(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_4

ID   ASHGO_4; SV 6; linear; genomic DNA; GRV; FUN; 1467287 BP.
XX
AC   AE016817_GR;
XX
DT   01-SEP-2009 (Rel. 111, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 18)
XX
DE   Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-
DE   1056) chromosome IV, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Eremothecium.
XX
RN   [1]
RX   PUBMED; 15001715.
RA   Dietrich F.S., Voegeli S., Brachat S., Lerch A., Gates K., Steiner S.,
RA   Mohr C., Poehlmann R., Luedi P., Choi S., Wing R.A., Flavier A., Gaffney
RA   T.D., Philippsen P.
RT   "The Ashbya gossypii genome as a tool for mapping the ancient
RT   Saccharomyces cerevisiae genome.";
RL   Science 304:304-307(2004).
XX
CC   This Genome Reviews entry was created from entry AE016817.6 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1467287
FT                   /culture_collection="ATCC:10895"
FT                   /organism="Ashbya gossypii"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /strain="ATCC 10895 = CBS 109.51 = FGSC 9923 = NRRL Y-1056"
FT                   /strain="ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome IV"
FT                   /chromosome="IV"
FT                   /db_xref="taxon:284811"
FT                   /db_xref="taxon:284811"
FT   source          13802..74366
FT                   /clone="BAC clone bAG1909"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          47762..103975
FT                   /clone="BAC clone bAG1245"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          78350..128182
FT                   /clone="BAC clone bAG1278"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          107269..168009
FT                   /clone="BAC clone bAG1240"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          174545..222107
FT                   /clone="BAC clone bAG2113"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          181005..224945
FT                   /clone="BAC clone bAG1163"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          224823..286051
FT                   /clone="BAC clone bAG1005"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          249920..316261
FT                   /clone="BAC clone bAG2006"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          299749..364233
FT                   /clone="BAC clone bAG1264"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          318911..391257
FT                   /clone="BAC clone bAG1827"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          373415..442712
FT                   /clone="BAC clone bAG1374"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          443286..522628
FT                   /clone="BAC clone bAG1493"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          541861..614767
FT                   /clone="BAC clone bAG1277"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          615387..679785
FT                   /clone="BAC clone bAG1147"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          638841..687359
FT                   /clone="BAC clone bAG1169"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          676754..749665
FT                   /clone="BAC clone bAG1281"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          715375..784145
FT                   /clone="BAC clone bAG1927"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          766021..845075
FT                   /clone="BAC clone bAG1656"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          786241..837889
FT                   /clone="BAC clone bAG1806"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          842093..896272
FT                   /clone="BAC clone bAG1696"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          849478..908586
FT                   /clone="BAC clone bAG1535"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          890960..968600
FT                   /clone="BAC clone bAG1203"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          951485..1020399
FT                   /clone="BAC clone bAG1251"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          977883..1023199
FT                   /clone="BAC clone bAG1920"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1020346..1087615
FT                   /clone="BAC clone bAG1492"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1082077..1141244
FT                   /clone="BAC clone bAG1586"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1088227..1134357
FT                   /clone="BAC clone bAG1327"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1176005..1229905
FT                   /clone="BAC clone bAG1480"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1213054..1262909
FT                   /clone="BAC clone bAG1212"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1225327..1292003
FT                   /clone="BAC clone bAG1050"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1297299..1360162
FT                   /clone="BAC clone bAG2102"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1311823..1375333
FT                   /clone="BAC clone bAG2004"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1375287..1449579
FT                   /clone="BAC clone bAG1153"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   CDS_pept        2278..3450
FT                   /codon_start=1
FT                   /gene_family="HOG000144380" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775025"
FT                   /locus_tag="ADL400W"
FT                   /orf_name="AGOS_AFR758C"
FT                   /product="ADL400Wp"
FT                   /protein_id="AAS51520.1"
FT                   /db_xref="HOGENOM:HBG025195"
FT                   /db_xref="HOGENOM:HBG058532"
FT                   /db_xref="UniParc:UPI00002528EC"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BG2"
FT                   /transl_table=1
FT                   /translation="MLAPFSEVLWWGACVHVWGLRPSTNEKDLERRTCSHSCTGTIVRF
FT                   LAQQSPLVRHKNCRLNPLFTLARCHVVAEMLRDTESKTSIEGHKVDAVNDTALKRYRYR
FT                   TAICWLFCYVCHVAFCNCVLARAVQLFKEEDSEKLLANLKNYAILNCYSFELMAQTIAP
FT                   AGRLMNGWKFTALALCSIYLIIFDPELLYVSGCLLNFFPSVKSWSLDAIAKYFIWEACV
FT                   LYSIVAWVPVAANFILICKYVLAEERAMELSLGAYFDEPDNDAMLENESFSLKRARVVH
FT                   NLKIIKMAVAGILFIHLLLQVFLFIIAYPASVLSEVSGKSGLYAYVLVGLLFATVVRLL
FT                   SILFCICYILVTSNCIRFLSSMILFVSVVQSDFVMGVCCSFILSTVSLVG"
FT   CDS_pept        complement(4367..7024)
FT                   /codon_start=1
FT                   /gene_family="HOG000166970" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750112"
FT                   /locus_tag="ADL399C"
FT                   /orf_name="AGOS_AFR757W"
FT                   /product="ADL399Cp"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAS51521.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058312"
FT                   /db_xref="HOGENOM:HBG590918"
FT                   /db_xref="InterPro:IPR004648"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniParc:UPI00002528ED"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BG1"
FT                   /transl_table=1
FT                   /translation="MEKLSGEFKGSPPYFNEDKDSSSLSPSLPSQDDKKYKYNVSADAQ
FT                   ETKEVLTEDQLIYITTRMGYEHATDLEHIPESVRYLESKLADLDVEKCCEIIDVHIKEH
FT                   DQDPNLSTEDWNDLVRFSKRDFDPKNPQQVFELKVVAAIFHYYSPYVEVRAVASPVDDP
FT                   TIPVETFRAYFLATLWVVIGSGFNMFFAQRQPAISLGVFAVQMLVYPCAVLWVRVMPCW
FT                   GFKVFGRRIALNIESQWSEKEQMFVTLLYSITNGAFYSEYNIVTQQIHYKSPMSYAYQF
FT                   LLSFSLQFLGFGLAGIMRRYVVYPSIALWPSSMTTIALNKALLSSDHSNGIGRKKMFYI
FT                   TATAIFVYNWFPTYLFEALSTFNWMTWIKPDNFSLATVTGGINGVGLNPISTFDWTNIG
FT                   TSSLYLPFRVTLTTYLGGLLAALVTLGVYYMNYRECQFLPIFTQSLYNNRATSYRVEEI
FT                   LTEDRKLDEQKFQKYGFPYYTAGNIVAYGCFMCVYTALVVTSILQQGAFYGRVYKTWIL
FT                   DLWSLRKPSSWRAVFSNDKHVLDDFHDSHSRMMRKYKEVPEWWYMTIFIVSIVIGIIVV
FT                   KVFKTNTPVWGLFLAVALNFVLLLPITLLQATRGVTIGLNLLLQMISGLALPGNPYALM
FT                   FIKAFGYNIDGQADNYLGNMKLAHYAKIPPVPLFRGQLLMVLIQIFVNLGVINWQLHNI
FT                   ENYCDPKQRFKFTCPGIRTYFNASVMWGAIGPKRIFEHVYPIMKWCWLIGACVGLFFGL
FT                   WKKLSIMYKKIPYPDRFSPVIFIIGMLSFGPPYNLQYTTSGLYVGFISMCYMKRYHLRV
FT                   WERYNYVVAAGISCGLVFSAIVMFFTVQWKGVEISWWGNTVSYAGLDYARVPLLNVTET
FT                   ERGYFGPELGQIPG"
FT   CDS_pept        complement(9082..9546)
FT                   /codon_start=1
FT                   /gene_family="HOG000144416" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750113"
FT                   /locus_tag="ADL398C"
FT                   /orf_name="AGOS_AFR756W"
FT                   /product="ADL398Cp"
FT                   /protein_id="AAS51522.1"
FT                   /db_xref="HOGENOM:HBG058172"
FT                   /db_xref="HOGENOM:HBG202312"
FT                   /db_xref="UniParc:UPI00002528EE"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BG0"
FT                   /transl_table=1
FT                   /translation="MKFISSMLLGAAALANVALADSEEFNFLGLRSGSKFHFSSVHADN
FT                   GALKLGGKGEALSAVITDNGKLRLSDGKYAVVTASGPIIEGSEQDASTGFSVAEGYLKY
FT                   AGNSAFVPISVGDSYELSVRPMDPSDIAISIRAQSKTNVGAAIPDFLANL"
FT   tRNA            join(10299..10335,10345..10388)
FT                   /gene_name="tRNA-Leu"
FT   CDS_pept        complement(10438..11022)
FT                   /codon_start=1
FT                   /gene_family="HOG000184663" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059054"
FT                   /locus_tag="AGOS_ADL397CB"
FT                   /orf_name="AGOS_AFR755W"
FT                   /product="ADL397C-Bp"
FT                   /function="FMN binding"
FT                   /protein_id="ADJ41757.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniParc:UPI0001DB2770"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGB4"
FT                   /transl_table=1
FT                   /translation="MSSAYWHSIATMKSIFSLVTCFLALVTSAFAQASQEEQQAAVQLR
FT                   KLIKDESSFQLTTINQNGTPYGIRMYYISPDRCEGVEHDGQPIFLMVDTTLQQVNAKNN
FT                   NNVSFSVASISIEDPMKAPRANFAGELEVLQPIPALQKCFADVHPDAKPWIPSGPSPVK
FT                   FYRFKIKSIYYVAAKAGYNGYIDPALYANAN"
FT   CDS_pept        complement(12264..12926)
FT                   /codon_start=1
FT                   /gene_family="HOG000184663" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059055"
FT                   /locus_tag="AGOS_ADL397CA"
FT                   /orf_name="AGOS_AFR754W"
FT                   /product="ADL397C-Ap"
FT                   /function="FMN binding"
FT                   /protein_id="ADJ41758.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniParc:UPI0001DB2771"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGB5"
FT                   /transl_table=1
FT                   /translation="MPCYTTLVIYIIAHSWVSIQLCFSIKERYNTTMTNFLYLVTAFIS
FT                   FASVALTAQSEKEAAAELRSLMSKEKTSFLNTITATDGRPFSLVHYHVSTDRCEGMEKT
FT                   GEPILIVVDKSPQSHSIRNNGPASFSINDNSIQYKMNGVRSTFYGSFEEQQPTDELKKC
FT                   FLSVHPDSQALIPGFNPKLPTRFYKLKISGIFNVPGAATNGYHGAVSPSLYAAAVPA"
FT   tRNA            complement(15464..15537)
FT                   /gene_name="tRNA-Val"
FT   CDS_pept        complement(15929..16441)
FT                   /codon_start=1
FT                   /gene_family="HOG000112974" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775026"
FT                   /locus_tag="ADL397C"
FT                   /orf_name="AGOS_ADL397C"
FT                   /product="ADL397Cp"
FT                   /protein_id="AAS51523.1"
FT                   /db_xref="HOGENOM:HBG128038"
FT                   /db_xref="HOGENOM:HBG204144"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniParc:UPI00002528EF"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BF9"
FT                   /transl_table=1
FT                   /translation="MSFNSPFFDFFDAINNEVANYNRLLGRGHSSSAVTKHGKKDTTDW
FT                   LTNARIIPPVDVLEQEKDYEVHVSVPGIVDQDKISIEFHSDRGELVISGEVPTKETEEN
FT                   KDGWRVRERATGSFRRVVGLPDKPGVDAEHITANYEHGVLTLRVPKLEPRENQAVRKIQ
FT                   VGRGSAK"
FT   CDS_pept        join(17117..17121,17570..18149)
FT                   /codon_start=1
FT                   /gene_family="HOG000094457" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622481"
FT                   /locus_tag="ADL396W"
FT                   /orf_name="AGOS_ADL396W"
FT                   /product="ADL396Wp"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51524.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG058736"
FT                   /db_xref="HOGENOM:HBG398068"
FT                   /db_xref="InterPro:IPR002164"
FT                   /db_xref="UniParc:UPI00002528F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BF8"
FT                   /transl_table=1
FT                   /translation="MRARALEALAECEREREREERALEVERQRRLGPVYARRSKAIEGI
FT                   AGFWGIVLTQHGEFANYVRAADWRYVEAIRRVEVEWAGAGAWDFAITVEFGEVEGRLRA
FT                   QSVRKQFTVGEDGEVRSAAVEMEWPKRYDGTFFAWFRWTGERPGEEFANGDELARLFSE
FT                   ELFPYCVRYYAEAQRDVEEEEEEEEEEEDMY"
FT   CDS_pept        complement(18171..18497)
FT                   /codon_start=1
FT                   /gene_family="HOG000279813" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775027"
FT                   /gene_name="SUI1A"
FT                   /locus_tag="ADL395C"
FT                   /product="Protein translation factor SUI1 "
FT                   /function="translation initiation factor activity "
FT                   /biological_process="regulation of translation "
FT                   /protein_id="AAS51525.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0006417"
FT                   /db_xref="HOGENOM:HBG012772"
FT                   /db_xref="HOGENOM:HBG522548"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005874"
FT                   /db_xref="UniParc:UPI00002528F1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755R1"
FT                   /transl_table=1
FT                   /translation="MSIENLKSFDPFADTGDDEASSSNYIHIRIQQRNGRKTLTTVQGI
FT                   PEEYDLKRILKVLRKDFGCNGNMVKDDEMGEIIQLQGDQRAKVCEFLITQLAIPKKNIK
FT                   IHGF"
FT   CDS_pept        join(complement(18799..18861),complement(18553..18738))
FT                   /codon_start=1
FT                   /gene_family="HOG000144415" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22059056"
FT                   /locus_tag="AGOS_ADL394C"
FT                   /orf_name="AGOS_AFR643C"
FT                   /product="ADL394Cp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="transcription regulator activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51526.3"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG058838"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="UniParc:UPI0001DB2772"
FT                   /db_xref="UniProtKB/TrEMBL:Q752D3"
FT                   /transl_table=1
FT                   /translation="MSSIEETAQAIQAICSVLLGERRRTVLPKETKEFLESVFERKRCP
FT                   NAKERRAIAEKCGLTPIQIRIWFTNKRMRSKTRGARF"
FT   CDS_pept        18965..19393
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750114"
FT                   /locus_tag="ADL393W"
FT                   /product="Putative mating-type transcription factor "
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51527.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG058893"
FT                   /db_xref="UniParc:UPI00002528F3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q755R3"
FT                   /transl_table=1
FT                   /translation="MTRTINLQLPKRTSTYSSNFLKPAGCPKYEFVEGSKKPSRPRNKF
FT                   IIMRTIFHNSSSKIVSAIWKHSPDQFQKYFQLLAEFEQNWHKHNHSPAAALTDAEAFRV
FT                   IARSLHPQPRVIKRRQQKKKVKMLCGRFSRIEDVFSSL"
FT   CDS_pept        19374..19643
FT                   /codon_start=1
FT                   /gene_family="HOG000142000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059057"
FT                   /locus_tag="AGOS_ADL393WA"
FT                   /orf_name="AGOS_AER455CA"
FT                   /product="ADL393W-Ap"
FT                   /protein_id="ADJ41759.1"
FT                   /db_xref="UniParc:UPI0001DB2773"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGB6"
FT                   /transl_table=1
FT                   /translation="MFLVPCKVRYSGPTAEFQSLNHIRGRKIVGKDILSKFPDSNAYLA
FT                   RPDNVATLNAILNCERDGNDQRLLSELHKFHENLDLNDAIHAST"
FT   tRNA            20996..21068
FT                   /gene_name="tRNA-Val"
FT   CDS_pept        21270..23027
FT                   /codon_start=1
FT                   /gene_family="HOG000177996" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079269"
FT                   /locus_tag="ADL392W"
FT                   /orf_name="AGOS_ADL392W"
FT                   /product="ADL392Wp"
FT                   /function="hydrolase activity"
FT                   /biological_process="nucleotide catabolic process "
FT                   /protein_id="AAS51528.1"
FT                   /db_xref="GO:0009166"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG434271"
FT                   /db_xref="HOGENOM:HBG736951"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR014485"
FT                   /db_xref="UniParc:UPI00002528F4"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BG4"
FT                   /transl_table=1
FT                   /translation="MKFLNIGLLLAGATAAIVPDDVDKDTDSADSISLRELKLGQLNFL
FT                   HTTDTHGWLGSHVSQPDYDATWGDYVSFAQRFRERVKDKDLILIDSGDKRTGNGLSDLT
FT                   SPMGLKSSGIFNLQKLDLLTLGNHELYTEDVVRLEYYGTAMEPELSDKYVTSNVEFITE
FT                   DGDVYPFGNKYRYFETPNQNLRVLAFAFMFDFPWAAKNVRLTPLAEEVKKDWFTQTVEK
FT                   YPADKLDIIVVFGHLPVTRGENEELLQLHKRLRESYPDTIIQYFGGHTHVRDFVVLDEK
FT                   ATALQSGRYSETVGFLSIDDVAKEKPEFFRSYMDFNLRSFMHHSGYKNIEEFRTKDGEY
FT                   VNAQIEELREKLGLNTVFGYVPEDYYLDAEPIESPNNIYNFLTNKILPTLRSDAYDETV
FT                   SRFIMINTGSMRYDLYRGNFTADVEYIVTPYQNDWKYIEVPTKLGGILAAYMNSGKPIF
FT                   TSIANELPRLSRRDSRCPVITDANLSRGYTTADDAGCTGDDTPHQSTPSYPVPNVVQSV
FT                   EINEEAGEDGTAHLVFYSFMEKRIVVALNELNILQKVTTKTYSAADVKLYGGPNSRQLL
FT                   RNYFKSLSY"
FT   CDS_pept        join(complement(24597..24610),complement(23596..24367))
FT                   /codon_start=1
FT                   /gene_family="HOG000231325" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775028"
FT                   /locus_tag="ADL391C"
FT                   /orf_name="AGOS_ADL391C"
FT                   /product="ADL391Cp"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS51529.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG007973"
FT                   /db_xref="HOGENOM:HBG392118"
FT                   /db_xref="InterPro:IPR000876"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR013843"
FT                   /db_xref="InterPro:IPR013845"
FT                   /db_xref="InterPro:IPR018199"
