(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE71

ASHGO_3.PE71         Location/Qualifiers
FT   CDS_pept        115355..117121
FT                   /codon_start=1
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20621892"
FT                   /locus_tag="ACL135W"
FT                   /orf_name="AGOS_ACL135W"
FT                   /product="ACL135Wp"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS51093.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000252747"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CQ4"
FT                   /transl_table=1
FT                   /translation="MAEEKFAQASEASTLDELKGPKLAAAGEGRGLRHTHSSTDQEAQS
FT                   VDWNYDGKHEGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILIAYSIM
FT                   GWVVFTVMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGWAYLFKYLVLTPNQLTAGA
FT                   LVIQFWIPAARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLCVMILLL
FT                   VLALGGGPTHDRLGFRYWSDPGAFKEYSKKDTHIKGGLGKFVAFLSVFVYALFAYLGTE
FT                   LCGIVAAECKDPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQASSAEVSA
FT                   AASPYVVAIENAVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAPKLFAR
FT                   TNKWGVPYNALACCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITYICFD
FT                   RAFRAQGIPKSTLSYVAPCQPYAGWVALIFCIFVALIKNFDAFIGKEVDVPTFITGYIG
FT                   LPIYIFCFIGYKIVHKTKWIPSKEVDLFTFKEAIDLEEEECIRERALMKEQLAKGGLSW
FT                   KKIYDNVLGWIF"
     atggcggaag agaagttcgc acaggcatca gaggcgtcca cgctggacga gttgaaaggc        60
     cccaagctgg ccgccgctgg tgagggccgc ggtctgcggc atacccacag cagcacagac       120
     caggaggcgc agtccgtaga ctggaactac gatggcaagc acgagggcat ccggctcaag       180
     aaggacctgc aggcacgtca tgtgtcgatg atagccatcg gcgggtcgct agggaccggg       240
     ctgctgatcg gcacgggcag ctcgctgatg cgagcgggac cggggtcgat cctgattgcg       300
     tacagcatca tggggtgggt ggtgttcaca gtgatgtcgt gcctggggga gatggcggcg       360
     tacattccgc tggacgggtt cacgtcttac gccacccggt acgcggaccc tgcgctgggc       420
     tttgccgtgg ggtgggcgta tctgttcaaa tacctggtgc tcactcccaa tcagctgacg       480
     gcaggcgcgc tagtgataca gttctggata cccgccgcac gggtcagccc gggcgtgtgg       540
     ataacggtgg tgctggcggt cattgtcgtg attaacacgg tgggggtgcg tttcttcggg       600
     gaattcgagt tctggctgtc tagtttcaag gtgctggtca tgctgtgtgt gatgatcctg       660
     ctgctcgtgc tcgccctcgg tggggggccg acccatgatc ggctgggatt ccgctactgg       720
     agtgaccctg gagcattcaa agagtattcg aagaaagaca cgcacattaa gggcggcctc       780
     ggcaagtttg tggccttctt gtcggtgttc gtgtatgccc tctttgccta cctgggtacc       840
     gaactgtgcg gtattgtcgc tgcggagtgc aaagacccgc gccgcaacgt gccccgcgcc       900
     atcaaactaa cgctgtaccg tatcgtggtg ttctacctcg tcaccatctt cctccttggc       960
     atgtgcgtcg cttataatga tccccttttg atgcaggcat ctagtgccga agtgtccgcg      1020
     gctgcatctc catacgtggt ggcgatcgag aatgctgtca ttcctgtcct tccaaatctg      1080
     ttcaatgcct gtgtgctaac ctttgtgttc agtgcctgca attcggacct gtatgttgga      1140
     agcagatccc tttacggcct ggcgatcgac gggaaggctc ctaagctctt tgccagaacg      1200
     aacaaatggg gtgttccgta caacgccctt gcatgctgca cactgttctg ctgccttgca      1260
     tacatgagtg tctcgaagtc tgccaggact gcatttggct acttcgtgaa tgtcacatcc      1320
     atcttcgggc taatgtcgtg ggtgtcgatt ctaatcacat acatttgttt tgacagggct      1380
     ttccgtgcac aggggatacc gaagtcgaca ctctcatacg tggcaccatg ccaaccatat      1440
     gcaggctggg tcgccctgat tttctgcatc ttcgtggcct tgattaagaa ttttgatgcc      1500
     ttcataggca aggaggtaga cgttccgacc ttcatcacgg gctacattgg gcttccaatt      1560
     tacatattct gctttattgg atacaaaata gtgcacaaga cgaagtggat accgtcaaag      1620
     gaagtggatc tcttcacatt taaagaagct attgacttgg aggaagagga gtgcatcaga      1680
     gagcgcgcat taatgaagga gcagcttgct aagggtgggt tgtcatggaa aaagatatat      1740
     gacaacgtgt taggatggat cttctga                                          1767
//

If you have problems or comments...

PBIL Back to PBIL home page