(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE75

ASHGO_3.PE75         Location/Qualifiers
FT   CDS_pept        124302..124613
FT                   /codon_start=1
FT                   /gene_family="HOG000292977" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15747776"
FT                   /locus_tag="ACL131W"
FT                   /orf_name="AGOS_ACL131W"
FT                   /product="ACL131Wp"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="glycerol ether metabolic process "
FT                   /protein_id="AAS51097.1"
FT                   /db_xref="GO:0006662"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG491141"
FT                   /db_xref="HOGENOM:HBG493509"
FT                   /db_xref="HSSP:1AUC"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI000025274B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CQ0"
FT                   /transl_table=1
FT                   /translation="MVSEIKSLSEFESAVGSDKLVVVDFYATWCGPCKMIAPMIEKFAT
FT                   QFQEASFYKVDVDAAAEVAHKYQITSMPTILFFKNGQAVDKVVGADVQSIRTKIAQHL"
     atggtgtccg aaatcaagtc cctttctgaa tttgagtccg ccgtgggctc cgacaagctc        60
     gtggtcgtgg acttctacgc cacgtggtgc ggtccctgca agatgatcgc gcccatgatt       120
     gagaagtttg ccacccagtt ccaggaggcg tcattctaca aggtggacgt ggacgcggcc       180
     gcggaggtgg cgcacaagta ccagatcacg tcgatgccca cgattctatt tttcaagaac       240
     gggcaggcgg tggacaaggt ggtcggcgcg gacgtgcagt cgatcagaac caagattgcg       300
     cagcacctgt ag                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page