FT                   /db_xref="UniParc:UPI00002528F5"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BG3"
FT                   /transl_table=1
FT                   /translation="MARGPKKHLKRLAAPHHWLLDKLSGCYAPRPSAGPHKLRESLPLI
FT                   VFLRNRLKYALNGREVKAILMQRHVKVDGKVRTDTTYPAGFMDVITLEATNENFRLVYD
FT                   VKGRFAVHRITDEEATYKLGKVKRVQLGKKGVPYVVTHDGRTIRYPDPNIKVNDTVKVD
FT                   LATGKITDFIKFDTGKLVYVTGGRNLGRIGVITHRERHEGGFDLVHIKDSLENTFVTRL
FT                   NNVFVIGEQGRPWISLPRGKGIKLSIAEERDRRRAQQGL"
FT   CDS_pept        25176..27626
FT                   /codon_start=1
FT                   /gene_family="HOG000247966" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928044"
FT                   /locus_tag="AGOS_ADL390W"
FT                   /product="ADL390Wp"
FT                   /function="calcium ion binding"
FT                   /function="mannosyl-oligosaccharide 1,2-alpha-mannosidase
FT                   activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS51530.2"
FT                   /db_xref="GO:0004571"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG058539"
FT                   /db_xref="InterPro:IPR001382"
FT                   /db_xref="UniParc:UPI0001DB278E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BF4"
FT                   /transl_table=1
FT                   /translation="MNWEDILCAIFCSLFFAVVAASELFSPFSFNKYELEHYKNEIRSL
FT                   FYHGYDQYLQHGYPFDEVRPISCVPNKRNFQDPYDISTNDVLGNFTTTLIDSLTTIAVM
FT                   GDVDKFLEGVELVNKVIPADFSLNVTVQVFETTIRLVAGLMSAHLYAVDPTKKVYLGSQ
FT                   YDGHLLAKAKKLADRLLPAYLTETGLPVPRVNLANGLEGVPEELLQENNAAASASPMLE
FT                   FTMLSYLTFDEKYRLIARYAFNKTWSLRSDLNLLPMSFNPHTEDVYHPMTGVGASIDSF
FT                   YEYAIKGSILFDDSDLHSVWETAYYALSVYSKSDWFFQNVHTATGDIVTPWIDSLSMFF
FT                   PMLQVLHGDIADAELKNLMSLKLWNTYGGIPERWLFTTLYKKQQVTVNDTVQLEWYPLR
FT                   PEFVESTYSLYRATKDAFYLNIGRSILQALSTRFKTKCGFAGIQNVITGEPHDRMESFV
FT                   LGETLKYLYLLFDVSNELHTQKRTNQIFSTEAHPLWLTASMKARYEKNKYCENDVYIQN
FT                   LRRLQELDQLKSRANSSTAEEAMIPAPDFKTEDSEESLKDRVAAPILEASHVEYDHVRG
FT                   TCRPLRRNKSAFYDSHLLNHFHRLFEIDYRYNVTLLRPHWMRSQHAIELESGFYRRWST
FT                   AAAQSQLATNTVSLELILDGANRPLFPPQSTRDCFYRYFPALRCSRLRVERITPNATSS
FT                   YGLQVAPAAFCGLSYESIAGPACDRSLPEFLLLTAVDGQAIAQEEVVLVDYEDLFGPHA
FT                   LHLKHVLGYNAQHQLLLNCVPVVNVYVQWSGHAAKAHFGSCRTAALHNPAQDFQCSPLH
FT                   NRID"
FT   CDS_pept        28136..30271
FT                   /codon_start=1
FT                   /gene_family="HOG000233033" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750115"
FT                   /locus_tag="ADL389W"
FT                   /orf_name="AGOS_ADL389W"
FT                   /product="ADL389Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS51531.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG330930"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HSSP:1A06"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="InterPro:IPR018029"
FT                   /db_xref="UniParc:UPI00002528F7"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BF3"
FT                   /transl_table=1
FT                   /translation="MMNFFSKNQPSAHEQQDRPRSTANGFFPSFTHTATPTTALSENSY
FT                   AIGTTGLNAGKQENVLTHMKEINRQDSYQNDHSQPPQQIFPQTSSHQSHTLKDHLTVTK
FT                   PPPAVPPMAPENADKSASDSNMPRGKLKVTIVKAKDLLTSSDQTQPYVVCTYESSEFIS
FT                   DGPESIDHTQRTHNARWGNRMAANEKNVRPLYTRQSSSQLDKLAAHHNYNTTSSNPVWH
FT                   HETTFDVIGARSELEISVYDAAHGDVFLGQVRLRPNTHTKHDVHNQWSKLNGRTVGESV
FT                   SGEILVRWEYWHTEKRHYGPQDFEVLRLLGKGTFGQVYQVRKKDTKRIYAMKVLSKKVI
FT                   VKKNEIAHTIGERNILVRTASKSCPFIVGLKFSFQTPTDLYLVTDFLSGGELFWHLQKE
FT                   GRFTEERAKFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLKD
FT                   RTNTFCGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKIA
FT                   FGKVKFPRDVLSPEGRSFVKGLLNRNPKHRLGAVNDGAEVRAHPFLSDIDWEALRNKQI
FT                   PPPFKPHLTSETDTSNFDPEFTQTSTSFMNKQPIAATPLSPAMQAKFAGFTFVDESAIE
FT                   EHNANYNSRKFLQNSYFMEPGSFIPGDPTMPPAEDVIEDGDDDSMDLASKGNTDHLQPD
FT                   YNDHHMDDDFVSGRFEI"
FT   CDS_pept        30850..32298
FT                   /codon_start=1
FT                   /gene_family="HOG000248776" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750116"
FT                   /locus_tag="ADL388W"
FT                   /orf_name="AGOS_ADL388W"
FT                   /product="ADL388Wp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="two-component response regulator activity "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="response to stress"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51532.1"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG058548"
FT                   /db_xref="HOGENOM:HBG397302"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014402"
FT                   /db_xref="UniParc:UPI00002528F8"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BF2"
FT                   /transl_table=1
FT                   /translation="MAEEIQMMGGMEVGKKLPAAQKGCVPRGNGSRAAYNDFVRKLFAI
FT                   LESGEYTDIISWTKEGNSFVVVDTNEFTTNILPKHFKHSNFSSFVRQLNKYDFHKVKRT
FT                   PEERQSSVYGEHSWEFQHPRFRRNDEAALDRIKRKTVTQKKVSLTDDMLAGHQRVGNGA
FT                   VAFPAMDLGATTNLLLNNTINKTKFSQLKKRVDSIELHNQQLRAENNSLKIEFQKMSSR
FT                   YNSMVENLVSLKNYNNSLVENFNLLVSTLAQQGLKVPHPLNLGNYASSQVAKNSSASDV
FT                   QPHVSPLGTVAPTSIPLAQATPSKEEANPPTSLRPGFHVLLVEDDSVCIQLCSKFLRKY
FT                   GCSVEVVTDGLSAIETVEKFQYDLVLMDIVMPNLDGATATSVIRSFDNQTPIIAMTGNI
FT                   EDQDLVTYLQHGMNDILAKPFTKDDLHSMLVRYLKDRIPLTEQASVVGTAQSGAQPPLL
FT                   KEEQGGIQDQVLLQGEPLLKKPRV"
FT   CDS_pept        complement(32499..33965)
FT                   /codon_start=1
FT                   /gene_family="HOG000074714" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18928045"
FT                   /gene_name="SET5"
FT                   /locus_tag="ADL387C"
FT                   /product="Potential protein lysine methyltransferase SET5 "
FT                   /EC_number="2.1.1.-"
FT                   /function="methyltransferase activity"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51533.2"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG058551"
FT                   /db_xref="HOGENOM:HBG397508"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniParc:UPI0001DB278F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75BF1"
FT                   /transl_table=1
FT                   /translation="MGQSSLKLETIPLNDCHFSDAAPVGSVIPTESEVYDAVAQLWRQE
FT                   PELERAGWEEWRARLKAIHPGWSLSVAHICRTLEKHCMSITGITQFTYHELVTSKESPA
FT                   LREPHLAKVQVTWSEKGKGLVARRPLAKGELVFAEDALSFIPPLEKSTLVHLSKACGSC
FT                   GTSLSQNRYYYVMNNLDCDNCTTIWCTKGCRNLDTTHDFLKHPMSRNKRCSAQKWLKFE
FT                   QFCKENTWHSAYSVGVMFARYYLHSDRRLQGNFESLAEVSQRVRLHAADTMNSGAAFDL
FT                   GVDLTANAQSVCMWEEGYGLFCDAFPLAKDEYDLDFEKFLRYVGKFNLNQVNGQIYMLL
FT                   SHLNHSCEPNIYYELEGHHINVYARKEIKSDEELTVSYVNPLHDVDLRRRELRVNWGFL
FT                   CLCDRCKREISKKNIDKAGHSSTTAGPEPQSYRGHRRKSSLRASKPTLQDLLENGKEFD
FT                   IEIPSQPGFAARRASVRFDSKVVTAVEERQ"
FT   CDS_pept        34065..34835
FT                   /codon_start=1
FT                   /gene_family="HOG000112619" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750117"
FT                   /locus_tag="ADL386W"
FT                   /orf_name="AGOS_ADL386W"
FT                   /product="ADL386Wp"
FT                   /protein_id="AAS51534.1"
FT                   /db_xref="HOGENOM:HBG058556"
FT                   /db_xref="HOGENOM:HBG203717"
FT                   /db_xref="UniParc:UPI00002528FA"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BF0"
FT                   /transl_table=1
FT                   /translation="MMAYKYPVGAARRQLQANIRTCKAIVNILVRKASYTTGRQFAVAR
FT                   RPPKWYGLGIFGASFGLGWLITQHLSYADLMAWLFYDQLPADDEKVRNYQAGLLQRAHE
FT                   LPATKDLFESGFRQVFPERGQRNVLINQTLRRPGALSIEPLFFYNPKTKTTVGIYHLGM
FT                   RLTGYPFLVHGGILATVLSDLMREAVTFVTGTDYEVTEHIKISYCFPTLANQFVVVRTT
FT                   RVEDHGNNVRLEAEIINQSGTRTLVRAKGSFTTG"
FT   CDS_pept        complement(34842..35498)
FT                   /codon_start=1
FT                   /gene_family="HOG000007299" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750118"
FT                   /locus_tag="ADL385C"
FT                   /orf_name="AGOS_ADL385C"
FT                   /product="ADL385Cp"
FT                   /function="5-formyltetrahydrofolate cyclo-ligase activity "
FT                   /function="ATP binding"
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /protein_id="AAS51535.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="GO:0030272"
FT                   /db_xref="HOGENOM:HBG325345"
FT                   /db_xref="HOGENOM:HBG507167"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="UniParc:UPI00002528FB"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BE9"
FT                   /transl_table=1
FT                   /translation="MSKRTLRTQLKQALDAVPKPALLEQGQQVLLALEPVLQQHRSFAC
FT                   YLNMDSGEAPTEAILERLFQLGKDVYLPRCTDSSASGIAGAGSHMRRHLTFYHMQSMAA
FT                   VRALRPQGKYGLREPPAEAPPPALPDVDVVLMPGLGFCADTGARLGRGAGYYDNYVSRT
FT                   QQLHGRRPLLVGLALSQQLMLHVPLEPHDQCLDAVACGDGQLRWAQRAPGEIVDI"
FT   CDS_pept        35747..36877
FT                   /codon_start=1
FT                   /gene_family="HOG000276704" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750119"
FT                   /locus_tag="ADL384W"
FT                   /orf_name="AGOS_ADL384W"
FT                   /product="ADL384Wp"
FT                   /function="branched-chain-amino-acid transaminase activity "
FT                   /biological_process="branched chain family amino acid
FT                   metabolic process"
FT                   /protein_id="AAS51536.1"
FT                   /db_xref="GO:0004084"
FT                   /db_xref="GO:0009081"
FT                   /db_xref="HOGENOM:HBG424074"
FT                   /db_xref="HOGENOM:HBG617123"
FT                   /db_xref="HSSP:1A3G"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="UniParc:UPI00002528FC"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BE8"
FT                   /transl_table=1
FT                   /translation="MSTAELDASKLKVIRKEEPTVFEQNADFTFGRLFIDHMLVVEWKR
FT                   ESGWQAPEIRPYGNLSLDPSACVFHYGFELFEGMKAYRTEDGRVTLFRPEMNAARMNRS
FT                   AARIGLPQFDAEQLVELIGKLVELDRQFVPQRPGYSLYIRPVMIGTSASLGVTAPDSAL
FT                   LYVIACPVGPYYKSGFSAVRLLATDNVTRAWPGGFGDKKLGGNYAPCIPSQEEAARLGY
FT                   HQNLWLFGPEKYITEVGTMNAFFVFKDSTTGKKELVTAPLDGTILEGVTRDSVLTLARE
FT                   RLSPEEWDVSERYYTISEVAERAAKGEVVEAFGCGTAVVVSPIKEIGWNDQAIKIPLLP
FT                   GEETGEFTKQVAHWISEIQYGKVEYNNWSRTIADLK"
FT   tRNA            37469..37539
FT                   /gene_name="tRNA-Gly"
FT   CDS_pept        37638..38825
FT                   /codon_start=1
FT                   /gene_family="HOG000141916" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079270"
FT                   /gene_name="ASA1"
FT                   /locus_tag="ADL383W"
FT                   /orf_name="AGOS_ADL383W"
FT                   /product="ASTRA-associated protein 1 "
FT                   /biological_process="chromatin modification"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51537.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="HOGENOM:HBG058575"
FT                   /db_xref="HOGENOM:HBG103877"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00002528FD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75BE7"
FT                   /transl_table=1
FT                   /translation="MRFTLRAHVSTVTDLKPVSHRQTPHLLSADSKGCLYLWNLISRRP
FT                   IASIDLKTHIIAIEVVGQGLYAALARDNKLRFISLQEESRLTRINDKVSRELQSLEIVY
FT                   EIPVNCLNFANFALQDLGLRNYRLWCCNTMDAESIDVYEFQLGDRQSFKRTFNAINLFD
FT                   SVAGLAEAKQKFRFDKMGIVMRFIVAGDTVFCGYESGVVVGLRIRDKSLQICYASFAHY
FT                   PEPVLSLAHDRTERRVFSSSTTDQVCVHNIPTPDLPVVTSVSGIQVVANAGTREEVINA
FT                   PLKKIGHLAVLNDILLLTSWHGYVLGLQDQKELFRYRKERNLLCVDDSTDGQAETKKEK
FT                   PWINPGPIAGIAHSTDSQLVLEKLPIGGHRRLKNFLEHKWYITGYNDGTITVSQI"
FT   CDS_pept        complement(38868..40217)
FT                   /codon_start=1
FT                   /gene_family="HOG000094453" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750120"
FT                   /locus_tag="ADL382C"
FT                   /orf_name="AGOS_ADL382C"
FT                   /product="ADL382Cp"
FT                   /protein_id="AAS51538.1"
FT                   /db_xref="HOGENOM:HBG058580"
FT                   /db_xref="HOGENOM:HBG398062"
FT                   /db_xref="UniParc:UPI00002528FE"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BE6"
FT                   /transl_table=1
FT                   /translation="MSVASEKPIRLAVLGGSCTGKTSFISRLTVDIVREAHYPTRKQNN
FT                   WLFTFNPTDPLARAILDEKAHERYYYSDEHAVPEPVFRTPSITDHVLLSPPVYQSFIQN
FT                   YQMVKHALAVGQRLADQRTLLKSDNQYYQYKNEDVGHGPDSCSRRTARLQERTRRRGAV
FT                   DRCLPSNYTPPRYSSISIDIIDTPAYDPDMVIPFLEVSLFSNLDKSILRGLADHPRKPV
FT                   STQSLLVASGASELNGKVDGYIFVYSALPELNYAEPPSYDSLNRVSGGVGQAPAQGQAV
FT                   EYKRTSAQDGGFSLLSSIRACFLDAWTEFRNYQRRAAQIKEGDIYSLMYSLKQAWKPDP
FT                   QATGKDKGTRELSASLDQIDLNPDSPNSPPPMLIICTHILDPLHSPLLVEHGKRLAVEW
FT                   KCAFVALDSMSDFNVDVAMACIIRDIVEKEKLLNKHITKKKGVLHKIIKG"
FT   CDS_pept        40547..41473
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079271"
FT                   /gene_name="ATG14"
FT                   /locus_tag="ADL381W"
FT                   /product="Autophagy-related protein 14 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS51539.1"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG058584"
FT                   /db_xref="UniParc:UPI00002528FF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75BE5"
FT                   /transl_table=1
FT                   /translation="MQCTICHRPSTVWYCAHCVNTSPKLILRYKLELTQICEEVTEMRD
FT                   IVTSTLENAISEKEGLLGKHMERLQHLRLKRYNARLSHRARELEQHLDSKLSRRDGLRR
FT                   ALKQLSPDVAVVPAEDPDEYRELRHKLTLLQNVVSMKSTQKFEELCQWFVFTCSTTEDD
FT                   HFPYSIRFIPVCNIRNWRLLSTAQESLQHMCEFVIYASRALLVDIPFGSHSEKLTTDHI
FT                   AAVSHFTVNLLTILIKRKRLQERPDVPDLLGRYDIDGLLYLLCSGGDVESITGTCPPTY
FT                   KVVHEFVRTALEDGDQSEERGHWMVLE"
FT   CDS_pept        41757..43307
FT                   /codon_start=1
FT                   /gene_family="HOG000165320" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750121"
FT                   /locus_tag="ADL380W"
FT                   /orf_name="AGOS_ADL380W"
FT                   /product="ADL380Wp"
FT                   /function="ATP binding"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="plasma membrane ATP synthesis coupled
FT                   proton transport"
FT                   /cellular_component="proton-transporting V-type ATPase, V1
FT                   domain"
FT                   /protein_id="AAS51540.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0033180"
FT                   /db_xref="GO:0042777"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG389886"
FT                   /db_xref="HOGENOM:HBG565875"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005723"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="UniParc:UPI0000252900"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BE4"
FT                   /transl_table=1
FT                   /translation="MISDNELFALNKQAATAGLKAKPRISYNTVAGVNGPLVILERVKY
FT                   PQYNEIVNLTLPDGSIRQGQVLEVRGDRAIVQVFEGTSGIDVKKTTVEFTGQSLKIPVS
FT                   DDTLGRIFDGSGRPIDNGPKVFAEDYVDINGSAINPYARIYPEEMISTGISAIDTMNSI
FT                   ARGQKIPIFSASGLPHNEIAAQICRQAGLVRPTKDVHDGHEDNFSIVFAAMGVNLETAR
FT                   FFKQDFEENGSLERTSLFLNLANDPTIERIITPRLALTTAEYLAYQTERHVLTILTDMS
FT                   SYADALREVSAAREEVPGRRGYPGYMYTDLSTIYERAGRVEGRNGSITQIPILTMPNDD
FT                   ITHPIPDLTGYITEGQIFVDRQLSNKGIYPPINVLPSLSRLMKSAIGEGMTRKDHGDVS
FT                   NQLYAKYAIGRDAAAMKAVVGEEALSMEDRLSLEFLENFEKTFISQGAYENRTIFESLD
FT                   HAWSLLRIYPKEMLNRISPKILDEFYNRARDSDADDADDDEEDDDSDESHQEAERSLI"
FT   CDS_pept        complement(43797..45395)
FT                   /codon_start=1
FT                   /gene_family="HOG000141915" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750122"
FT                   /locus_tag="ADL379C"
FT                   /orf_name="AGOS_ADL379C"
FT                   /product="ADL379Cp"
FT                   /protein_id="AAS51541.1"
FT                   /db_xref="HOGENOM:HBG058596"
FT                   /db_xref="HOGENOM:HBG103879"
FT                   /db_xref="UniParc:UPI0000252901"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BE3"
FT                   /transl_table=1
FT                   /translation="MEYTDPILSHFADKSSLDAAKLGELLEAQRVESRARGEEAREEAA
FT                   LRQCEATLSMYTDLIKLKVLLRKTWDLQALDKSVQVRFGPAGAGEAKELTRPTEDFYRD
FT                   IALKTVAKCDKISKALEQLTVDSHATIHAIQEFSHGQAHEYYMRDSVCLLLEMWFLCGN
FT                   LLRELKRSVASFFMKAKLLLVDHELECIQSSISGHAAQEQYHALSETISSYNSFIRVLL
FT                   QQLQDAENSGDQSLFEDCLGVFLDVESMYQSLNMTWLLRENRLLQADITAIEREQFDRE
FT                   EQRNAERIGQLVDEAVHKDTHTGDADATSVVFDASEDTIVADQCIEKSQLGSSGTLAPP
FT                   VVANRTDNERSELLSNLEQTSISQELPNLLKAFNNAKRLELELENVRMSPETRSPMGSP
FT                   RSPAMTDSALQHHSPTLQASTYGRMSSSTSPRARTFTSLKDTTPALLLPPGMNSNPCRM
FT                   GPSLAGSSILEGLGHKKQDTKSGDDKAIPATKLKQDMMKLMTSNSVLQHGAPQAPIYGF
FT                   GSNVLNNLYGIRSRK"
FT   CDS_pept        46376..47860
FT                   /codon_start=1
FT                   /gene_family="HOG000191477" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750123"
FT                   /locus_tag="ADL378W"
FT                   /orf_name="AGOS_ADL378W"
FT                   /product="ADL378Wp"
FT                   /function="alpha,alpha-trehalose-phosphate synthase (UDP-
FT                   forming) activity"
FT                   /biological_process="trehalose biosynthetic process "
FT                   /protein_id="AAS51542.1"
FT                   /db_xref="GO:0003825"
FT                   /db_xref="GO:0005992"
FT                   /db_xref="HOGENOM:HBG287181"
FT                   /db_xref="HOGENOM:HBG559076"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR012766"
FT                   /db_xref="UniParc:UPI0000252902"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BE2"
FT                   /transl_table=1
FT                   /translation="MTEEVRKQAQQLTLDTQRSEEHSGNVVVVSNRLPVTIKKNDSGEY
FT                   EYSMSSGGLVTALQGLKKSTKFQWYGWPGLEIPEGDREQVQRDLLEKFNAIPIFLSDEL
FT                   ADLHYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANRAFAEAIQKNLRDDDIVWVHD
FT                   YHLMLLPELLRNYIATANLQNVKLGWFLHTPFPSSEIYRILPVRQEILRGVLSCDLLGF
FT                   HTYDYARHFLSSVHRILNVNTLPNGVKFQGRFVNVAAFPIGIDVNNFTEGLQKESVVQR
FT                   VKQLKETFKDCKIIVGVDRLDYVKGVPHKLHAIEVFLNEHPEWIGKVVLVQVAVPSRGH
FT                   VEEYQYLRNVVNELVGRINGQFGTVEFVPIHFMHKSVPFEELISLYSISDVCLVSSTRD
FT                   GMNLVSYEYIACQAENKGSLILSEFTGAAQSLNGAFIVNPWNTDELAEAIHESLTLPIE
FT                   KREANWEKLYKYISKYTSSYWGETFVHELYKLSSQK"
FT   CDS_pept        48319..49587
FT                   /codon_start=1
FT                   /gene_family="HOG000233896" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079272"
FT                   /locus_tag="AGOS_ADL377W"
FT                   /product="ADL377Wp"
FT                   /function="metal ion binding"
FT                   /function="protein serine/threonine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="protein serine/threonine phosphatase
FT                   complex"
FT                   /protein_id="AAS51543.2"
FT                   /db_xref="GO:0004722"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008287"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG394483"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniParc:UPI0001DB2790"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BE1"
FT                   /transl_table=1
FT                   /translation="MGQLLSHPLTEKTIVYNDYLLEANGKHANLPDGSMKPYAKERHHR
FT                   HLHLRRQFTENKSQEVVLTDTSSEITKEHASCTQFFNCVGSMQGYRMTQEDAHLVSNCD
FT                   TQLVASFRNPMNNNAVEKLRISVFGVFDGHGGDECSQFLADSEKGLLKWIKYSFENHEY
FT                   CSISDSASTASSRRAFCTVEGLISQIFRDAFALQDKDLHCHFANSPCGSTAVVAAIINS
FT                   ETLYVVNCGDSRCILASMNSCIKTMSFDHKPQHIGELIRINDDGGTVSLGRVGGVLALS
FT                   RAFGDFQFKRSVAYKDSQLTNSIRRYIPAAEAQVTVEPDVLTHSLDYAKDEFLVLACDG
FT                   IWDIYSNKALTQFIKYHLTLGLRLDDIVTKLLDHGLAGADSNTGVGFDNMTIIIIVLNK
FT                   PGETLSQWYAKMKMRMEQEKGLV"
FT   CDS_pept        49782..51719
FT                   /codon_start=1
FT                   /gene_family="HOG000142016" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775029"
FT                   /locus_tag="AGOS_ADL376W"
FT                   /product="ADL376Wp"
FT                   /protein_id="AAS51544.2"
FT                   /db_xref="HOGENOM:HBG058610"
FT                   /db_xref="InterPro:IPR019136"
FT                   /db_xref="UniParc:UPI0001DB2791"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BE0"
FT                   /transl_table=1
FT                   /translation="MKCHYREIRLSRVRSRPINKHTIYRKQATITSGWASMSEEVARTR
FT                   STTPTDVPGPRAREFTLDLPRIPSIEFPLKVSQSQESIEKVINMCGGLPKVRRALAAHS
FT                   DSSHDLELRLNDGSEEDGRPQFFNEHPIIGKRVQQRDEAIVLKISMPRGTMERNDGDVR
FT                   KALASLPASKVKAVPVAILHNTVRFREMSDFQVRLDNNPSAKEFNDSFGTLNWEKFKKF
FT                   VETIPDYDDKPFENIGKVVFDRASVCPSSDFQLPPIPRFSMVGLPFIYKYRSNPYATKT
FT                   ASGESKVVGTYIKNYQQFVHDFSPSVSVPLTPHPELVKQYELAKKTKVYPGSKSDSKFY
FT                   EKLEQCLPILTELFNRRHVWIKRHIDGIIPQDLHVVLKIALSLVSYRFTKGPWRNTYIK
FT                   LGVDPRSSNEYAKYQTEYFKIERRLLRNTAVRKNVPDPPERFYRTNTPNDIDSRFRFDG
FT                   KQIPWYLMLQIDLLTDEPNIKEVFQNAVYLDTPKELTGWFSELDLTKIRKIVKYELGCM
FT                   VQGNYEFNEHKLKYFKVMLYVKETLSSKDGDGDVHMTDEKEDAEDEDEDNGVETGELDE
FT                   TVLQADEEDEDEIPMHRALTQPEGSEDSDEFSIKTASFKEIVERIARSDPETADYLAKD
FT                   LDGFVLETQI"
FT   CDS_pept        51891..52409
FT                   /codon_start=1
FT                   /gene_family="HOG000248746" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928046"
FT                   /locus_tag="ADL375W"
FT                   /orf_name="AGOS_ADL375W"
FT                   /product="ADL375Wp"
FT                   /protein_id="AAS51545.1"
FT                   /db_xref="HOGENOM:HBG123673"
FT                   /db_xref="HOGENOM:HBG397282"
FT                   /db_xref="UniParc:UPI0000252905"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BD9"
FT                   /transl_table=1
FT                   /translation="MFRSLITKRFISGPPGLSTAQASLPKRPLRKIRPGKARPAIYHQF
FT                   NVQIELSDGSVITRKSQYPKAEIRLIQDQRNCILWNESRTDLVVVDANTGGRMDKFKQK
FT                   YGSAYSMKTADPQAATEASAEHQADAKAASEEDDSAFGMDDYLDLLSANAVAVQSGGKL
FT                   AGKQKKSKK"
FT   CDS_pept        52620..53051
FT                   /codon_start=1
FT                   /gene_family="HOG000198385" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750124"
FT                   /gene_name="DIB1"
FT                   /locus_tag="ADL374W"
FT                   /product="Spliceosomal protein DIB1 "
FT                   /biological_process="RNA splicing"
FT                   /biological_process="cell division"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="mitosis"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="AAS51546.1"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG020872"
FT                   /db_xref="HOGENOM:HBG522501"
FT                   /db_xref="InterPro:IPR004123"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI0000252906"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75BD8"
FT                   /transl_table=1
FT                   /translation="MGSVFLPHLHSGWHVDQAIVTEEERLVVIRFGSDSDRSCMLMDEI
FT                   LYSIAEKVVNFAAIYVCDTTEVPDFNEMYELQDPMTVMFFYKNKHMRCDFGTGNNNKMN
FT                   FVVDNKQEMIDIIETVFRGARRNKGLVVSPYDYNYKRIQ"
FT   CDS_pept        53437..55413
FT                   /codon_start=1
FT                   /gene_family="HOG000242015" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622483"
FT                   /locus_tag="ADL373W"
FT                   /orf_name="AGOS_ADL373W"
FT                   /product="ADL373Wp"
FT                   /function="ATP binding"
FT                   /function="glycine-tRNA ligase activity"
FT                   /biological_process="glycyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS51547.1"
FT                   /db_xref="GO:0004820"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006426"
FT                   /db_xref="HOGENOM:HBG004481"
FT                   /db_xref="HOGENOM:HBG319978"
FT                   /db_xref="HSSP:1ATI"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniParc:UPI0000252907"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BD7"
FT                   /transl_table=1
FT                   /translation="MASEDVQLARKAVEFNRENLESVLKRRFFFAPAFELYGGVSGLYD
FT                   YGPPGCAFQANIVDVWRKHFILEEDMLEVDCTMLTPYEVLKTSGHVDKFSDWMCQDPKS
FT                   GEIFRADHLVEEVLEARLKGDKAARGISAAPEEEDADKKKRKKKVKQIKAEKLDDSVIQ
FT                   EYESVLAKIDGYSGEELGELMVKFNIGNPVTGETLEPPKAFNLMFETAIGPSGQLKGYL
FT                   RPETAQGQFLNFNKLLEFNNGKTPFASASIGKSFRNEISPRSGLLRVREFLMAEIEHFV
FT                   DPENKNHPRFDEVKNLKLKFLPKGVQEAGRTEPIESTVADAVASGMIDNQTLGYFIARI
FT                   YQFLTKIGVDEEKLRFRQHMSNEMAHYATDCWDAELKTSYGWIECVGCADRSAYDLTVH
FT                   ANKTKTALVVREKLDVPRQVTQWEIELTKKLFGPKFRKDAPKVENYLLNLSQDELASKA
FT                   EQLSSDGKIVFQVEGIEGDIELDSKFISIEHKTKTEHVREYVPNVIEPSFGIGRIIYAI
FT                   FEHSFWSRPEDAARSVLSFPPLVAPTKVLLVPLSNNADLAEVVTEVSRVLRKEQIPFKV
FT                   DDSGVSIGKRYARNDELGTPFGITIDFESIKDGSVTLRERDSTRQVRGSVTDIIRAIRD
FT                   ITYNGVTWEEGTKSLTPFVSQSE"
FT   CDS_pept        55636..56106
FT                   /codon_start=1
FT                   /gene_family="HOG000248409" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750125"
FT                   /locus_tag="ADL372W"
FT                   /orf_name="AGOS_ADL372W"
FT                   /product="ADL372Wp"
FT                   /protein_id="AAS51548.1"
FT                   /db_xref="HOGENOM:HBG058633"
FT                   /db_xref="HOGENOM:HBG396367"
FT                   /db_xref="UniParc:UPI0000252908"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BH5"
FT                   /transl_table=1
FT                   /translation="MSSTPVKDAAKQLVKTLEKFPAERIKHMQCFRDVQLSRFRRIAGL
FT                   ESAPKDTKKPSISDIKDILNRTSGPLGLRKDLLKKMANAMPQEHFTPTSIEQQRLALER
FT                   ILSNRYKTHYEVGDKLYKPAGKPQYYERLLAEVQGRSKESLLTAMRTVLFGK"
FT   CDS_pept        join(complement(57121..57131),complement(56220..57063))
FT                   /codon_start=1
FT                   /gene_family="HOG000142015" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928047"
FT                   /locus_tag="AGOS_ADL371C"
FT                   /product="ADL371Cp"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAS51549.2"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG058640"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0001DB2792"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BH4"
FT                   /transl_table=1
FT                   /translation="MRQSVYLSNLPASNASRIEYARQLLKSINKDNPYALSAEKTLPEP
FT                   LPSADVPLPLLDEKYGVVSVSRPRKCRNKCFLGFATPSQADEFLQNFKDRLFIYGHQVN
FT                   IEPAKHDAFWYIEREDPRACQRLRKHRAQLADPEAKLRVRSNRRLRRLRSRLRKRGLDA
FT                   EHITEVVQRIKEKSKPSAENKTVRERTPSSAAVADPKKRVVDVANNPPNKVLLVQDLPT
FT                   DITEQELVDIFANDKLLQVRLVQVRQLAFVDYADVQSATAVKNKLGTNYVIKNQTTIIG
FT                   YAK"
FT   CDS_pept        complement(57297..58673)
FT                   /codon_start=1
FT                   /gene_family="HOG000229291" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750126"
FT                   /gene_name="TEF"
FT                   /locus_tag="ADL370C"
FT                   /product="Elongation factor 1-alpha "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS51550.1"
FT                   /db_xref="EMBL:AAP86548.1"
FT                   /db_xref="EMBL:CAA52157.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG307581"
FT                   /db_xref="HOGENOM:HBG491630"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004539"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="UniParc:UPI0000129BEF"
FT                   /db_xref="UniProtKB/Swiss-Prot:P41752"
FT                   /transl_table=1
FT                   /translation="MGKEKTHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKE
FT                   AAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYHVTVIDAPGHRDFIKNMIT
FT                   GTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDSVKWDES
FT                   RYQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGAVK
FT                   GKTLLEAIDAIEPPVRPTDKALRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPS
FT                   GVTTEVKSVEMHHEQLEEGVPGDNVGFNVKNVSVKEIRRGNVCGDSKNDPPKAAESFNA
FT                   TVIVLNHPGQISAGYSPVLDCHTAHIACKFDELLEKNDRRTGKKLEDSPKFLKAGDAAM
FT                   VKFVPSKPMCVEAFTDYPPLGRFAVRDMRQTVAVGVIKSVVKSDKAGKVTKAAQKAGKK
FT                   "
FT   CDS_pept        complement(58958..59779)
FT                   /codon_start=1
FT                   /gene_family="HOG000066012" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750127"
FT                   /gene_name="MRL1"
FT                   /locus_tag="ADL369C"
FT                   /product="Mannose 6-phosphate receptor-like protein 1 "
FT                   /biological_process="protein transport"
FT                   /cellular_component="Golgi apparatus"
FT                   /cellular_component="endosome membrane"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS51551.1"
FT                   /db_xref="GO:0005794"
FT                   /db_xref="GO:0010008"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG124455"
FT                   /db_xref="InterPro:IPR009011"
FT                   /db_xref="UniParc:UPI000025290A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75BD5"
FT                   /transl_table=1
FT                   /translation="MPTQLQRPLARLLALALLVLLARAAEDEPPFCAVRNRSTGSYIDL
FT                   SPLASNVSGTPPNWLVRGWQYGANFTLGVCTSPLGDGPAAYYSDTGRRVSIGRVATTPR
FT                   YTGKKLTLTYEGGDLCPNRVDRKSSLLYFVCDRDIHTIAQVSLLGVLHNCSYLFEVRSV
FT                   HACAAARAAGDRSVLGIFAAILLVFAAVELARRCCAAPLRRRFRPDFPADRPRWAPAPT
FT                   GWAARTRAFFARAAEPRQAIKLASSPPGHPASDMEAQNTLLDSLDVRSSGA"
FT   mat_peptide     complement(58961..59707)
FT                   /gene_name="MRL1"
FT                   /locus_tag="ADL369C"
FT                   /product="Mannose 6-phosphate receptor-like protein 1 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75BD5 "
FT   sig_peptide     complement(59708..59779)
FT                   /gene_name="MRL1"
FT                   /locus_tag="ADL369C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75BD5 "
FT   CDS_pept        60332..61276
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079273"
FT                   /locus_tag="ADL368W"
FT                   /orf_name="AGOS_ADL368W"
FT                   /product="ADL368Wp"
FT                   /protein_id="AAS51552.1"
FT                   /db_xref="HOGENOM:HBG058653"
FT                   /db_xref="UniParc:UPI000025290B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BD4"
FT                   /transl_table=1
FT                   /translation="MIDLDTRGAPEAASPLDYDGYETFCNEQCASQRTGNFIPTMVLER
FT                   REELRQQQLSILKFDDADFNTHEDQEFAELMKENDDLMCRIEQLAHSTQEHISKADRVL
FT                   RSTEPGFFSKMFPKLSANSARYFPGMSGLPESATGLTSSAGAPTGLADSGSAFVAGQLQ
FT                   PANRRRRFLKRLTSWLRGSQLGGDFPIRSYSSRHAPSSRKSWKWPSGGSSLARADDLRL
FT                   GRNLISSPYDDHLKLCTPIIMKSHSYRRSHSMGTLQSKHFYDKVRRGMLFYNSRKKARP
FT                   SRPSDLQEKDTRKSGEDYGSASSYKAYGNLITT"
FT   CDS_pept        62204..63127
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751182"
FT                   /locus_tag="AGOS_ADL367W"
FT                   /product="ADL367Wp"
FT                   /protein_id="AAS51553.2"
FT                   /db_xref="HOGENOM:HBG058660"
FT                   /db_xref="UniParc:UPI0001DB2793"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BD3"
FT                   /transl_table=1
FT                   /translation="MSCTRCSENRCVPIDALDDGGADSAVSADSKSGKVAVGAIIGGVV
FT                   GGLLLLVGLGLLTYYHKYWRKRKQRYADTVGSDPPDDEKAMYKAADSAGGNGTPKGDMA
FT                   AAYQPRNRSSAATMATRASNVLPVAYIPGVTAVGKKFRNRHLFNNGDTRSHITLGSSIL
FT                   GGDDDDFDDDSEIGSQAGDRSSVGVQHAGNLTTAIRAKPKLVQINEEDETEDTESLPPA
FT                   GSSSTTGALPRKAAVTVEAAPEAAKAVSAALSQDPFHMDGEDDNHDKDKDEGTDSNDEP
FT                   DDDDDEGSFILDVEVAEPIRKNSLRR"
FT   CDS_pept        63579..65621
FT                   /codon_start=1
FT                   /gene_family="HOG000225954" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622743"
FT                   /locus_tag="ADL366W"
FT                   /orf_name="AGOS_ADL366W"
FT                   /product="ADL366Wp"
FT                   /function="transketolase activity"
FT                   /protein_id="AAS51554.1"
FT                   /db_xref="GO:0004802"
FT                   /db_xref="HOGENOM:HBG001305"
FT                   /db_xref="HOGENOM:HBG565885"
FT                   /db_xref="HSSP:1AY0"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="UniParc:UPI000025290D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BD2"
FT                   /transl_table=1
FT                   /translation="MTQFSDVDRLAVSTIRLLSVDQVSKANSGHPGAPLGLAPAAHVVW
FT                   KQMRLNPKSPKWINRDRFVLSNGHACALLYSLLHLFGYDLSIEDLKQFRQVGSKTPGHP
FT                   EYELPGVEVTTGPLGQGISNAVGLAIAQANLAATYNKPGYELSDNYTYVFLGDGCLQEG
FT                   VSSEASSLAGHLKLGNLIAFYDDNKITIDGHTEVSFDEDVLKRYEAYGWEVLNVANGDE
FT                   NLEDIASALEQAKKNKDKPTLIKLTTTIGFGSLNAGSHTVHGAPLKADDVKQLKTKLGF
FT                   NPDESFIVPQEVYDLYHNSTIQPGAESEKEWNALLEKYAGEYPKEAAELKRRLAGKLPE
FT                   NWESKLPVYKPTDSAVASRKLSEIVLQSIFEDVPELIGGSADLTPSNLTRTTNAVDFQP
FT                   PQSGLGDYSGRYIRFGVREHGMGAIINGLSAYGANYKVFGATFLNFVSYAAGAVRLAAL
FT                   SGHPVIWIATHDSIGLGEDGPTHQPIETLAHLRAIPNMMVWRPADGNEVSAAYKVALES
FT                   QDTPSVIALSRQNLPQLDGSSIEKASKGGYILQDVENPDIAIVSTGSEVGIAVEAAKLL
FT                   AEKNMKVRIVSLPDFHTFSRQPKEYQLSVLPDRVPILSVEVLSTSGWSEYAHQSFGLNR
FT                   FGASGKGPEVYKFFEFTPEGIASRAEKTVAFYKGKEVLSPLNKAF"
FT   CDS_pept        65962..66435
FT                   /codon_start=1
FT                   /gene_family="HOG000273094" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775298"
FT                   /locus_tag="ADL365W"
FT                   /orf_name="AGOS_ADL365W"
FT                   /product="ADL365Wp"
FT                   /function="acid phosphatase activity"
FT                   /function="non-membrane spanning protein tyrosine
FT                   phosphatase activity"
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS51555.1"
FT                   /db_xref="GO:0003993"
FT                   /db_xref="GO:0004726"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="HOGENOM:HBG300882"
FT                   /db_xref="HOGENOM:HBG730979"
FT                   /db_xref="InterPro:IPR000106"
FT                   /db_xref="InterPro:IPR002115"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="UniParc:UPI000025290E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BD1"
FT                   /transl_table=1
FT                   /translation="MPDQIAVAFVCLGNICRSPMAEAIFKHTVKKAGLEHRFSNIDSFG
FT                   TAAYHVGSTPDSRTVSICRKHGVHIDHRGQQIKTKHFAEFDYVICMDESNRRNLERMKP
FT                   QDSKAQVHMFGHWNTGGKFDTIVEDPYYGGTEGFEYNYQQVCYFSEQFLKREL"
FT   CDS_pept        complement(66561..68075)
FT                   /codon_start=1
FT                   /gene_family="HOG000184850" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622744"
FT                   /locus_tag="ADL364C"
FT                   /orf_name="AGOS_ADL364C"
FT                   /product="ADL364Cp"
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51556.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG181557"
FT                   /db_xref="HOGENOM:HBG395803"
FT                   /db_xref="InterPro:IPR007207"
FT                   /db_xref="InterPro:IPR007282"
FT                   /db_xref="InterPro:IPR012270"
FT                   /db_xref="UniParc:UPI000025290F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BD0"
FT                   /transl_table=1
FT                   /translation="MSQRKLLQEVDKVLKKVKEGLVEFDLIYEKFQATESDNQSYREKL
FT                   ESDLKREIKKLQKHREQIKSWLSKDDVKEKNALLMENRRLIENGMERFKSVEKIMKTKK
FT                   FSTEALSNPDLIKDPRELKKRDQFIFVEECLEELQKQLESYEAQELAEKVERHQFHISN
FT                   LENILRMLQNNELEPDTVEEYQDDIRYYVDNNDDPDFIEYETIYEDMGCELQSEEGKDQ
FT                   PTPVKPKTKLERSPKKKATSPAPINIGTKSVVSTTGTATAPSAPGSQASSASPDSSAKQ
FT                   KKDSSPLPLDLPPPKDFSKEIEEIIEHDLTKLAFQNPLFKDELPYWLQAKRPLIQPYST
FT                   MSERMLKQLESSLLNCPDSLDADTPHLYQHPLSLPHPTSIFFPSEPIRFVAAGWNNDNT
FT                   STKDIYGKTSMVQIMTKFDLDTLFFIFYHYQGTYDQFLAARELIIRGWIFNRVNRCWFY
FT                   KEVEKLPPGMDQKEEVSWRYFDYQKSWLARRCGPDFVFRSEEFERL"
FT   CDS_pept        complement(70483..71034)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751183"
FT                   /locus_tag="AGOS_ADL362C"
FT                   /product="ADL362Cp"
FT                   /protein_id="AAS51557.2"
FT                   /db_xref="HOGENOM:HBG058683"
FT                   /db_xref="UniParc:UPI0001DB273C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BC9"
FT                   /transl_table=1
FT                   /translation="MEKEQDAIVMRLLREIDILREENSRLRRNMGHLLNGEPLSPTPPQ
FT                   SRRSSVASLRQQQLFGTSGSMASTPSSSRRSSFSQIDNLKSDLQKKRNSACNYPITLSN
FT                   NASSPFANAAGMHVGKPGTYEYVEGLSVPAAWPAGPDAGSSVAAANTRGRRRRQSNEPS
FT                   VGGGGVRLSKVPNRTGYTVL"
FT   CDS_pept        complement(71679..72380)
FT                   /codon_start=1
FT                   /gene_family="HOG000216653" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622745"
FT                   /locus_tag="AGOS_ADL361C"
FT                   /product="ADL361Cp"
FT                   /protein_id="AAS51558.2"
FT                   /db_xref="HOGENOM:HBG058687"
FT                   /db_xref="InterPro:IPR010033"
FT                   /db_xref="InterPro:IPR010036"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001DB273D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BC8"
FT                   /transl_table=1
FT                   /translation="MCRTRSGHFDKPQTSSRRPAGPECQIMCGSVHVTEARSKEKLASV
FT                   RPTEPTTMQYPDVAAFDLDYTVWPCFCDTHLTSPFTPVATPAGEVLTVVDAAGYELTLY
FT                   PDVPRILADLKLHGVTLLTASRTWAPDVAQQLLRTFRIRVGEDFLSLSEVFDGGAWGDH
FT                   PKIRHITAGLADVYGPSAPDPRDIRVWLFDDESRNRDVERHGVAYLHVRDPQRGPAWDW
FT                   YQASLRGRQNK"
FT   CDS_pept        complement(72734..74671)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775299"
FT                   /locus_tag="ADL360C"
FT                   /orf_name="AGOS_ADL360C"
FT                   /product="ADL360Cp"
FT                   /protein_id="AAS51559.1"
FT                   /db_xref="HOGENOM:HBG058692"
FT                   /db_xref="InterPro:IPR018803"
FT                   /db_xref="UniParc:UPI0000252912"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BC7"
FT                   /transl_table=1
FT                   /translation="MRVSHWMIAVSAALAAGATASSAAEQWNVADLKEYLKDSGQEVAH
FT                   DSLDALRDAASKEWEKHTDGRKSMLDLLWRPKQTPHDWFGSDYTNPVSEWLFNTWPVEE
FT                   LQKLLKHSRVKTDPTWSRDKLVAVSKRNFKKISETLGVSGYYPSESYFKLWDSSELKEW
FT                   LEDYGIPYSKAATARDQLLKVVRENIRRASDFYHDERYEVLTSVGFLNDEFSRTGTVDH
FT                   VDFSSWPLDSLRSWLEVHKLKFDRNMAEDKQYLVALAEKNKKLLMDDVEWLGSIAQKEL
FT                   AEIFKQKDAAMKLSKEAAGKSKNAIKKSGQNAVQYGKDAGNAAMGYGKNVGKDAVNAGR
FT                   DVANAGKHAGKDAVNAGKDAVNTGKHAGKDAVNAGKKAGKDAVAAGKHAGKDVVDAGRD
FT                   AIHAGKEAGMDAVEVGREAGDSFVHHGKDLFHAGQESAESLWDSIKGYFNKADDVINDT
FT                   FLLDVENWPKRRLKHFLEARGVKYSLLSTRKDLLKSVIKYRNKPVHDLKETKNKWFPSW
FT                   TLENLQHWSSEKTEQGKEKYNSAKDHLKAGSNKVQDQSKEANEAIKQKIDDWVETFNSW
FT                   TTDDLQTYLRSFGIQPPKSYKKDQLVDLALKHSKAFFGSSSDSSESGYFRFVPRIARKW
FT                   FNYGYSLLVR"
FT   CDS_pept        complement(74893..75414)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622746"
FT                   /locus_tag="ADL359C"
FT                   /orf_name="AGOS_ADL359C"
FT                   /product="ADL359Cp"
FT                   /protein_id="AAS51560.1"
FT                   /db_xref="HOGENOM:HBG058696"
FT                   /db_xref="UniParc:UPI0000252913"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BC6"
FT                   /transl_table=1
FT                   /translation="MQHGTRRSPSTCWMPACILITCDYGVQPPWVVFRRTVCSLCGSHR
FT                   IIARVGLSTSAAVARAHTQVAIVAAPSAEWNPTSAPAHGTTITRGRGGVEQTAGICARA
FT                   RRSIAPRSASSCCCGILQRYLRRPRFRCYGAGVTRSYTHVTTCGSRHLVRERGARGIWA
FT                   EDGRTGGWLV"
FT   CDS_pept        75953..77710
FT                   /codon_start=1
FT                   /gene_family="HOG000000742" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928290"
FT                   /locus_tag="ADL358W"
FT                   /orf_name="AGOS_ADL358W"
FT                   /product="ADL358Wp"
FT                   /protein_id="AAS51561.1"
FT                   /db_xref="HOGENOM:HBG058700"
FT                   /db_xref="HOGENOM:HBG203545"
FT                   /db_xref="UniParc:UPI0000252914"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BC5"
FT                   /transl_table=1
FT                   /translation="MFKQGTPGLGGEATSAHNEMEQLTSFQTVAPMPISVMREMSGSSG
FT                   SKAGHVLQHALAGLTVYQNLPNGSIVGVDDLTRMKMALMSGVDEEVTWSLKKYLVYSNK
FT                   APYMVSLRMNRELVDTFNTFVVAMAPILEMFKWPLVEEDFYQFEKGLNAILILRNLAQD
FT                   SDSTQVLAMNEPLKLFLLTVLEWCNLFNHPNHVMYQENAPLFMELINYVLDLVEAISSY
FT                   IAPAKKDDPFFKNLVSILRVTNDRYHVISILRSLSRLLVRSKADQESAADNLDDEILNL
FT                   IVSYLLVDCDNELVMASLDFLYQYILPGSERITTLLSNPERNSILTTVLPSLLTYNVEL
FT                   PDYDYLSKVEIKLVRRVKPRPPTHVPTLPPDLFQKLLGLNEPMRSTAWLRCCFESAADS
FT                   EVTQISLWKSYEHIFSEPVKQSGRRLLPAVEFIKNVSNAFVGAAAMVVTDPVTAQKRFV
FT                   IKGIQPRIKAVSINDGEAAASANAAVTPPTTMGNVTNAGDSANVKDVEDALKTAEAKQI
FT                   VLPKLKFPTKLSDVSKASATFLCLLSNDTQGLGLKFCNSVKPSIMHTLADVPPLNAVLS
FT                   EFMDNIPTL"
FT   CDS_pept        complement(77957..81487)
FT                   /codon_start=1
FT                   /gene_family="HOG000141909" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079558"
FT                   /locus_tag="AGOS_ADL357C"
FT                   /product="ADL357Cp"
FT                   /protein_id="AAS51562.2"
FT                   /db_xref="HOGENOM:HBG058707"
FT                   /db_xref="InterPro:IPR013888"
FT                   /db_xref="UniParc:UPI0001DB273E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BC4"
FT                   /transl_table=1
FT                   /translation="MAFKTFKYKLYSKGYHSAAQKPATSFFDSSYQYLKQNQGLVSLDT
FT                   AISQPFNGYLNPHPVVVAGVNYTNVQEVLELADEEGNRLREETEEAPAGTLTARPRALI
FT                   RRNSDSFQFLTLPGLQKSDFNPRYSQCFYTSAAAPGDAEGLHTAAEPQPDVRFQEDLPP
FT                   WQLDREPCLNEKTFLATSIKEIKTCMENEDYNKVNCIYQALKRNGIVPPVNTFEQVLCA
FT                   IKLRDMDADDPEGKMVQLLNCYQDLVSNKLKPTTEIYTIVIGSLLERAATTKVLKEGLG
FT                   EDFFKIALDLFFASNYTHTRGFNQELLDRILLGANLYPGHIKYSMLTSLVNDSLEYEKT
FT                   EFYYISMINYARECKDATRLKALYDEFREATKSNDRLRTYQYEVYSMVVAGLVSLDSLE
FT                   VAVKLLDRLLTQIRSTDGLDSCQTLVLSNFLLAVARNNPKTAYKLWTQFQQHSWVPEFS
FT                   YEFYLAMLESSIEDMDVARNVYMYLYGMKPDFRKDPASFKEYLLYPRNKGHVLSALLHQ
FT                   SMQHSDKELINRLLEESICKRLPFKIDLYGPIFAYLKSIEIPPTYLLRFIECHGTLLTS
FT                   LTGSEQFIFLQALVTYFSSYDLLKSVTEMSFFRDVCASFDITVSDTIPYNGLAACFEAL
FT                   WKAPQKIEHYGNVLELHALLITRIYDPALSQYKISAPVVQELKSKVTERFQKLASNFRR
FT                   LHLDSTRCPAEVSQAVKIVRLPTETQNYFTNPGDWDKTYPLSLSILLSVDLHAGIREFS
FT                   RLLKDGYCFDFETYKSLIHYRYVDDHVVSKSLELCPSNKSSKEELCDLLVTCTPARALN
FT                   ELILSNPSFQSEIRPYLSDSSLLEILRHCADIDFFITSVGFPENFKSIAAAAEFRRTIE
FT                   YLYVRLLKSKRYTEIISFNKITSVLDLTVLMKACIRTGAYEAYLNLKKQFGREYKAELV
FT                   AIHAEYLVNIFKFDEAVALVENAAVKTTAARDVSSFAQFIQSFSKEVKTNENVENTLQL
FT                   ANALCSLRSLEEMNDLYESVVSSKQHPLVDGTNIAFAVKLELLEQMLNNLHDALPFLDL
FT                   KSEDCKKHVMERLNNYLLFRNRFHLPNARKEDLLQLMTIWSFVAPEAIDNLFNELVETL
FT                   YASGTSPQKHLYVNDGFVLPCDRSLANTLVDWIKTFYQQEHNPENLIKVENFQQVLGNF
FT                   YTGKDIMTFI"
FT   CDS_pept        join(complement(83433..83534),complement(82009..83301))
FT                   /codon_start=1
FT                   /gene_family="HOG000012351" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622747"
FT                   /locus_tag="ADL356C"
FT                   /orf_name="AGOS_ADL356C"
FT                   /product="ADL356Cp"
FT                   /function="hydroxymethylglutaryl-CoA synthase activity "
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /protein_id="AAS51563.1"
FT                   /db_xref="GO:0004421"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="HOGENOM:HBG236384"
FT                   /db_xref="HOGENOM:HBG578402"
FT                   /db_xref="InterPro:IPR010122"
FT                   /db_xref="InterPro:IPR013528"
FT                   /db_xref="InterPro:IPR013746"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniParc:UPI0000252916"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BC3"
FT                   /transl_table=1
FT                   /translation="MTDPNQAKKQKIEAQPPRPQNIGIKAIELYIPSQCVNQEALEAYD
FT                   GVSQGKYTIGLGQTNMSFVNDREDIYSMCLTACSNLMKNYDIKPESIGRLEVGTETLLD
FT                   KSKSVKSILMQLFGENTDLEGVDTVNACYGGTNALFNSLNWIESSSWDGRDAIVVCGDI
FT                   AIYDKGAARPTGGAGTVALLIGPDAPIVFDSVRGSYMEHVYDFYKPDFRSEYPYVDGHF
FT                   SLTCYVKAVDQAYRAYSRKAIAKGLAENPAGPEAVNVATFFDYNVFHVPTCKLVTKSYG
FT                   RLLYNDFRANPELYPEVSADLATLDYEASLADKNIEKTFVGLAKPLHKARVEPSLVVPT
FT                   NTGNMYTGSVYAALASLLYYVGNDALQGKRIGLFSYGSGLAASLFSVRVLGDIKHITHN
FT                   LALDTKLQNRKTETPEDYEKALALREAAHLQKAYTPQGSLDLLQPGTYYLTAVDDRYRR
FT                   SYAVKE"
FT   CDS_pept        join(complement(84659..84664),complement(83949..84605))
FT                   /codon_start=1
FT                   /gene_family="HOG000141910" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059058"
FT                   /locus_tag="AGOS_ADL356CA"
FT                   /product="ADL356C-Ap"
FT                   /protein_id="ADJ41760.1"
FT                   /db_xref="InterPro:IPR006735"
FT                   /db_xref="UniParc:UPI0001DB273F"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGB7"
FT                   /transl_table=1
FT                   /translation="MGNDGGTINRSKNLAVAAVRGANVAADDNVQEYNWQSQWTSCRLS
FT                   GKPLQLPVVGDCKGNIINKEALLEWLLDRQERGAGKPRPEFRHLRRRADMVELHNLVAE
FT                   GDAGILRCPVGDATLGQSKGRFVYLASCGDVMPQKLQQQVSQCAVCGKAYDPLDVVLIN
FT                   PRAADEHAALRDRMRVLVERGLSHSGKPLPKKKRSRSPSAPEGPPPAKKAATRVGTD"
FT   CDS_pept        join(84793..84795,84866..85441)
FT                   /codon_start=1
FT                   /gene_family="HOG000178619" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751184"
FT                   /locus_tag="AGOS_ADL355W"
FT                   /product="ADL355Wp"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51564.2"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058719"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR009145"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0001DB2740"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BC2"
FT                   /transl_table=1
FT                   /translation="MIGACRHGDKCSKRHNSPINSYTIVIYNMYVPPRDYKDLHALTED
FT                   FESFYEDVFLEAARFGEVQELIVCENKTDHLNGNVYIRYSTIDAAKAARDALITRWYGE
FT                   RPLYCDLSHVTDFREAVCKSYEEGTCDRGEQCNFIHRRIIGYHIANGLMLSQWKSRHIM
FT                   PQHRSDEARNTGHVAHSSAAVTAPLPPSA"
FT   CDS_pept        join(85668..85711,85777..86485)
FT                   /codon_start=1
FT                   /gene_family="HOG000091085" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751185"
FT                   /locus_tag="ADL354W"
FT                   /orf_name="AGOS_ADL354W"
FT                   /product="ADL354Wp"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="proteasome core complex, alpha-subunit
FT                   complex"
FT                   /protein_id="AAS51565.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0019773"
FT                   /db_xref="HOGENOM:HBG434372"
FT                   /db_xref="HOGENOM:HBG499923"
FT                   /db_xref="HSSP:1G65"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI0000252918"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BC1"
FT                   /transl_table=1
FT                   /translation="MADRYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVI
FT                   ATEKKANTTLTIKDTLDKVSQITPDIGAVYSGMGPDFRVLINKSRKTAYGSYRKAYGEY
FT                   PPTKILVSQIAKIMQEATQSGGVRPFGVSLLVAGYDEHNGFGLYQVDPSGSYFPWKATA
FT                   IGKGATAAKTFLEKRWNDELELEDAIHIALLTLKESVEGEFNGETIELAVVGEENDDML
FT                   GYKGDASAKGPRFRKFTAQEINDRLDAL"
FT   CDS_pept        complement(86598..89195)
FT                   /codon_start=1
FT                   /gene_family="HOG000074497" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751186"
FT                   /locus_tag="ADL353C"
FT                   /orf_name="AGOS_ADL353C"
FT                   /product="ADL353Cp"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="small-subunit processome"
FT                   /protein_id="AAS51566.1"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0032040"
FT                   /db_xref="HOGENOM:HBG058728"
FT                   /db_xref="HOGENOM:HBG398243"
FT                   /db_xref="InterPro:IPR006709"
FT                   /db_xref="UniParc:UPI0000252919"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BC0"
FT                   /transl_table=1
FT                   /translation="MAKRKSKSGAGASRRRAQNALELAERELASDSSADEGIPRSQRRR
FT                   NSAIVNPQRGSDDENGSEEFEDEELDSDEALGSDDDYDVMNSKFSQSIRDKKKNNQSVE
FT                   ELDEEGGYTSIDEEELLPLSAVWDMDDTATAGAEKHVASQLKLNDDNLSDDSESESESD
FT                   SDSSDEAEDEEDPFDEVPNEEVDLATVSSTLQKHTTKQYKRLDTYAGGVEDEYALPSLQ
FT                   GPGKLDITKLLDVVDDPEAVEQATLLKGNLKSLDVPLPMRIQQRHERKAAYEISKEEMS
FT                   KWASIVQQNRQSEHLSFPMDSSASHTEASAFTRNSEKPLTEVEVKVTEVLKKSNLLDPV
FT                   KENTFNDLAEAKLSVEDMKKRTAELRLMRELMFREERKAKRIKKIKSKAYRRIKKKEML
FT                   KNQELVDSDESDTDRDVARARERMSLKHNTKSKWARDMVKHGITKDKETRDDLENMLKQ
FT                   GERLREKIMGHAEGSESDTDVSDLERDDASPEQDTPYRGDIGKTGVLNMAFMKNAEARE
FT                   REENRQNLAALRAVENGEDIKLFEDGLTKDGSNVASNKGRRVYSAADLEAKEKDAQFNE
FT                   EVLAEHADDESRSLEKRLEKANKRSSGSQNKLSAKTTQSSTKKQDSKTEDPSALENPWL
FT                   DGGDDSTLIKKSSKIKVVDANSSQFTKSAHKIDKEKQKLSRSKKDEKDNGDDLLLDIES
FT                   SNKLDIIDPYDESGDEADGNSFKQQDAINEAFAGDDVVAKFQEEKKRVAIDEDDKEEDV
FT                   TLPGWGEWAGAGAQPAKKRKFTKKIKGVVSKEKRRDKNLKNVIINEKVNKKNVKYQSSA
FT                   VPFPFESREQYERSLRMPLGEQWVSRATHQKAVKPRILTKPSVVIDPLKAPFK"
FT   CDS_pept        join(complement(89899..89917),complement(89387..89844))
FT                   /codon_start=1
FT                   /gene_family="HOG000207562" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079559"
FT                   /locus_tag="AGOS_ADL352C"
FT                   /product="ADL352Cp"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="prefoldin complex"
FT                   /protein_id="AAS51567.2"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0016272"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG409907"
FT                   /db_xref="InterPro:IPR004127"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR011599"
FT                   /db_xref="UniParc:UPI0001DB2741"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BB9"
FT                   /transl_table=1
FT                   /translation="MASPQTIDLTTLTPAQLAQVKQQFDQELQHFTKSLQALSMARAKF
FT                   NECIADVKVVSEKKNSEQRLLVPLAGSLYVPGKVVNNQKFMVDIGTGYYVEKDASQAIE
FT                   FYQKKVNKLNKEAVQIQDIIKEKTQSSLAIEAQMRKAAIKQHEEIAKQKQQAAQ"
FT   CDS_pept        90030..90629
FT                   /codon_start=1
FT                   /gene_family="HOG000000743" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775300"
FT                   /locus_tag="ADL351W"
FT                   /orf_name="AGOS_ADL351W"
FT                   /product="ADL351Wp"
FT                   /function="damaged DNA binding"
FT                   /function="endonuclease activity"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51568.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG058732"
FT                   /db_xref="HOGENOM:HBG203506"
FT                   /db_xref="InterPro:IPR004579"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniParc:UPI000025291B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BB8"
FT                   /transl_table=1
FT                   /translation="MGADDATSFEKILANVQRRRQEYNGATSASRPEPRAAPAVALDTG
FT                   PTGSSRVTNAFNQERPTPAAAETDLPKRPRSGQGRTILVSTSQKGNPLLKGLASTNWTY
FT                   VKSSGTEKVYYDYQVQGRKVVFLSLKYHKLRPEYIDQKLRPFGKTQGNILLCVVDIEDS
FT                   EDILKELNKTTMFNGFTMLLAFNFEQAAKYLVFLNK"
FT   CDS_pept        complement(90632..92158)
FT                   /codon_start=1
FT                   /gene_family="HOG000038438" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622748"
FT                   /locus_tag="AGOS_ADL350C"
FT                   /product="ADL350Cp"
FT                   /function="asparagine synthase (glutamine-hydrolyzing)
FT                   activity"
FT                   /biological_process="asparagine biosynthetic process "
FT                   /protein_id="AAS51569.2"
FT                   /db_xref="GO:0004066"
FT                   /db_xref="GO:0006529"
FT                   /db_xref="HOGENOM:HBG037399"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI0001DB2742"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BB7"
FT                   /transl_table=1
FT                   /translation="MCGILVHYSEVEADSDRFVEFPERCEPPEVQKHCDGASQEFLRLV
FT                   PYIMARGPDYASYRLEAGMGLAWFSSVLSLRQPLTPQSMAVGDRYILQFNGELFNEDIQ
FT                   HNDTQYIADLLASWPVTAVIRQMYGEFAYTIFDRQDGLLYFGRDNVGKRSLCYRLDGRE
FT                   LHVASVSGKSQGFLNCDAGVIYTFDVHQKTLRMEERICASPFTVSAHCESAGLEGDLDT
FT                   LYEILQRSTRQSLESIQPLHSENAKHASVLFSGGVDCSVVAALICEQWSSHKDAVLELL
FT                   NVAFENPRTGKMPEDAPDRKLAIESAAQLQKLFPEMDIRLVEVDVPYNEYLEVRPSVVD
FT                   LIYPKQTEMDLSIAIAFYFAARGRGFIHRDRHREPYNRRGLVLFSGLGADELYGGYHKF
FT                   ANKSTEELVVELTRQINNIHDRNLNRDDKVLACHGVEARYPFLDEKVIKASVALPISYK
FT                   NDKMILRKLARERLHLSGISDMPKRAIQFGARSAKMTKDSSKNGTDIIVQ"
FT   CDS_pept        92278..93516
FT                   /codon_start=1
FT                   /gene_family="HOG000141911" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928291"
FT                   /locus_tag="ADL349W"
FT                   /orf_name="AGOS_ADL349W"
FT                   /product="ADL349Wp"
FT                   /protein_id="AAS51570.1"
FT                   /db_xref="HOGENOM:HBG058743"
FT                   /db_xref="HOGENOM:HBG203498"
FT                   /db_xref="InterPro:IPR003123"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR013995"
FT                   /db_xref="UniParc:UPI000025291D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BB6"
FT                   /transl_table=1
FT                   /translation="MQPDELSTCKSQEESNPSDSRELEHTEEDEDDENFYDFRLFISQL
FT                   RDSRAEPILKYTKSFLQGFVSNRTMWSASEQVKLLNDYKLFVYDKYAQYEPFRSLGPTK
FT                   LRNAKEGMEKLLMGKLYMRCFSPCIGLPAERLDPEHAADLEQDEQLKAKIAEYRFLAPE
FT                   HLEIPDTLSPKLSRFVDLSVAELAKINQYKAPRDKIVCILNACKIIFGLLKHSRLEHGG
FT                   ADVFVPLLIYTVLKSDVSALASNLRYIERFRLPAFLHGESAYYLSSLQGAVGYILHLDP
FT                   EKLHIPDPVAYNALYDANRLSLPAPPLEEAPRAPADYILRPLDGAASTVFSLFTDFLSP
FT                   KNEKPPDADVDEIDDPTTTELIRKLEHQEHREMLQNLQGMFPDLDPGLIHDVCIATRYR
FT                   MGACVDSLLSISD"
FT   CDS_pept        93705..95345
FT                   /codon_start=1
FT                   /gene_family="HOG000158050" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18928292"
FT                   /gene_name="ERO1"
FT                   /locus_tag="ADL348W"
FT                   /product="Endoplasmic oxidoreductin-1 "
FT                   /EC_number="1.8.4.-"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity, acting on a sulfur
FT                   group of donors, disulfide as acceptor"
FT                   /biological_process="electron transport chain"
FT                   /biological_process="protein thiol-disulfide exchange "
FT                   /biological_process="transport"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="AAS51571.2"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006467"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0016671"
FT                   /db_xref="GO:0022900"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG436396"
FT                   /db_xref="HOGENOM:HBG521237"
FT                   /db_xref="InterPro:IPR007266"
FT                   /db_xref="UniParc:UPI0001DB2743"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75BB5"
FT                   /transl_table=1
FT                   /translation="MQLNKLMLGFMLCASALADDGQQAAEPHTSANFCKIDKDQQVGST
FT                   CDITFHELNEINEQIRPQLARLVKTDFFRYFKLDLYKECPFWSDNNGYCVNRACAVDVV
FT                   DDWESVPDIWQPEVLGGLDEDSVKSEGGESDECSFLNELCGRRREFARPEPLSIDYCDV
FT                   TDFTNKDSVLVDLVANPERFTGYGGEQSAQIWSAIYKENCFTLGEQGFCLAKDVFYRLI
FT                   SGLHASIATHLSNDYLDTKTGKWGPNLELFMARVGNHPDRVANIYFNFAVVAKALWKIQ
FT                   PYLERVEFCNVYDTNVKDMISNVVSRLDSRVFNEDLLFQDDISMRMKDDFRRRFKNVTK
FT                   IMDCVHCDRCRMWGKVQTTGYATSLKILFEMDAGDEKARQRVVDKLTKYELIGLFNTFD
FT                   RISKSVNAINNFERMYHSQMETNTSSIAAFFQNNFFRLGFTETEDQETSNATADMPLPE
FT                   DSASDNEPYFADLKIPARRSKKQTKEESTSALQQELQGVYHALQFIWNSYVNLPRNLLI
FT                   LVLDVANTWFNNFIGVPTQINILGDDASD"
FT   sig_peptide     93705..93758
FT                   /gene_name="ERO1"
FT                   /locus_tag="ADL348W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75BB5 "
FT   mat_peptide     93759..95342
FT                   /gene_name="ERO1"
FT                   /locus_tag="ADL348W"
FT                   /product="Endoplasmic oxidoreductin-1 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75BB5 "
FT   CDS_pept        complement(95414..95890)
FT                   /codon_start=1
FT                   /gene_family="HOG000141912" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622749"
FT                   /locus_tag="ADL347C"
FT                   /orf_name="AGOS_ADL347C"
FT                   /product="ADL347Cp"
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /biological_process="transcription from RNA polymerase II
FT                   promoter"
FT                   /protein_id="AAS51572.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0006366"
FT                   /db_xref="HOGENOM:HBG061001"
FT                   /db_xref="InterPro:IPR003195"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000025291F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BB4"
FT                   /transl_table=1
FT                   /translation="MSRKLKKTNLFSKDVAPLMYAYGDSPQPLPETVQCVDELVTSYLT
FT                   DICANAYRCAQTVHRTKIKVEDFKFVLRNDPVNLGRAEELIMMNKVIADARKQFDNSEG
FT                   KSLKRVNKDEDLEDIPEEDGEDMGGMGPGSELAVEETSKRGRKPKKRKNAKGSV"
FT   CDS_pept        96588..100745
FT                   /codon_start=1
FT                   /gene_family="HOG000191209" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18928293"
FT                   /gene_name="LYS2"
FT                   /locus_tag="ADL346W"
FT                   /product="L-aminoadipate-semialdehyde dehydrogenase large
FT                   subunit"
FT                   /EC_number="1.2.1.31"
FT                   /function="L-aminoadipate-semialdehyde dehydrogenase
FT                   activity"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="ligase activity"
FT                   /function="phosphopantetheine binding"
FT                   /biological_process="lysine biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS51573.2"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0004043"
FT                   /db_xref="GO:0009085"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="GO:0031177"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG058757"
FT                   /db_xref="HOGENOM:HBG324699"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR014397"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI0001DB2744"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75BB3"
FT                   /transl_table=1
FT                   /translation="MCAVLEPSMIRWLSEVDNIVVSSLPSDYIPSGPAGVKAESCEVEL
FT                   PGSFGVIDEEDSYIRLLSAFATLVCRMSGESDVAMYSKANRLLKLAVPPGVAFQQLRAS
FT                   VTEAVEGTLALPAVDFDELSALEREKKQLDYYPQYFKVGVVTAADKTKLDQFRYHKFEL
FT                   LLRQVTSSRFEMVYDSERFSPDRIGELGEQLVQFLTLVEAKDDADVYAISLVTSGASRV
FT                   LPDPTTDLGWGQFRGAIHDIFQHHAETRPDRLCVVETGVGQVAARTFTYSAINCASNIV
FT                   AHYLLARGIRRGDVVMIYSTRGVDLLVSVLGVLKSGAVFSVIDPAYPPARQNVYLGVAK
FT                   PAGLIVIQAAGQLDEAVEAFIRDNLSLKARLPALALQTDGAILGGTLPDFHLDTLVPFA
FT                   SLKNTRTDVVVGPDSNPTLSFTSGSEGIPKGVLGRHFSLTYYFDWMAKRFGLSEDDKFT
FT                   MLSGIAHDPIQRDMFTPIYLGAQLLVPQEDDIGTPGRLATWMATHGATVTHLTPAMGQV
FT                   LTADATTPFPSLKRAFFVGDVLTKRDCARLQSLAENVAIVNMYGSTETQRAVSYFEVPS
FT                   CSSNPSYLDNLKSIIPAGRGMHNVQLLIVNRHDRTKLCGIGEVGEIYVRAGGLSEGYRG
FT                   LPEINKEKFIDNWFVDAGHWGGLDLSGDEPWRNYWLGVRDRLYRTGDLGRYLPNGDCEC
FT                   CGRADDQVKIRGFRIELGEIDTNISQYPLCRENITLLRKDQNGESTLISYLVPRSDQKA
FT                   LASFISAVPESIATESIAGSLIKYHKLINDIRGFLKKRLAGYAIPTLIMVMERLPLNPN
FT                   GKIDKNKLQFPEPTELDRASEHFASETLGLSSFSPLEQEIRKIWLDLLPTRPAITSSDE
FT                   SFFDLGGTSILATRMAIVLRNRLNISLALSTIFRYPTVKELAKEISRVRGTISDDKSSN
FT                   SGTTEYYADAKHVSEAELASKYESRLSLLPSGATSAPVYVFLTGVTGFLGCHILADLLN
FT                   RSRKPYDITVYAHVRASDESSALQRIKSVCTAYGLWKNAYAPRIKVVLGNLAEKQFGLP
FT                   KKAWHDLQEGIDVIIHNAALVHWVYPYSKLREANVLSTVNVLNLAAAGKAKYFTFVSST
FT                   SALDTKHYLELSNAAIESGGSGVPEDDDLMGGSLGLKGGYGQSKWAAEFIIKRAGERGL
FT                   RGCILRPGYVTGSPSTGASNADDFLLRFLRGCVQLGKIPDIEGTVNMVPVDYVARLATA
FT                   ASFSSSGNTHMMVVNVNAKPRISFRDYLLALKEYGYQVTSVPYDEWSKALESSSDEENP
FT                   LYPLLYLVLDDLPKKLRSPELDTTNAKFVLEEDFARTNIEPIIITSVSLEVVGSYISFL
FT                   HKLGFLEEPAKGSRPLPNISLSDEQISLIAAVATARSSTAKP"
FT   CDS_pept        complement(100809..103049)
FT                   /codon_start=1
FT                   /gene_family="HOG000179829" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751187"
FT                   /locus_tag="AGOS_ADL345C"
FT                   /product="ADL345Cp"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS51574.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG060995"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI0001DB2745"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BB2"
FT                   /transl_table=1
FT                   /translation="MTGEEGGFIRRRPRRAAARRSAVREEISSEDEPLSGQARTGSAAW
FT                   DPVVVESSDGEEPLEEESEEDEPLGKRRRAKPRGGKPSAKKVPAKKARAPNVSRYDRMT
FT                   QLLFEHHRELADVFPALRDAPAYKPIRAAQPAGLTVPLLPFQLEGLHWMALQENNERYR
FT                   GGVLADEMGMGKTVQMISLLLHANKGPTLVVAPTVALIQWKNEIDKYTGGALRSLVFHG
FT                   PGRSAVSEELAAADVVLTTYAVLESVYRKQTQGFRRKAGVVREQSPLHAVDFYRVVLDE
FT                   AHNIKDRSSGTARSVNALRAVRRWCLTGTPLQNRIGEMYSLIRFLDIEPFTRYFCTKCS
FT                   CSEKTWRFSDNLHCDSCDHVGMQHTNFFNHFMLKNIQRHGMEGPGLESFENIQLLLRNI
FT                   MLRRTKVERADDLGLPPRIVTVRRDVFDEEERDLYRSLYSDSKRQYNTYVESGVVLNNY
FT                   ANIFTLLTRMRQLADHPDLVLKRLPGNEIVGVIVCQLCVDEAEDAIESKCRHKFCRLCI
FT                   REYIDSFVGRSADLTCPVCHIALSIDLAQPALEIDEEMFKKQSIVNRLGLQGNWRSSTK
FT                   IEALLEELYNLRSSTRTIKSIVFSQFTSMLDLVEWRLKRAGFQTAKLQGSMTPTQRAET
FT                   INYFMDNVHCEVFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQHRP
FT                   VKITRFCIEDSIESRIIELQEKKANMIHATLGQDEGAVNRLTPADLQFLFNN"
FT   CDS_pept        104044..106776
FT                   /codon_start=1
FT                   /gene_family="HOG000184664" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928294"
FT                   /locus_tag="AGOS_ADL344W"
FT                   /product="ADL344Wp"
FT                   /function="binding"
FT                   /protein_id="AAS51575.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG051979"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001DB2746"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BB1"
FT                   /transl_table=1
FT                   /translation="MNNPLGQHGGGAVGLRAAQALAAGTGPHGANGGGSPSGGVAAIAA
FT                   DGAGGGAAVDPLSQSAAETWLSIASLAETLGDADRAAMAYDATLQYNPSSTKALTSLAH
FT                   LYRSRDVFQRAAELYQRALAVNPELGDVWATLGHCYLMLDDLQRAYAAYQQALYHLSNP
FT                   NVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPHFEKVNEIYFRLGIIYKHQGKWNQA
FT                   LECFRYILPQPPAPLQEWDVWFQLGSVLESMGEWQGAREAYEHVLSQNDRHAKVLQQLG
FT                   CLYGMNNVQFYDPQTALNLLLKSLEADSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVN
FT                   RDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSD
FT                   ALDAYKQAVRLDPNNVHIRERLEALTAQLANPGAQQPQQQPQQQQMQQPRGPAPIMLQP
FT                   TLQQQDQTNPLNNKPAFYRSSPHGVAVAGTESAGHTPMSGRPQPLQQLNNNGSILEPSL
FT                   LPQKRPMEGGMDTLVNAISQQELQQHQKKHMPSQNHPSLALATGQPQQLPPDAAPIIPP
FT                   EKKGAPLPQFQKTEPEHAAKRLKHEQNNVEEQPVRSRTIPSITHPASMDHSGPGDQNHI
FT                   LSGPSVHATHVLPPVAVAAKGSERSQPVANGSTIKDLHATNTLPPVTGPIVNSDKLGSK
FT                   APPDTSKEAAHATAQAGFHDKVSPGQPDVGEKPKDSREVKSANTASTGAPVRNLPPLAT
FT                   AASPECSSTHTEISAAPSESITAAASENLEDQEPNLKTNSASSAVDLAERQKSSTEVAT
FT                   DYHPAAETAPTASNKLRSTDPPAPPDLHQPPAAESAEPTAIKPSADAIEKLQEEARMRQ
FT                   EEELEALQKKAAHNGVGTSTDLPKESVIRKVEEDENYDD"
FT   CDS_pept        complement(106928..107227)
FT                   /codon_start=1
FT                   /gene_family="HOG000093977" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751188"
FT                   /gene_name="SUS1"
FT                   /locus_tag="ADL343C"
FT                   /product="Protein SUS1"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="mRNA transport"
FT                   /biological_process="protein transport"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="nuclear pore"
FT                   /cellular_component="nucleoplasm"
FT                   /protein_id="AAS51576.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0005654"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG037315"
FT                   /db_xref="HOGENOM:HBG396842"
FT                   /db_xref="InterPro:IPR018783"
FT                   /db_xref="UniParc:UPI0000252923"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75BB0"
FT                   /transl_table=1
FT                   /translation="MTAKDKEALELRAQIQQHLVESGNYERISNKLAQRLLDEGWIDQV
FT                   KKLTRETMEDDNTTNFSEVLKRVEPEAVSLVSANTKNEIMQQIKAFLCDILDTQ"
FT   CDS_pept        107387..108088
FT                   /codon_start=1
FT                   /gene_family="HOG000174302" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18928295"
FT                   /locus_tag="ADL342W"
FT                   /orf_name="AGOS_ADL342W"
FT                   /product="ADL342Wp"
FT                   /function="hydrolase activity"
FT                   /protein_id="AAS51577.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG344655"
FT                   /db_xref="HOGENOM:HBG446368"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniParc:UPI0000252924"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BA9"
FT                   /transl_table=1
FT                   /translation="MTPLAQGIRLQLLYRTQYQVRRMAGSTKRGPEQAKLLERRAVTDT
FT                   SEFKWIGLEKLKYADPLGRERDWEGAVRTTRASTGVDGVGILAIVREPGQPDRILLQKQ
FT                   FRPPVGGVCIEMPAGLIDEGETLEEAVARELREETGYSGRIVTTSAILFNDPGFTNTNL
FT                   RMVTVEIDATAPENRNPQPELEDDEFIECFMVPLRDFPEEMGRLDAAGYKLDARVDNVA
FT                   HGIKIARMYGL"
FT   tRNA            complement(108169..108250)
FT                   /gene_name="tRNA-Ser"
FT   CDS_pept        complement(108386..109666)
FT                   /codon_start=1
FT                   /gene_family="HOG000066035" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751189"
FT                   /gene_name="MED1"
FT                   /locus_tag="ADL341C"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 1"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="AAS51578.1"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG058774"
FT                   /db_xref="HOGENOM:HBG203970"
FT                   /db_xref="InterPro:IPR019680"
FT                   /db_xref="UniParc:UPI0000252925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75BA8"
FT                   /transl_table=1
FT                   /translation="MPDAYVESLGKMIAILVNYKPGSITLENITRLCQTMGLESFVDQV
FT                   SANISRLSIASKIIVIDIDYEVTDGKVIDVKLVLASNFDKFDYFNGEANILHRSLTTYS
FT                   DLHEFHHNLKFLTLLDACSSIDIESNVSQFDLFEYYSMLPQYMQSYLDDNGAQLTVQTN
FT                   LNDRFGIYLLDHSEKKVAKLTFAATQDPNQRYYEYKYSSETKEWINQSAESYTTGITLV
FT                   FELLGDPPTYLPKDSLPPEHPDEGFTSASASELQRRFAFKCQNPRVTLVNDFTVDVYPA
FT                   STFQLLNDNICLCFDILRRQKWWHTVLYPISQLLLHQGQDSAVGDAPAPAAQPPLHRRR
FT                   SSNKGCRRASAAESATLGDENMHQLTLTEIMNKSVIPEDDAMMDDRIELYVNENYVYLG
FT                   TQEGCSFYNDPIERWEAFVESLRQMLT"
FT   CDS_pept        110227..111108
FT                   /codon_start=1
FT                   /gene_family="HOG000256147" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079560"
FT                   /locus_tag="AGOS_ADL340W"
FT                   /product="ADL340Wp"
FT                   /function="spermidine synthase activity"
FT                   /biological_process="spermidine biosynthetic process "
FT                   /protein_id="AAS51579.2"
FT                   /db_xref="GO:0004766"
FT                   /db_xref="GO:0008295"
FT                   /db_xref="HOGENOM:HBG011091"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="UniParc:UPI0001DB2747"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BA7"
FT                   /transl_table=1
FT                   /translation="MSDEITHPTIKDGWFREISDTMWPGQAMTLRVEKVLHHEKSKYQD
FT                   VLVFKSTNHGNVLVLDNVVQCSERDEFAYQEMITHLAMNLHANPKKVLVIGGGDGGVLR
FT                   EVLKHESVEEAWLCDIDEAVIRVSKQYLPEMSRSYEHPKVKTHIGDGFQFLRDYPNTFD
FT                   VIITDSSDPEGPAEALFEQPYFSLLNQALTENGVITTQAESLFIHMEIIKQLKGTCSQL
FT                   FPNVGYAYASVPTYPSGQIGFMVCSKNADIELSKPLRTISDEQERELYKYYSKKMHEAC
FT                   FVLPTFAAKELN"
FT   CDS_pept        111251..112561
FT                   /codon_start=1
FT                   /gene_family="HOG000225180" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751190"
FT                   /locus_tag="AGOS_ADL339W"
FT                   /product="ADL339Wp"
FT                   /protein_id="AAS51580.2"
FT                   /db_xref="HOGENOM:HBG058786"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="UniParc:UPI0001DB2748"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BA6"
FT                   /transl_table=1
FT                   /translation="MKLIISSSCYQAQICDLLPCNDNCKSQLIHGMLGAYGLLQHFDKV
FT                   ITAPYATKHTLNKFHSMQYLSFALDPRFNRSTEDCEDWAQVGQVARRYREAHGSSPREL
FT                   WHNTKAELYSKFVSRTGYQIADEGSDNDERAAMASAALAKYGLHDDCPVMDYLPMYIHT
FT                   VAGATLALAKELSRHRGSALAVNWDGGRHHALKARASGFCYVNDIALLIQTLRRQGFLR
FT                   VSYVDFDLHHGDGVENAFRYSKNVQTCSLHLFEPGFFPGTGACKNCTDNSVLNVPLLHG
FT                   VDDSTLDHVVDHIVTPAVQRHDPEVLIIQCGGDGLSGDKYGEWQLSIHGLTRNILKLVQ
FT                   AHKFKKIALLGGGGYNGRLQSRFYAYLTSMLLAQCKGIPTEIGDDEDELIRDHELIEMY
FT                   EQEDYKFWYYEYEGLNRKNLINDNTEEYMQKLLASFS"
FT   CDS_pept        complement(112558..113973)
FT                   /codon_start=1
FT                   /gene_family="HOG000216716" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751191"
FT                   /gene_name="ALG1"
FT                   /locus_tag="ADL338C"
FT                   /product="Chitobiosyldiphosphodolichol beta-
FT                   mannosyltransferase"
FT                   /EC_number="2.4.1.142"
FT                   /function="chitobiosyldiphosphodolichol beta-
FT                   mannosyltransferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS51581.2"
FT                   /db_xref="GO:0004578"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG058792"
FT                   /db_xref="HOGENOM:HBG319770"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniParc:UPI0001DB2749"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75BA5"
FT                   /transl_table=1
FT                   /translation="MDTSSVTMHTERACCHQAQRAVAAMLDKAPSWLIWTAVLYVGLPF
FT                   MLYWAVPYLFYHNKTKSRRIAIYVLGDLGHSPRICYHARSFSAAGWEVELCGYLEEQPP
FT                   KDLLDDPRVTIRALPGASNAGKSLGQTARKVVLQTCHIVRQLWELRGCDYILIQNPPSI
FT                   PLLPIVAIFKVLTRTRLILDWHNFAYTVLQLRVGRFLHPLVLVSYAVEFLFSRMADYHI
FT                   TVTAAMKDYLVQSFLLPARRIAVMYDRPGEQFRPLPAGERGAALAEPFIRGYIPAGFDV
FT                   QRGDTILVTSTSFTLDEDINVLFGALKIYESAAAKFDTTLPRILLFVTGKGPLKGKYME
FT                   EVRNYKWERCTIHFLWLSAEDYPRLLQLCDFGVSLHTSTSGLDLPMKVLDMFGSGLPAF
FT                   VMDYPAIGELVQDRVNGLRFTTRRELEQCLIFAIKDEHTRKVLKENALLESKNRWHQSW
FT                   ASAMSELQVVRQS"
FT   CDS_pept        114168..114611
FT                   /codon_start=1
FT                   /gene_family="HOG000233018" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079561"
FT                   /locus_tag="ADL337W"
FT                   /orf_name="AGOS_ADL337W"
FT                   /product="ADL337Wp"
FT                   /function="calcium ion binding"
FT                   /protein_id="AAS51582.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG483331"
FT                   /db_xref="HOGENOM:HBG746798"
FT                   /db_xref="HSSP:1AK8"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI0000252929"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BA4"
FT                   /transl_table=1
FT                   /translation="MSQNLTEEQIAEFKEAFALFDKDNSGSISSSELATVMRSLGLSPS
FT                   EAEVADLMNEIDVDGNHNIEFSEFLALMSRQLKSNDSEQELLEAFKVFDKNGDGLISAA
FT                   ELKHVLTSIGEKLTDAEVDEMLREVSDGSGEINIKQFAALLSK"
FT   CDS_pept        complement(114923..117052)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775301"
FT                   /locus_tag="AGOS_ADL336C"
FT                   /product="ADL336Cp"
FT                   /protein_id="AAS51584.2"
FT                   /db_xref="HOGENOM:HBG058815"
FT                   /db_xref="UniParc:UPI0001DB297E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BA2"
FT                   /transl_table=1
FT                   /translation="MGTDAIKKGLAAAGRSTIDGAVAVSKKGIKASKTHYEKSKAMRGG
FT                   KSASSSAGTSSQSYETQTRLAQLPDPRQFPPPPLRPEQRPQSGSAGAIGGSTGSSVSSA
FT                   AVSAGRASAVAAVVAPAALAVRTGPGFASAMDTAQGALNPAQPAVVPPVHGSAVSGRSG
FT                   NGNAPNISMPVHRPLPMRPDSGAPGAQLAINAPHVAPMHQNTPSYAIQGYSDYGMQERG
FT                   ATQGAVSTEPAPPPIPVRNYETAAAPAANPSRLPLELPPYPLMPCDDASYSTGMGAQPA
FT                   PSQLLPWPHVPGANASDGIIAPGQSASVGQAAPAILPSRPQVPGSDFGSQPVQEITTTS
FT                   TSQHQIQVKPYTWGAPKGDREANKINVPQVEINVLPPPPKHRDRDRSKSSTPAHIQQST
FT                   TGPKPSIPARRSPSAFASPATTGSGAGGPPSDQLETKCTQQTGHMQSASTSFSSLPQTS
FT                   PRNEGVASIAKTREESIGPTKGISGQYNYEISVSFEPPPKPHRRGDGPQSRASPFASSR
FT                   DNSTSVPDSAGSPSRGSIRHSALNNTDPPPPYTDTAHARAGSDSPAPSASKQRSSAGRS
FT                   LPPLSADRSLPPPARQAAGAMASRLSEEASGVTLRRITSPEGSQTGDGASVKKKPPIVP
FT                   KKKESLAGNKKAPPPVPKKKAILAQGLQRDAATSSDAAEVLSSSGIDTSAQDDNPFRRY
FT                   LKNVVPQENDRVHHR"
FT   CDS_pept        117217..117948
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079562"
FT                   /locus_tag="ADL335W"
FT                   /orf_name="AGOS_ADL335W"
FT                   /product="ADL335Wp"
FT                   /protein_id="AAS51585.1"
FT                   /db_xref="HOGENOM:HBG058819"
FT                   /db_xref="UniParc:UPI000025292C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BA1"
FT                   /transl_table=1
FT                   /translation="MENFIENEELLGVDSRGPGQGRARDPELVAGSIKWAFYYSKARVD
FT                   EHQLATKLKEMLKTSTDVEVSVRKDVAEIKGTPHNTMKRTWYLFVYGGDVLALSDASVI
FT                   NGDTSSAWDELGLYPFKVPFSSELMASAADALVPHCRPAVQVSFCASVQTKYLDRFDVE
FT                   ADARALLTQDAQCPVSRALLGALADQVGVTSALGISSVRLASDVYICSGYTRFLGTCSR
FT                   RGTAAIAPAVRSAVCRGASAA"
FT   CDS_pept        complement(117952..118506)
FT                   /codon_start=1
FT                   /gene_family="HOG000228313" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751193"
FT                   /locus_tag="ADL334C"
FT                   /orf_name="AGOS_ADL334C"
FT                   /product="ADL334Cp"
FT                   /function="iron-sulfur cluster binding"
FT                   /function="structural molecule activity"
FT                   /biological_process="iron-sulfur cluster assembly "
FT                   /protein_id="AAS51586.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0016226"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG058825"
FT                   /db_xref="HOGENOM:HBG730174"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="UniParc:UPI000025292D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BA0"
FT                   /transl_table=1
FT                   /translation="MFKRILARPPAGLPRPLAFYSAARLRGLRWQSSANVLAGDGAGPL
FT                   VTPTRVVNGDPSLRLNITQRAAQRLGEIYRSSGEVLRVGVESGGCHGFQYNLALQPRPE
FT                   SQPSGADASEFDEFEDRKDIVYVLPEEQGEVVIDHASHEILNNTTLTYTTELIGSTFRI
FT                   IGGKMTSSCGCGSSFDFDGQS"
FT   CDS_pept        complement(118623..119582)
FT                   /codon_start=1
FT                   /gene_family="HOG000166793" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751194"
FT                   /locus_tag="ADL333C"
FT                   /orf_name="AGOS_ADL333C"
FT                   /product="ADL333Cp"
FT                   /function="ATP binding"
FT                   /function="small protein activating enzyme activity "
FT                   /biological_process="protein modification process "
FT                   /protein_id="AAS51587.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0008641"
FT                   /db_xref="HOGENOM:HBG028577"
FT                   /db_xref="HOGENOM:HBG521753"
FT                   /db_xref="InterPro:IPR000127"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR019572"
FT                   /db_xref="UniParc:UPI000025292E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B99"
FT                   /transl_table=1
FT                   /translation="MRAREDSLARCRVLVLGAGGLGCELLKNLALLGIPELHVIDMDTV
FT                   ELTNLNRQFLFRETDIGHPKAAVAARYINGLALPSVVPGRGVRVEPHVGDLTQQPSAFW
FT                   EGFTAVISGLDAIEPRRHANALLVRLTLSSNYAKCIPLIDGGSEGFAGHCKTILPGISA
FT                   CYECSLDTLAPPGLAFPLCTIANKPRLPQHIVMYVLTVEWPTAPFQAGCSFDDPEAVAW
FT                   LAQRCATRAAAFGMNAAAFTTAYVLGVAKRIVPSVASTNAIVAAACCSELLKLVHDLTD
FT                   PENMNNFLQYNGAEGCFAYSFTHQRLPSCPVCSQGDGC"
FT   CDS_pept        complement(119667..120236)
FT                   /codon_start=1
FT                   /gene_family="HOG000161354" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079563"
FT                   /locus_tag="AGOS_ADL332C"
FT                   /product="ADL332Cp"
FT                   /protein_id="AAS51588.2"
FT                   /db_xref="HOGENOM:HBG055481"
FT                   /db_xref="InterPro:IPR012098"
FT                   /db_xref="InterPro:IPR019263"
FT                   /db_xref="UniParc:UPI0001DB297F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B98"
FT                   /transl_table=1
FT                   /translation="MNPQISNLAIMLVLMQISRRLNMEDPTVILYIRILYVTSTVLAYL
FT                   VYQVTRKRIVAKNDLTTLKYVTPANPLSGQPEEQLKVTTVRDYDLEQLDSSIKSIYTGV
FT                   LMMGFMHLYLKYTNPLLMQFISPLKTALEHAEVRIHLFGKPATGELKRPFKQAGLFGMG
FT                   AAAGPKTDKQSIEAAEKAGTGGVKAE"
FT   CDS_pept        complement(120467..121717)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079564"
FT                   /locus_tag="ADL331C"
FT                   /orf_name="AGOS_ADL331C"
FT                   /product="ADL331Cp"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51589.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG058839"
FT                   /db_xref="InterPro:IPR000910"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="UniParc:UPI0000252930"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B97"
FT                   /transl_table=1
FT                   /translation="MADEDGEAGEAGAGALGYKQKQHIPRPRNAFILFRSHQQKLLTDY
FT                   WKQSGQDIPHNCEVSKIISYQWKKLTAEEKKEWHDKAELEKQEHAKKYPGYKYKPKRKK
FT                   NRNKLALEFELQNLVRMYPHGAAAGASAPAGALPPLGREEPVHLQQPAGASAGSQTPST
FT                   YLMQLAPWENRYPLEQAPGPPAQPLARGAASPAPAPAQPAFGSPHAAKAYAPEVWKPYY
FT                   RQPQQPQALTQQPQALPQQQLPQQLPQQLPQQPQQLTQQQQQLTQQPQALQQQQALQQQ
FT                   QALPQRLPQHYPPAQRQQPYRYPQPYRYPPQQQQYYRLPNLQQDAYLDHGFPQHALSAN
FT                   PSSAGSNPSPMPAMGAPVQTARYPMPIHHLPGSSNTSSATTAPNLLPHSSSNSNIAATV
FT                   AMNNLGTSHPDDISHGK"
FT   CDS_pept        122426..123256
FT                   /codon_start=1
FT                   /gene_family="HOG000142012" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622750"
FT                   /locus_tag="AGOS_ADL330W"
FT                   /product="ADL330Wp"
FT                   /protein_id="AAS51590.2"
FT                   /db_xref="HOGENOM:HBG058846"
FT                   /db_xref="InterPro:IPR018618"
FT                   /db_xref="UniParc:UPI0001DB2980"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B96"
FT                   /transl_table=1
FT                   /translation="MINETRSAKGTAPATPAGTGLFRCGSGESLASAWTADTSAGCSPC
FT                   ARKYMAGLGGGGGGGEAAPRATTTTNWLRPLMAFQGYQISGYKKYQVHVLLQTVALPAE
FT                   GCAAATTPHVTGFLTIRGLTNQHPEITTFFESFAVNDTVGFLSSSMPPELAEYKSSDRV
FT                   DLEHWLNFPSFKELCMAGGGTTVADIMDGHYTHRDYLARRFVFMRWKEKFLVPDEEVGA
FT                   VEGASYDGYYYIVHDQVTGSVLGFYYHKDAEKFQQLELTPVYPDRQGVCCFEFA"
FT   CDS_pept        join(123386..123426,123479..123764)
FT                   /codon_start=1
FT                   /gene_family="HOG000000997" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775302"
FT                   /locus_tag="AGOS_ADL329W"
FT                   /product="ADL329Wp"
FT                   /protein_id="AAS51591.2"
FT                   /db_xref="HOGENOM:HBG124459"
FT                   /db_xref="UniParc:UPI0001DB2981"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BH6"
FT                   /transl_table=1
FT                   /translation="MALHNVRRADLTAQYTHVLAPDTAYTGASQGVVSQSMPMLAMFMR
FT                   NKFLAWFSLLTAWHTYLTADPNAVRDREGTEVGPIMKLGMAVVAVVVCYTGMVLPQPAP
FT                   GAKR"
FT   CDS_pept        complement(123785..124240)
FT                   /codon_start=1
FT                   /gene_family="HOG000085050" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079565"
FT                   /locus_tag="AGOS_ADL328C"
FT                   /product="ADL328Cp"
FT                   /function="hydrolase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS51592.2"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG220403"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniParc:UPI0001DB2982"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BG7"
FT                   /transl_table=1
FT                   /translation="MAQWDRKGMEIAYQEALQGYAEGGVPIGGCLIDQTDGTVLGRGRN
FT                   MRFQRASATLHGETAALENAGRLPGHVYKHCTLYTTLSPCDMCAGAVLLYGIPRCVVGE
FT                   NDTFLGAEAHLRARGVEVAVLQDARCRALMQQFVAARPQDWNEDIGL"
FT   CDS_pept        124325..125242
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775303"
FT                   /gene_name="JID1"
FT                   /locus_tag="ADL327W"
FT                   /product="J domain-containing protein 1 "
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial membrane"
FT                   /protein_id="AAS51593.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0031966"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG058862"
FT                   /db_xref="HOGENOM:HBG203968"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI0000252934"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75BG6"
FT                   /transl_table=1
FT                   /translation="MAKRANWSLDGQQSSGGGAASWICACTDKISIAKALTRSLSVMLS
FT                   RPTALLRTGARWRVSLTASGRSTVRCASTVAGWQGGLSWPQGKQPTPYEVLGLVKTGVD
FT                   ARQLKKRYHELAKLYHPDTAGAAQQGLGEHERLRRFKLVNEAYALLSDASRRRMYDMYA
FT                   TGWAHGPAPMAPAMAHGAYHERYAYYNAGTWEDMQDLNSDRQQVQFSAWGMVVWALCML
FT                   AGFQVMAFLIRLEERTSKSAHTHEEAEHALLLAHLNYGLDQDRVSRVRRFLWFRSWGLY
FT                   RTKAELDEAARTNEALVRQLEGGK"
FT   CDS_pept        125440..126219
FT                   /codon_start=1
FT                   /gene_family="HOG000176992" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751195"
FT                   /locus_tag="ADL326W"
FT                   /orf_name="AGOS_ADL326W"
FT                   /product="ADL326Wp"
FT                   /function="chorismate mutase activity"
FT                   /biological_process="aromatic amino acid family
FT                   biosynthetic process"
FT                   /protein_id="AAS51594.1"
FT                   /db_xref="GO:0004106"
FT                   /db_xref="GO:0009073"
FT                   /db_xref="HOGENOM:HBG055772"
FT                   /db_xref="HOGENOM:HBG611693"
FT                   /db_xref="InterPro:IPR008238"
FT                   /db_xref="InterPro:IPR020822"
FT                   /db_xref="UniParc:UPI0000252935"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BG5"
FT                   /transl_table=1
FT                   /translation="MDFLDPKSVLNLDHIRHELVRMEDTIIFNFIERSYFPTCPVVYHA
FT                   NHERLPLPDFDGSFLDWAHMHMEMTQSQLRRFEAPDQVPFYPGSILPPILPPVQYPKLL
FT                   APYAPQINYNDRIKAIYLDSVVPLVSLGEGTSWENLGSVTSCDIDCLQALSRRIHFGKF
FT                   VAEAKFQLEPEKYTALIKNRDVDGIMDSITNKFVEDKILKRLQAKATVYGVDPLDRNCS
FT                   KRVTPEYLAKIYKEYVIPITKEVEVEYLLRRLEGEDL"
FT   CDS_pept        complement(126627..127595)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751196"
FT                   /gene_name="BRR1"
FT                   /locus_tag="ADL325C"
FT                   /product="Pre-mRNA-splicing factor BRR1 "
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="AAS51595.1"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG058872"
FT                   /db_xref="UniParc:UPI0000252936"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75B95"
FT                   /transl_table=1
FT                   /translation="MGHTSGPVDPVFGQCQVFDCSAAEVNPEVVKYLAHVRDEALHTVG
FT                   VVPSASNLRKRKIEISYDDEEVVKRPSEGEKAIELPFDMDEVISWFDQVKEDALSEREA
FT                   FEGYDEETLNTLLVGIRDYISRMSSRDESTNNLIKLLEGVQPVVTNEALELDEKWAAKL
FT                   VARLGRRKFTTLDNLKLRLNTQLPIPTRAKAWKIHIPINEPSHEFFHRMNSTQLFDLLR
FT                   YLTDNIVEHYQTDSATDYGQWLVYLLLHLPRQLTANEISEVRGLSKKVRALIIDHEILK
FT                   LPMLLPSEIEDVSPIPRGVNPLHLALAVVAVIYGQRDILFL"
FT   CDS_pept        127723..128109
FT                   /codon_start=1
FT                   /gene_family="HOG000142021" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751197"
FT                   /locus_tag="ADL324W"
FT                   /orf_name="AGOS_ADL324W"
FT                   /product="ADL324Wp"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS51596.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058876"
FT                   /db_xref="HOGENOM:HBG103547"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000252937"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B94"
FT                   /transl_table=1
FT                   /translation="MPKRLRTEEYSCNQEDERSDSQVIVCNDPPCSGARISMHIYPSHV
FT                   AEHHDNVCAACNKNMITERMLQLHLQELHDPFNSNKALECYEADCMQQFQTHSKRREHL
FT                   ITVHEYPMNARLDIVYTGYNDTTT"
FT   CDS_pept        complement(128102..129127)
FT                   /codon_start=1
FT                   /gene_family="HOG000175900" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751198"
FT                   /gene_name="TFB4"
FT                   /locus_tag="ADL323C"
FT                   /product="RNA polymerase II transcription factor B subunit
FT                   4"
FT                   /function="general RNA polymerase II transcription factor
FT                   activity"
FT                   /function="metal ion binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="transcription"
FT                   /cellular_component="core TFIIH complex"
FT                   /protein_id="AAS51597.1"
FT                   /db_xref="GO:0000439"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016251"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG382873"
FT                   /db_xref="HOGENOM:HBG737144"
FT                   /db_xref="InterPro:IPR004600"
FT                   /db_xref="InterPro:IPR018381"
FT                   /db_xref="UniParc:UPI0000252938"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75B93"
FT                   /transl_table=1
FT                   /translation="MDAIADSTFQINKSKVQLVEETPSLLTLVIDTNPKLWAEFDREVG
FT                   KKGQLMQVLKSTIVFLNAHLSFNNSNQVSVIAACSRGIKYLYPQADDKEGSTKKKKSED
FT                   RSIINRNMYRGFRNVDEAVVEELYRVFQQESKQLEDGVPQPFRSTLSGAMSAGLTYINR
FT                   ITHETEGVSLKSRLLVITCGSSASKDEVFQYIPIMNCIFSATKMKCPIDVVKVGGVKES
FT                   TFLQQATDATNGNYLHVANTDGLIQYLSTAMFIDPSLRQWVVKPNQSSVDFRTSCYLTG
FT                   KVVAIGFVCSVCLCVLSIIPPGNKCPACDSEFDEKVVAKLSRKPVITGTLRKKKKKKVT
FT                   K"
FT   CDS_pept        complement(129301..130806)
FT                   /codon_start=1
FT                   /gene_family="HOG000111162" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775304"
FT                   /locus_tag="AGOS_ADL322C"
FT                   /product="ADL322Cp"
FT                   /protein_id="AAS51598.2"
FT                   /db_xref="HOGENOM:HBG058888"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013720"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0001DB2983"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B92"
FT                   /transl_table=1
FT                   /translation="MSITSEELNYLIWRYLQEAGHEVSALAMQEETRVLEFDEKYKEHI
FT                   PLGTLVKLVQKGILYTESEFLVQYNAQSEGADAEHYGKDFNLVQALEVDKQRFPELVAQ
FT                   GRFALAHEREEPEAEPEVTRLESDDSFIKTLQCVQTFPPGYVSQWNPKHEGVFAYGERD
FT                   SRAAVVTYSVADGLWNISETVVLPHANTGQQNEVTCLEWAPGGQSLLTGVESGELRLWS
FT                   VEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTE
FT                   ESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLS
FT                   ASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTV
FT                   ASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQKLLQQLNHNGYHGTARSAEVAR
FT                   IPVVGDHRSAREGNYVTQISWSQESTQLSVSYSLGDINILSVD"
FT   CDS_pept        131171..133264
FT                   /codon_start=1
FT                   /gene_family="HOG000000727" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751199"
FT                   /gene_name="EXO84"
FT                   /locus_tag="ADL321W"
FT                   /product="Exocyst complex component EXO84 "
FT                   /biological_process="exocytosis"
FT                   /biological_process="protein transport"
FT                   /cellular_component="transport vesicle"
FT                   /protein_id="AAS51599.2"
FT                   /db_xref="GO:0006887"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0030133"
FT                   /db_xref="HOGENOM:HBG058894"
FT                   /db_xref="HOGENOM:HBG204158"
FT                   /db_xref="InterPro:IPR014812"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="UniParc:UPI0001DB2984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75B91"
FT                   /transl_table=1
FT                   /translation="MVDFSLRKARNNWSKLSSPGKTRQQGSPTKLKSNAYEDFVSPRDT
FT                   LQLPEIGMKDRRKVGTSMQRRLSVHNAKYIPPPIDYASAPALPTAVELPVRDNSLLSSE
FT                   LMKPNHRRPPVDIYGGRSLREILSNPQFQAKRFVHEKLGDATALEIDHFASNLNHLSQE
FT                   IEQEIKSNINKSYNELMQVNKELAVASTELKDLRSKVQQLQVVMGQFTAMAEKRLLLEK
FT                   EHFRQSNTSVMTTKSGSTGSGLLPPVKSGAAKKDRSSVIILEKIWTNELSSLFRSVEGA
FT                   QKYIAPAPGRRILLESNDWMEINIATLKPLHATRIFLLNDMILVAVCRSDKKGELVANQ
FT                   CCSLRELTVAEESNYTLSFHFGNKHHSLYRSRTPTGYTALLNEIKSAKDELRDIYQAEE
FT                   DNARKLRDSFTYLQSTQQSPSRDISSPARGHSRQRSLGTLQNTPSRASTYQENLLQNIS
FT                   MSMHTRSRSGGVNQTAVKLNLVYEELEELSVPVTRMNFGLAIKKLHSIENILKGITAEA
FT                   EGEVMLLNLLRMKCNQTRTLITQKLTHVINTEYSDANKLESSTKSLILLGMPAEALQLF
FT                   LHNRSNFIQDLVLQVGVHDNSNSYITQVAVIRCQTIKKVAIQFQKLFEGTTAKYSSVLV
FT                   SWCNDEVDKHFFLMKKQLINDDQLTPQAIKISRKQIDELKSVGMDFVYKLDDFLKIHSN
FT                   KIY"
FT   CDS_pept        complement(133335..135383)
FT                   /codon_start=1
FT                   /gene_family="HOG000144414" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928296"
FT                   /locus_tag="ADL320C"
FT                   /orf_name="AGOS_ADL320C"
FT                   /product="ADL320Cp"
FT                   /function="zinc ion binding"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS51600.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058899"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000025293B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B90"
FT                   /transl_table=1
FT                   /translation="MFKKISIDVDIHPLSDKVVLPHEVLANWAGLSTGDVFEQSKPLTL
FT                   LLTARRQGATGAIGTCVVGIREFSLDDKEAILLPWLVAQRLELGNDLSEVTIEYRVFSE
FT                   LPNGTSMQLEPLGVVFWSRLLAEPGHGMDDSVDAPLPAWLQSDDEHVRAFLEARWNNTL
FT                   TSVMAGDCLLVSTAENGAAAEELYKFKVLRLEPAEVVCVVNTDLRLDVVRSVRAPTAAG
FT                   SEVEHVREVVGQSGRTATVQLGDVVHVLPGTNEMYQIDTRGERAVVEILCNDEDESFHI
FT                   VGGTSDLVTEEFYEITSVASAAKESHNGKNRGNCIPIDSSIRFLRSCFSSAPKGSTFSF
FT                   TVRPAAEPSVACITSADEVCCEYCGNCILKDTYMMHELHCQRRTKICDVCGKKYINTRV
FT                   KPTAHWHCPKQDCGGVGDTEQSHITHDRYCHEEQLCEGCQHSFANAIELGRHKALDCPM
FT                   SFHYCRFCQLKVLHGESTVESRYFGLSGHEYHCGVKTVDCYKCQKPVRRLELASHLALH
FT                   DHERKVRGKNTLILLCGNVNCRRAVSSFSNDHNLCDTCFGPFYSTEEDLNGKRFRIRLE
FT                   RRYFIQMSRGCGSTYCKNSACISSGLASFPDTLSLMKYVQQLLLETDYYLCVDEATTRR
FT                   KLLADTFLEVSDAYASPWVYRAVDTGAKDVASVEQWLKENALAKSEL"
FT   CDS_pept        135633..136502
FT                   /codon_start=1
FT                   /gene_family="HOG000000726" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079566"
FT                   /gene_name="FES1"
FT                   /locus_tag="ADL319W"
FT                   /product="Hsp70 nucleotide exchange factor FES1 "
FT                   /function="binding"
FT                   /biological_process="regulation of translation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS51601.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006417"
FT                   /db_xref="HOGENOM:HBG058907"
FT                   /db_xref="HOGENOM:HBG398639"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013918"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000025293C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75B89"
FT                   /transl_table=1
FT                   /translation="MDKLLHWSIANAQGDKEAAAKAGAPDPKLLQQLFGGGPDEPALMR
FT                   DAMAVIMNPEATVDNKLVAFDNFEMLIENLDNANNIENMRLWAPLISILESEEEQLREC
FT                   ALSVVGTAVQNNEKSQSNFLKHDGAMKKIIELARKDSESEQVRTKAFYALSNIVRHNKD
FT                   ASALFVDNGGLEIMAPVLKHQNTGEKMKIRALALLTSVLTSLSADEKFSDRIREDKILE
FT                   ASLEHLAPSANPYLIDRVLNLLVLMKGSGAKFDTDELSKIRKSFASLYPVKDQLNEDDY
FT                   NAVKEMLG"
FT   CDS_pept        complement(136547..138691)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622751"
FT                   /gene_name="EME1"
FT                   /locus_tag="ADL318C"
FT                   /product="Crossover junction endonuclease EME1 "
FT                   /EC_number="3.1.22.-"
FT                   /function="DNA binding"
FT                   /function="endonuclease activity"
FT                   /function="metal ion binding"
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /biological_process="meiosis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51602.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="GO:0007126"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG058908"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="UniParc:UPI0001DB2985"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75B88"
FT                   /transl_table=1
FT                   /translation="MKSIELIDIESIASDRAGITREDGVIELLSEADEALGRRPYPSSP
FT                   TIRSTEANIDESIGNRQLWLQSIELNGEFQEDDSEEVEETIGKKPDDALVCSDACSAPD
FT                   VSIQELLQTFTPPKPHAGRVMKAGAGPVRGSSRQTSSKLQTKDVLQDILVELDDNLSSW
FT                   DTPSTSGIRSPETVATLAAKWANKTEKTSGKPLYGRPRSSGNRGNILLKRTLANRNNIL
FT                   SSELGGESSPSLQALTTPLPAKSNDGDKNQTTNVMTTGGFRLGTMEKQTLNGSACVDRI
FT                   QQVPVSSPESVSFLEGLSDIPISKPVQLTQRCIAATNTGYTKDNCASTPRSAAAVEYLE
FT                   PIDTDTSILSTAGEALPHSPVKPSKVSRERSKRDYIVHSKAFTAEESKAKIRQLMSNTA
FT                   LKKQFNEVNKVTREKQSLLAEIVLSINEQVHQYLLEQKVPIAEVLGPTTVIHNFESVPI
FT                   IRFKRKCTSMYDLNNDIYYPCETTMCNEPICLLFYNAVDFFTKYKNQKQRLYSEVQDLK
FT                   RAGNKVIIILNEYSRLEKSLAELENRCMRSRVEQQLTGDKSPRRKTVKEVQLTALEMNS
FT                   KDLGRKVNEMIIKCDIDIFPINSAASFANWISNLVWVVAKMRYDPMMKNVNWSHINVKI
FT                   GKTPTEVLSKTLQQINGVTEIRAGRVTSTYPSFQQIFTDFEKGYLVAGKDGNPLMTKVA
FT                   EKAMNALLMSEDPEEQIYIN"
FT   CDS_pept        complement(138862..141879)
FT                   /codon_start=1
FT                   /gene_family="HOG000066032" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775305"
FT                   /locus_tag="AGOS_ADL317C"
FT                   /product="ADL317Cp"
FT                   /biological_process="protein transport"
FT                   /biological_process="vesicle docking involved in exocytosis"
FT                   /cellular_component="exocyst"
FT                   /protein_id="AAS51603.2"
FT                   /db_xref="GO:0000145"
FT                   /db_xref="GO:0006904"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG058909"
FT                   /db_xref="InterPro:IPR007191"
FT                   /db_xref="UniParc:UPI0001DB2986"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B87"
FT                   /transl_table=1
FT                   /translation="MNKLRLSSKRNRSLSTTNSPDVDEHKHYDSLAKLQNDLSRIESSW
FT                   NKVITKDANPLELALQFLDDTSVGLGHRYGEFHQLKSQIANNLQEAANEHYQTFANSIA
FT                   SYGQTVKYLNDSRGNISQVKGKVEGVMASLTVEDPELDELNNESMKHAKMIETLNAIEH
FT                   VLLIPGRVEKFISERQFSSALESLVQGFTLAQNHHLWQISALSRTKQQLEAQENTLFDT
FT                   ALEELVELVYSKQKSVFSDLNFLDHVATEEGFNTLESHLHQVISIDIMEHSSKMNRQLQ
FT                   EFLKRLEARKAEGNSSVQLTVQNETDYDRIFSLLCVLNNMNKLSSALEQVVAKNKEELH
FT                   LIVTKAVDNVRAKFPNILKMVDAIKDRSNFGISDSNFLSIVLRKLFWEIFTKFLMAAQG
FT                   HRVIYEIRESMHTSSNSKYPAQKVWDEILAEIGNLLKSYTSDPTIYTSTHSRHRRSSAA
FT                   TSHLPQKKNLFNLQNNLVDSNATRNHANALKSLLQDMFPGFTSNSNLDLDEIYLEDDRF
FT                   EEEDTLIPLSVFNMKVILESFLVFVEGTKNVIPAQFAEETVSSLVFFQEYMNNVFLPRL
FT                   DRTINYFYEQQVEPNNPFALETINDSSVILKTAIDFRNLFIRLLYVMNTSYNYREGISD
FT                   ILLSLLHRFYTYYYNLFQNLLTSANSRFTKKLVATWLSDEELISITENILCDDDTYVPQ
FT                   ETTALLKYCPDYDKKSGVVSKNDFFSSSTIDTITYFLGTLTWLREWLPQLKQEVNEDDY
FT                   TVDVNNIDKLRSNWSFFEMVDLEKMDKMGSLKFLLTGRSLEKFNSIVKGFLELEYKLLS
FT                   CLRYDVRAKCIYNITEMLHTSKWNPDATSIELNPYITALTSEIGLLENKLSQRSNDQQR
FT                   QVVFVGLSYLINIGFLACSHSIRVLNTNGVKKIIRNVNVLQQTCRNISSTPEKEDMSLT
FT                   LNYFAMCSMNENTVVEYYNEGKLSQYTLEEVKNILRLQFSEELYRKLRHKSGTRVVSIS
FT                   SNKRYEDAVNRLVTPT"
FT   CDS_pept        complement(142079..146314)
FT                   /codon_start=1
FT                   /gene_family="HOG000216566" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775306"
FT                   /locus_tag="AGOS_ADL316C"
FT                   /product="ADL316Cp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS51604.2"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058910"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020648"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniParc:UPI0001DB2987"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B86"
FT                   /transl_table=1
FT                   /translation="MGAQLSLLAQTSPSIALSSYIDILDDVHYVTHLNSSRFLKTCKAL
FT                   DPNGEIIIKVFIKPTENYSLQEQYEQIRNESLRLAQLPNVLNYSKIIETDRAGYLIRQH
FT                   LKMNLYDRLSSRPFLQEIELKFLAFQLLQALEDLHSKGLTHGDLKTENILVTSWGWLIV
FT                   TDVSSFFKPVYLPDDNPGEFSFYFDTSGRRSCYVAPERFNSALYKHSNNDTRPTKEMDV
FT                   FSAGCCIAEMFSEGHSTFNLSELFKYKTGEHAAEDIISTSIKNTHLRSLISDMIQLRPE
FT                   KRLTVPEILLKYRDSFFPSYFYTFTYEYFRDLAVLNGHSSALNSTCSSDTLADRVDNID
FT                   GMVTKVYQDYSKICSSLHYPVVHSRNRDQESRKLITGRVKLPVLGEVELQQYKPDSPQL
FT                   QEESALLFLTFLLHAVRNLVSSGNKLKCLELITALSQYVSDGNKLDRVLPFVCAMFFDT
FT                   TPTVQGLAIQSLTQILSIVSTLTSINDNVFVDYILPRLKQVLQSSKNNPYVRMILADSI
FT                   GNIADSAVRFQEISQILRPPSNTEVSNSRKIRRRLVRNFEEITVALLTDVESSVKLALL
FT                   ENILPVCNLFGREKTNDIILSHLITYLNDKNSLVRIKLVQAITGIVILLGPITLEQYVL
FT                   PLLIQTITDSEELVVVNILQSLKWLCEVGMMRRRYFYEIAEIVTVLLLHPNAWIRQFSL
FT                   LLILEMSSKLSKAEVYCILYPIIRPYFEFDVTFSWESMFASCKKPVSRNVYNLLCTWSL
FT                   RATKTLFWKQVPSKSVDSFGNNSIEFITKDYTAKNYGFNSGMKVSSASVSLPSNKEIPL
FT                   TTEDKNWLDKLRAVGLHESETWKLAALRTYVFRVSKMLARKPELQDELDTRKAHSTFSN
FT                   SFIMPRNIFFDVDIVDENRVENSHLNTENKCSSDSLSTTLGTNSHRYLPLSIGVNGSLI
FT                   LSKKASPTIRSNLDNVYVQLEPTSEYPISFAHAPRKTAQESKFVISNSYDGDVSTIKQY
FT                   LRNVNIKPYLKSYREFGPYFNQSSGTKRQSSGTAFKGKLHFHLTENRPASIVKIVTSEY
FT                   KPYCISASDQGVLKLWDLTKLRDGEVYDPPIHYDLGSSIVDLRFLPNYDVFAAATRDGS
FT                   VSFLRVCFKERNSMEAYSHFEVIRKYTLKDENEYATNIQLSASDSKPYALFTTNYSRII
FT                   LLDIRTTELIATMQNNQRHGAILSCTAASDLSWFILGTSKGILDLWDSRFRVLVKSWTF
FT                   AENFPITHIEPYPSLTRRAENNIVLVGGSRRSLVSVWDISKAVCREVVLTADSKCLSTD
FT                   FIAVEKGIEDLAVHIDPFSTTVSAIHVSGHRVYIADRETGSILMVNFRNKAQNCIVVGH
FT                   SEQNISFSSSQLSSTLGLTIRSVSDSAAMHSLGVYFHTDIINSFTIAKDTPEPLLISGD
FT                   NSGVINIYR"
FT   CDS_pept        complement(146549..147853)
FT                   /codon_start=1
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751200"
FT                   /locus_tag="ADL315C"
FT                   /orf_name="AGOS_ADL315C"
FT                   /product="ADL315Cp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS51605.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="HSSP:1KE8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000252940"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B85"
FT                   /transl_table=1
FT                   /translation="MPLLQQNPPIQPPYSRASQKLKSLLSSYGENTSTTTAAKEMNGIA
FT                   PMNLIEKSVVHPPRTIYTKANFSIPGHYEVLQMLGKGSYGTVVSAIDNLNANYPIRIAI
FT                   KKITNIFQREVLLKRAIRELKFMHYFKGHKNIVSLINLEIVNEKPYDGLYCYQELIDYD
FT                   LARVIHSNVQFSEFHIKHFTYQILCGVKYIHSADVIHRDLKPGNILCSISGQLKICDFG
FT                   LARGISPLFTNTKTSNHITNYVATRWYRAPELILSHKRYNKSIDMWAIGCILAEFYGRK
FT                   PIFMGQDSMHQISEIVKVLGTPSRDTIIKYGSSRAYDIFCPPKPQYAKIPWAEIYPFAG
FT                   PDALDLIERLLDWDPDRRLTVEEAIEHDFVKSVRDVNDEPCCPHGPFNFSYEAEFKSMS
FT                   NLREVLYAEVKQFQEECATKDVVPSLPIPQQIYPI"
FT   CDS_pept        complement(148112..148816)
FT                   /codon_start=1
FT                   /gene_family="HOG000000725" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928297"
FT                   /locus_tag="ADL314C"
FT                   /orf_name="AGOS_ADL314C"
FT                   /product="ADL314Cp"
FT                   /protein_id="AAS51606.1"
FT                   /db_xref="HOGENOM:HBG058911"
FT                   /db_xref="HOGENOM:HBG396171"
FT                   /db_xref="UniParc:UPI0000252941"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B84"
FT                   /transl_table=1
FT                   /translation="MANHWWTAARTLFALFLASSYKSLPGAYFVRFAYYLTKNLLLPKV
FT                   LVGRTGSTANMRALKKDHHGAFRRSVIHTYCSPFECDFYLHKNNATYFEELDFSRTDLM
FT                   TSVFQQLFLRARAWPYLPVANVFTGFRKEIAPFQRYTIDSCVLCWDDKWIYVLSRFMLP
FT                   GVELPCAVSITTYVFKDGRRTITPREALEACELYNEDVEHIAQENLKTVLDHNSFTPTD
FT                   RLYKLTHCYTVL"
FT   CDS_pept        149359..150459
FT                   /codon_start=1
FT                   /gene_family="HOG000142008" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751201"
FT                   /locus_tag="ADL313W"
FT                   /orf_name="AGOS_ADL313W"
FT                   /product="ADL313Wp"
FT                   /protein_id="AAS51607.1"
FT                   /db_xref="HOGENOM:HBG058912"
FT                   /db_xref="HOGENOM:HBG204154"
FT                   /db_xref="InterPro:IPR013904"
FT                   /db_xref="UniParc:UPI0000252942"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BH3"
FT                   /transl_table=1
FT                   /translation="MTDTSEHVLTEEEERHQILNFTKYVLSQRTGNFPELNHTEDGTVF
FT                   PSIRGETTNRGYKLYQDAKGVSWRRLRVDTLEKKVFYSGSDHKLLARKRMKFSTTPQFH
FT                   RNDGDNDTSDTEESDDPEDLHDLVDVRKVLSPISSLADVATHPAVSRTFQSKVLRDLAL
FT                   DMILMVEKEQESVISYSRLLEVFLGDFPDALHEEQLGLPGYDHKLKLPEEDGASPPIAY
FT                   QKEAPDTAEDLHQPKEENTGYKAEEGEEQEDPFFAIPKLHGIQELSPPANDTGATDQLE
FT                   TTRQLAQIALQRNQEFIRNLQKIRNCIVKTNRIRERILVWGKEMAGIPEDDVTVPSALH
FT                   IVKRGLISATTNHMDEEAEEDDIEEE"
FT   CDS_pept        complement(150586..152742)
FT                   /codon_start=1
FT                   /gene_family="HOG000196814" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928298"
FT                   /locus_tag="AGOS_ADL312C"
FT                   /product="ADL312Cp"
FT                   /function="ATP binding"
FT                   /function="hydrolase activity"
FT                   /function="tubulin-tyrosine ligase activity"
FT                   /biological_process="protein modification process "
FT                   /protein_id="AAS51608.2"
FT                   /db_xref="GO:0004835"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG053941"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR004344"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="UniParc:UPI0001DB2988"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BH2"
FT                   /transl_table=1
FT                   /translation="MRVLLTNDDGPPHDAYSPYVRHFVDHVARHTGWELTICVPDRQRS
FT                   WVGKAHFPNANPRASFIYTAVEAGDNGFDGPHAVPLRGSRLTRLAGCAAAQREVPAGHV
FT                   EWCLLENSTPATCADIGLNHLVDGEFDLVVSGPNVGRNTSSAYITSSGTVGAAMNAVIT
FT                   NQVPAIALSWAYFDGAAVVSDALFRDASERSVELIQWLYSHWDPRVELYSINVPLKEGL
FT                   RSARTLYTSIFPTQWCSVYSGVRVVPVGGAVGADGEAPAQDSVALEFQWSPNFAKAREA
FT                   ALSASGELYDGKVIEEGHISVTPLLANFQVVEEILGEPIMGDRDRTCAAITIPSTDYIY
FT                   GPLTAALKRHLPELAIMDALPDLQSGQHSKVFHYGDYEQIDVDQLFSSSHYYANAYIYR
FT                   KALIRKHFLSHTIHSYVVKRPESVLKRAYLESFNIEIDYAEFLDDALDENWELRQELEQ
FT                   ETKWWILKPSMADKGQGIRIFKTIDDLQAIFDSFEEEETEDEESTRVVSSQLRNFIVQE
FT                   YLPNPLLLPRMDNRKFHIRCYIVCNGDLQVYVYSRMLALFAPTPFVLPAANHEVTDIQS
FT                   ISCHLTNTCLQTDSGVAENAVREFDSLDDLTDVDKEKVKSQINDITKELFLAAVNLNRL
FT                   HFQPLPNAFETFGVDFLVDENLNVKLLEVNAFPDFKQTGDDLKGLIDHLFDNIVSHCVN
FT                   PMFGNPVNSDPTFVEVLKHSSHDW"
FT   CDS_pept        152827..153135
FT                   /codon_start=1
FT                   /gene_family="HOG000211421" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751202"
FT                   /locus_tag="AGOS_ADL311W"
FT                   /product="ADL311Wp"
FT                   /function="metal ion binding"
FT                   /biological_process="protein import into mitochondrial
FT                   inner membrane"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="mitochondrial intermembrane space
FT                   protein transporter complex"
FT                   /protein_id="AAS51609.2"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0042719"
FT                   /db_xref="GO:0045039"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG371100"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="UniParc:UPI0001DB2989"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B83"
FT                   /transl_table=1
FT                   /translation="MSLFVNPYGAQELNQARLDVAEVQFDAMTTTFNTLLAACREKCVP
FT                   HDGYGEPDLTRAELSCADRCIAKAHAANRAIGTYVQARGLAPHRALPHYAAFAPRDR"
FT   CDS_pept        153537..153821
FT                   /codon_start=1
FT                   /gene_family="HOG000197861" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751203"
FT                   /gene_name="NHP6"
FT                   /locus_tag="ADL310W"
FT                   /product="Non-histone chromosomal protein 6 "
FT                   /function="DNA binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="chromosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51610.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG341495"
FT                   /db_xref="HOGENOM:HBG738370"
FT                   /db_xref="InterPro:IPR000910"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="UniParc:UPI0000252945"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75B82"
FT                   /transl_table=1
FT                   /translation="MAAAATTKKRTQRKKKDPNAPKRAMSAYMFFANENRDIVRAENPG
FT                   ISFGQVGRVLGEKWKALSDDEKQPYEAKAEADKKRYESEKELYNATKAA"
FT   CDS_pept        154073..154852
FT                   /codon_start=1
FT                   /gene_family="HOG000211098" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751204"
FT                   /locus_tag="AGOS_ADL309W"
FT                   /product="ADL309Wp"
FT                   /function="DNA binding"
FT                   /function="DNA polymerase processivity factor activity "
FT                   /biological_process="regulation of DNA replication "
FT                   /cellular_component="PCNA complex"
FT                   /protein_id="AAS51611.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006275"
FT                   /db_xref="GO:0030337"
FT                   /db_xref="GO:0043626"
FT                   /db_xref="HOGENOM:HBG049725"
FT                   /db_xref="InterPro:IPR000730"
FT                   /db_xref="InterPro:IPR022648"
FT                   /db_xref="InterPro:IPR022649"
FT                   /db_xref="InterPro:IPR022659"
FT                   /db_xref="UniParc:UPI0001DB298A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B81"
FT                   /transl_table=1
FT                   /translation="MLEAKFQQSSFFKKIIDGLKDCVQLVNFNCSEKGIAAQAVDDSRV
FT                   LLVSLVVTPEAFEEYRSDRAVTLGVDLNSLGKILRCGANEDSLTLVAEDSPDTMLVLFE
FT                   DTKRERISEYSLKLMEIDADFLEIDQIDYDTTVHMPSAEFAKIIRDLNQLSDSLNVVVT
FT                   KETIKFISEGDFGSGSVIVKPRTDVERPEDSVKVELEKPVDLTFGSKYLLDIIKAAALS
FT                   VSITIKLSADTPALFQFNLDGAGHLQYFLAPKFNEEE"
FT   CDS_pept        complement(154881..155402)
FT                   /codon_start=1
FT                   /gene_family="HOG000196601" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622752"
FT                   /locus_tag="ADL308C"
FT                   /orf_name="AGOS_ADL308C"
FT                   /product="ADL308Cp"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="AAS51612.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG530048"
FT                   /db_xref="HOGENOM:HBG742014"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0000252947"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B80"
FT                   /transl_table=1
FT                   /translation="MITYRPFDINSDLQFATIKKLIDRDLSEPYSIYVYRYFLNQWPSL
FT                   AYLAYDTEAATAEEPVGCIVCKAEAHRGVRQRGYIAMLVVNDAYRGRGIAKRLITLAIE
FT                   QMAAQGCDEIMLETECSNGAALHLYEALGFVRMKRMFRYYLNQGDAFKLILPLTARSYM
FT                   RSTFLDARAD"
FT   CDS_pept        155777..158995
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775307"
FT                   /gene_name="ATG11"
FT                   /locus_tag="ADL307W"
FT                   /product="Autophagy-related protein 11 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="AAS51613.1"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG058913"
FT                   /db_xref="InterPro:IPR019460"
FT                   /db_xref="UniParc:UPI0000252948"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75B79"
FT                   /transl_table=1
FT                   /translation="MGHVEGNLQLVNAISGRSIGTHVQYFMTMEDLKRFVIQQWHIPGP
FT                   EIFILQPYGGKFKRGHFQDMVSEAKKAVARGRVRETSVLYVFDRRLFDGGEEALAQATR
FT                   HDSTTLVRPLVSPLEDAEAEVGERAAASLLTTNLGWLSALEIDVRYFHACIEGWVQQLA
FT                   NMKECLSVLLQYLELYSFDIEKLYHASAEAVDGVRQRCASNDWRQKNQELLETIDAVAS
FT                   RGKLVQFVDLEEMSEAEERLRELERLLSKKLSLFRGALDENHAIRQEIANHIKEVGTRY
FT                   QDNISNYELEAQILGNFKDMVKKVKEDTRTILDLDTTKVSPDLMTSAVSLFKEMKSTAI
FT                   PALYTVGLSLFTQASKCMETKASLQREMLVILADIAVAQVNIVDAKNSLLQQVNQDISA
FT                   LHTTEQQLLRVSELPVVYGLYLIELYRRQHWITGLDRYYSEHTKEIQSVLQRELVFREK
FT                   WSSDFSSYSEIFQWQDDKPQLAKLFSNASPLEVGRPCIDIGTIQTYIEMLARCDVAEDS
FT                   QTLLKKTLSEVSRFQFIVKSPLAGSVSKDSTDSMNEVIEGYKNRINKLELLLHSTQFSN
FT                   TSSWPTGVLNSNSLNVFHNNIASINEKLLLSDYKSRDSIMSGKSNEKELQSQLVELQKQ
FT                   LEEAKNEAKRVQQQLKTTKTQLLNGEDERTAYKETLSILNAELSKLILNQEEQKQELVI
FT                   AAKDFQEKLDVSMRQVNDLLKQVNFWKSKCGDLDKIKQDLLANMATKETDFNNRCTDYE
FT                   RNIVELQRQLSEKCDATNERSVTSTSADVPGETKEYIESLKEVNRRLEEDMFAVFAGNI
FT                   VLLENIGLLLSRGPDNKLQIIRVKGLRKNIDDSIIKDSSPVINSHMVKSTVFQDVKNLF
FT                   DELQLSQGVNDQLHFVSELERFYEEDLFQTSVIKRFTDVENLAKKLRKENKAKKSVIER
FT                   HNKDKITFRDLKVGDLALFLPTRGVAGSLTSSVASSLASSFSSVDLSTPPPPLPTASQS
FT                   LIKVTPHKPHRNKSTPWAVFTASELGVRYFLKDSEELVKGKDWFVGKIQSMEKYTVNGD
FT                   SRNPFKLPEGMVWYEVVASCTKEL"
FT   CDS_pept        complement(159107..160969)
FT                   /codon_start=1
FT                   /gene_family="HOG000173033" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751205"
FT                   /gene_name="TAH18"
FT                   /locus_tag="ADL306C"
FT                   /product="Probable NADPH reductase TAH18 "
FT                   /EC_number="1.-.-.-"
FT                   /function="FMN binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS51614.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG269581"
FT                   /db_xref="HOGENOM:HBG736048"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="UniParc:UPI0000252949"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75B78"
FT                   /transl_table=1
FT                   /translation="MAATRIAILYGSETGTAQDFANILSHQLRRFHYKHTVCSIGEYSA
FT                   QNILACQYLFVICSTTGQGALPQNARQSPQGKVEGTLWSVLKRSSLPPTLLDHLQVAFL
FT                   GLGDSSYSKFNFAIRKLHNRIVGQLGAREIFPRLEADAIGLAGSNAGNGNGIELVYSEF
FT                   EKRVLSFLNDQFPFMTVNGEQVPREPIATDIYLKPEYYLEASGNDKGTASVPCTFEGDS
FT                   SVKYGTVVTNKRITATDHFQDVRQLVFSSQDGENYYPGDTVSIYPYNTDADVQAFIDTQ
FT                   QHWASIADVPLQIKTPTSARGICDGGLVSPLTLRNLLKYHCDIVSIPMRSFFMKTWTFA
FT                   VDHERLPDGKDQLQQQRDKLREFAESEDMQDIYDYCNRPRRSILEVVQDFMSLRLPWEY
FT                   ILDYLPHIKPRFFSISSQPCNKDIELTIAIVRYKTILRRIRRGLCTNYISDLSEGSIIR
FT                   YKVQYNDLLPAGKQDRPVIMISPGVGLAPMKCLIYAQLFNPMLLFFGNRYKDKDFLYAD
FT                   TLQKWADENRIKLFVCFSRSPDDSPGLKYVQDAVWENAREVARLITEENAVVYVCGSSG
FT                   KMPVQVRLTLCEVLKKWGNFPDDKASEEYLKDMENSDRYLQETW"
FT   CDS_pept        complement(161176..162555)
FT                   /codon_start=1
FT                   /gene_family="HOG000165163" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751206"
FT                   /locus_tag="AGOS_ADL305C"
FT                   /product="ADL305Cp"
FT                   /function="ATP binding"
FT                   /function="magnesium ion binding"
FT                   /function="phenylalanine-tRNA ligase activity"
FT                   /function="tRNA binding"
FT                   /biological_process="phenylalanyl-tRNA aminoacylation "
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS51615.2"
FT                   /db_xref="GO:0000049"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004826"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006432"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="HOGENOM:HBG023813"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004530"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniParc:UPI0001DB299C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B77"
FT                   /transl_table=1
FT                   /translation="MALQVGRILRPLVRSYSSKVGKSIVVNCRTFETDDSHTNVTPTIL
FT                   SLTERSLHLQKAHPIGILRDMIEQRLNSVDNAYETYNEFRPAVSVAENFDSLGFPADHP
FT                   GRSRSDTYYINKEHLLRTHTSAHEMECFGNIRNGATEKPGFLISADVYRRDEIDRTHYP
FT                   GFHQMEGARMWKRDLSAAPGQEPAHLAQLRADIAKVEEQLRHEQTRLQVEDSTTLEGNP
FT                   KQDYMTEAEVDLCAQHLKRSVELVVAQVFNKKLQSVGNPGEVLQVRWIKAYFPWTAPSW
FT                   EIEVWWKGEWLELCGCGLVREQVYLNAGFAPNTHVGWAFGLGLDRIAMLLFDIPDIRLF
FT                   WTLDERFHSQFRPGEITTFKPYSKYPASTRDVAFWLPEDKQSVEFHENDIMELVRNTAG
FT                   DLVESVKLLDKFVHPKTGRTSLCYRINYQSMDRTVTNAEVNVLQEQVSRELVRLYNVQL
FT                   R"
FT   CDS_pept        162919..163581
FT                   /codon_start=1
FT                   /gene_family="HOG000164574" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751207"
FT                   /locus_tag="ADL304W"
FT                   /orf_name="AGOS_ADL304W"
FT                   /product="ADL304Wp"
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS51616.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="HOGENOM:HBG286097"
FT                   /db_xref="HOGENOM:HBG341023"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="UniParc:UPI000025294B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B76"
FT                   /transl_table=1
FT                   /translation="MLSVMVPRWTHVATGVSPVRLCKRFSHQYAPRLSQQDKKHKGRVP
FT                   VRTGGSIKGNTLEFARYGMRLKTEGVRLTALQLTEADNSIMRTVRQLTNGKLWRRLCTN
FT                   VAVGVKGNETRMGKGKGGFDHWMARVPTGKIIFEMDGDNLHEKVAREAFRKAGTKLPGT
FT                   YEFVKRDSLVRVGLHSFKNPADDPKVNYFEKLAKEPTKEYLNKLRSKENMYRLYRGR"
FT   CDS_pept        complement(163703..164770)
FT                   /codon_start=1
FT                   /gene_family="HOG000224153" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751208"
FT                   /locus_tag="ADL303C"
FT                   /orf_name="AGOS_ADL303C"
FT                   /product="ADL303Cp"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51617.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG330815"
FT                   /db_xref="HOGENOM:HBG533331"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR019483"
FT                   /db_xref="UniParc:UPI000025294C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B75"
FT                   /transl_table=1
FT                   /translation="MSLWVDKHRPKSLTSLSHTASLTKQLEALAGSAKDLPHILLYGPN
FT                   GSGKKTRCMGLLASIFGAGVYKLKIDVRQFVTPSNKKLELNVVSSPYHIEITPSDMGHN
FT                   DRIVIQELLKEIAQMEQVDFQSGSEGLARRYKSVIINEAESLTRDAQAALRRTMEKYSR
FT                   NIRVIMLCDSLSSIIAPIKSRCMLVRVPAPAPAEMVAIMERVCTQEGVTASEHKLYEIA
FT                   EFADGNLRLALLTLESMCIQHNLKLTDTSTTVTPDWMLVVCRLANKVLKERTVGSLVEC
FT                   RGILYDLLSHCIPPDIILHELAFALLKMVSSDPVKLAVIDLASVFDERLALGNKAIYHL
FT                   EGFLAKVMCSIDCHV"
FT   CDS_pept        165193..168066
FT                   /codon_start=1
FT                   /gene_family="HOG000033976" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775308"
FT                   /locus_tag="ADL302W"
FT                   /orf_name="AGOS_ADL302W"
FT                   /product="ADL302Wp"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="clathrin adaptor complex"
FT                   /protein_id="AAS51618.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="HOGENOM:HBG204256"
FT                   /db_xref="HOGENOM:HBG354594"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR003164"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013038"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR015873"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017104"
FT                   /db_xref="UniParc:UPI000025294D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B74"
FT                   /transl_table=1
FT                   /translation="MPSKPMNNSMRGLQLFIADLKSAQLQQTQQKRIQSELVNIKTNFG
FT                   TSGLNGYQRKKYIAKLVYIYITTNTAKVGEVLFGLEQCLVLLKSSVYSEKAIGYQALEL
FT                   LMHHKEAQESVLFPVIEQVKLDLTSADTDTVALALNFLGIAGGCSRTVGNQLFYDVFKI
FT                   LKSPLAPSLLRSKAALAFLMLVRKSPEVLTDQDDATLAEWVRCIFALLDDEKNYGLILA
FT                   GVPLIEYFARHVAYDQCIKLVPKLIQILYSCVVVAKDNPNEFPEEYRFAKMPNPWLVSN
FT                   ISKLLNVLITPSDSHGRFTSLNIDQQSLGRLRLCVTKVIEFNGIQGTLSNATQHAILFT
FT                   LINLACKLDPTADALNNSVAVLTSLLGSKDTNIRYLTLDALTKMSFSSGGRVKDTLRKD
FT                   YLPRLLQILQEERDASIVCKVLDLLYALASEENVEYIVEQLLHFLASSTKRPLSIRNDL
FT                   CVKVAALIENSSKSPEWVALSLLKLLSLTPVESNSTKGDMICQRVCYLVVNEERLRKVT
FT                   CMNLVNYLLAPAPSTCILKASAFIFGEYANLLLENISIGDLFNVFAEKYFQSDNTTRAM
FT                   ILTTLIKLYRFNPAIGSAAIKFYQLELTSLDLELQTRAYQYLKIIQLDKLKKHDMKLLD
FT                   TIFSEMPPFPRKKALFAPDNATGEFSEDSELPSFTDNIPSSKSNSRAPTPAPTPPPSRN
FT                   IKTTYTSVTLSDGWESGFKRMLLHQQGVFYKNSLLKVLYRIIQNPSQPSISIVSLTTVN
FT                   NAELPITGFYPEVIPFRTSGNPSYITNVTEMSNFTIEPGQRTNFSFELQTRYSFPVIEA
FT                   PIVTFNFRYGGHNRDIGLKLGYGITSTISSKDNVSTMAQFIQRWKTISDALGHHGEAQD
FT                   VLDPESSTQLEVNLQRMGFAIVEQESVPHTVFATGIVHTKSSGNFGCLLKLMITDSAVK
FT                   LTCKTTSDGSLAQELVECVVQAFHSTT"
FT   CDS_pept        complement(168129..168935)
FT                   /codon_start=1
FT                   /gene_family="HOG000048983" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751209"
FT                   /locus_tag="ADL301C"
FT                   /orf_name="AGOS_ADL301C"
FT                   /product="ADL301Cp"
FT                   /protein_id="AAS51619.1"
FT                   /db_xref="HOGENOM:HBG001447"
FT                   /db_xref="HOGENOM:HBG289671"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="UniParc:UPI000025294E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B73"
FT                   /transl_table=1
FT                   /translation="MLGRAVGRGGKVAALRWSSKMTSQDSSRKKELCAAYSVVDERVSR
FT                   SMEECGRRRSEVLLLAVSKLKPASDVAILYEEMGLRHFGENYVQELVGKAAELPGDIQW
FT                   HFIGALQSNKCKDLAKVVNLHAVETIDSLKKARKLEEARAKFQPDAPAILCSIEVNTSG
FT                   EAQKAGVSDEAELCELVEFFLSEDAKHVRLRGLMTIGSWDASHAADGENPEFAALAKWK
FT                   RVLDGKYGLNLELSMGMSADFAAAMRQGSSEVRIGTDIFGARPARK"
FT   CDS_pept        169672..172452
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775309"
FT                   /locus_tag="ADL300W"
FT                   /orf_name="AGOS_ADL300W"
FT                   /product="ADL300Wp"
FT                   /protein_id="AAS51620.1"
FT                   /db_xref="HOGENOM:HBG058533"
FT                   /db_xref="HOGENOM:HBG103593"
FT                   /db_xref="InterPro:IPR007632"
FT                   /db_xref="UniParc:UPI000025294F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B72"
FT                   /transl_table=1
FT                   /translation="MSELAELDPNFVINAPAERRALEKLMERLDKLGVASRVRPGTSSN
FT                   SVYVFVRDSSGQLVPELKGMAVEEIIPLYGGEQRKRLEHLAKEMMYRRLFPSTGDLTEL
FT                   ATLTRNPEMALYFAFQKTYTLWLLPLAAVGAAFRFFAKATPWEFNMFYAIALLVWGMAF
FT                   ATFWNHSTERWYSEKLGFKNIVPLSEPKSVVMKKLCFTPIAITFMVCMVCFQFVCFMLE
FT                   IYITQIYNGPLGFLLALIPTVLLSAYVPVLTAVYNVFVNKLVKWENAANPERSRVEKNY
FT                   ALSFLTSYVPLLITLFVYLPMGHMLNPQMNLIAKYSQRYGIPVIGRHFMINTERYRTQF
FT                   FYFTVTNQLVAMAVDNILPIVMGVILPRIKGHTKSDSELNRARALTAEQYPKDIELVEH
FT                   VRTCMLGPWGPFKLHDNVSKLVIQFGYVVMFSTIWPLAPLICVIFNIVISKFDIWRALK
FT                   KHTPSSNPNTYKSKNLGLALTSLSPWNPILEFTVWVASVVSPALIIMYRHSNLPGFARP
FT                   LEKHSTWFIHSPIRYDWKLIFIYVAVAEHLGLLLHFVLSKIAGAPASNDSDVSPSLLKR
FT                   ELATANKHFDNSAAIPEAEDITQRIKSNYTTKREISQEYATRASGVDDTRTSVRNFEEE
FT                   QAPRIVTTTEHNISHRKQAMPAAIAQVAPKTAAPVHERSTFDRKPSCSSLGSSGSLYSS
FT                   VAGATLPHKIPTSKNYDERQGYPTPTQSNSMTSTKISIGNGDHSHSAHSRNGGAIPGSA
FT                   YTQQPTIVTNGSGEHYEGNGISTRVPQTVIVSETQNGNGNGGSRHYPAQEIVIDRIIVA
FT                   APEDLEASNVVVAPPNDTQFVNDKALELPVLKAPPPPEEDDYIIAPHLKTPPGDMRSAS
FT                   LPSSKQSVVQRRKSSSRKTLSILMRATTGKDGSSSEHKHKHKVKNTLNLLKKRFD"
FT   CDS_pept        complement(172734..174671)
FT                   /codon_start=1
FT                   /gene_family="HOG000248502" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622753"
FT                   /locus_tag="AGOS_ADL299C"
FT                   /product="ADL299Cp"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /biological_process="DNA replication"
FT                   /protein_id="AAS51621.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG058534"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="InterPro:IPR013627"
FT                   /db_xref="InterPro:IPR016722"
FT                   /db_xref="UniParc:UPI0001DB299D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B71"
FT                   /transl_table=1
FT                   /translation="MVLKDELLARFGPEAKDETVVTTLESYMKLYALSIDELYIKWEQF
FT                   AYHSLDGGVKLDANGLDNFKGFIQRQIEKANMAQGNAADVSHGAGHGSGAKLPRPLRAT
FT                   GGSSLFGYGSSPRSSNVRKMKLDVLHSDRDSPGPPSSPVGHTSVFSDAGPGFGTPTSAG
FT                   DSRDTDKIVDTLNPDLPIADGADFDSDHQVRSIPFYDTKKYKYRTMRQRLLGAADVLDE
FT                   QIEHFTSVVQKDLGISSAELGDPTIQSQSSIICVGRIVPDNPGDERINMESVSIETSRA
FT                   AGIGRRIRLNLKSIKEYSLFPGQIVAMRGRNANGEFFKVEELLQFPYLNSPVSSAEEIQ
FT                   EAQLALDGGQMKVLVTSGPYTPSTSIDFNHLEEFILRVNEHIRPHVLIMFGPFLDVTHP
FT                   LVETGQIPTFPNLKSQPRTLDELFTKILCPILRKINPRIQVVLIPSMRDAISRHTSYPQ
FT                   DSFSRKELQLPKNFKCYANPATFRVNELFFGCSNNDIFKDMKEVPNGPINLSKNRIDRV
FT                   SEHILEQRRFYPAFPGGAKTRTIDDSKEHVSGADLEVPYLGLTEFIGGFIPDIVIIPSE
FT                   LKHFARVVKNVMVINPGAFVRARGSRGTYAQLSISAPDLEDGILTLVEGQENVYLHNAW
FT                   KRTRIDILSA"
FT   CDS_pept        complement(174829..179256)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751210"
FT                   /gene_name="STU1"
FT                   /locus_tag="ADL298C"
FT                   /product="Protein STU1"
FT                   /function="binding"
FT                   /biological_process="cell division"
FT                   /biological_process="mitosis"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="microtubule"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="spindle"
FT                   /protein_id="AAS51622.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005819"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG058535"
FT                   /db_xref="HOGENOM:HBG103594"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001DB299E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75B70"
FT                   /transl_table=1
FT                   /translation="MEEPRVHNLEKLMDEGVAGIEQLQILTAFKTHVKKELVRDDSIER
FT                   YFDALVRFLGQPVEDRKVQQLGHSSLCYLIKRVAMQQPGRFQGARIRDLVRVVLLQEQL
FT                   QERKVWGSAVKSLEAIYLCKPQAFEAELASICAATRGSDRTKCLLFMDELIQLQQMNNR
FT                   NPMEVVNRFVDLWVDVLNESDPGCSKRDIELIHDILKKYFNEAMLQQFAERVVNTRSLK
FT                   HFMHTEHAAPSSAQTTSSMPSGPFDVDEELTRVMEELPPNVVNSNIGEARDYLSFEHVV
FT                   KDLEHITVAFQAIKETEHNWKQRQEGIITLRKIVNGNVSRQFPDEFIQACRDLNIADCI
FT                   SKAALSLRTTLSSHSCHLIKEMAFKLGPLLEPLLDVLFVPLRSLLSATKKISSQTAFAT
FT                   AAILLCTAPYHNRLFQQCIALSRDKNVSPRTFAAVFLRIYIIRFHRRLEHSSVLVEEWL
FT                   HKGLTDPQTQVREAMRVTLWYWYVPNAQSAKKVLDSMPHQMKRIIEGSIPTYLNIEYHV
FT                   TASVSSNESSRRSSFGVRRYPSYAAPTQSSNLQKLAANSLGGSANVRSLSENTNRHLTT
FT                   YTSLAKKSLATRHESLSPRVASSGLISSAGAANLSSENLELTEELTSNHSNTLLKKYLN
FT                   TNEPAVIRKSEGEPTGDLESMYSHLSSTTLQEKQQGLLFLKNLLLLKAPLDIAKLNPLL
FT                   VQLSIQSPKSFKDLLTLASFHPLIPLANLIELFAINDLPTNVLLDEFSSTDLLETVIHS
FT                   FQTFFPDHHDQLFLYYVKYRSVIFNYCFGIMIDLLSGDFAFSEGSTLFREVCTRIIEAC
FT                   GNDFNMEKYYTLISILYRADKSQFVELLRDAPVSSKFKIANELQRCDSTFNLHSIMSRE
FT                   STAESHHSDPNQQYKDGAHGGDARDANGTSNSSSDSDNEPDLESTKHLLEMTMVNPIGL
FT                   GCVENVLQSHIHAYKQDQQHQDPIAEKSLSTVAEVNDEDGDGSTTTQMKLMGANTTEPS
FT                   NESDKDKTSDIVAESMRGTDDPNYAKLCAIDSALIDSEDEPELNNFGGLKGLTEMTKVV
FT                   SIYEKLDGDEDVEMVDDEKFKDPVEQENQETGLDEIFRDEKHDQSVKFNDIPRIIDVNK
FT                   SWDRYDGESIEDTSGNTSHGTDENRPASFGTVSELVRKEMEKSPTLPLNEEDSKLLSDG
FT                   INEIELKHKDDPFVRDSEDCENGTPQDRSNFLSCKQHIDILGALPDNSLTAFELGLLEI
FT                   LDVSDMDANRILETVNTIQNSRLRSADVSRIVGAIVSHCTDPLLHWLTDSNGLQRLWSM
FT                   LTALSTADGFSDSYKCVVLYTALLIANSQLSSSHLSTDELSDAWAFALRELSKLSSYNN
FT                   ETYIACCELRETLIEHYSSSYLPQLLESAIKELNVAEDRVRITFLLQTLSDALDHMNTL
FT                   LSLEVLGSMSSLLQQFVTNDFTEWRYHSIKLLAQIYGILVARNSPASYIRSMFSILRQP
FT                   EFDLVKSYYTMDHN"
FT   CDS_pept        181007..181276
FT                   /codon_start=1
FT                   /gene_family="HOG000000724" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622754"
FT                   /locus_tag="ADL297W"
FT                   /orf_name="AGOS_ADL297W"
FT                   /product="ADL297Wp"
FT                   /protein_id="AAS51623.1"
FT                   /db_xref="HOGENOM:HBG058536"
FT                   /db_xref="UniParc:UPI0000252952"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B69"
FT                   /transl_table=1
FT                   /translation="MQTLYKLKNQSQFQSSESTGSTGSFLASAPVELTTVNGYNDFLKS
FT                   HKSKRTSTLFNDDCSRGYVMMDDKVLATITGEARDYLLELFGSP"
FT   CDS_pept        complement(181341..182246)
FT                   /codon_start=1
FT                   /gene_family="HOG000115443" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622755"
FT                   /locus_tag="ADL296C"
FT                   /orf_name="AGOS_ADL296C"
FT                   /product="ADL296Cp"
FT                   /function="GTP cyclohydrolase II activity"
FT                   /biological_process="riboflavin biosynthetic process "
FT                   /protein_id="AAS51624.1"
FT                   /db_xref="GO:0003935"
FT                   /db_xref="GO:0009231"
FT                   /db_xref="HOGENOM:HBG364806"
FT                   /db_xref="HOGENOM:HBG735778"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="UniParc:UPI00001B2432"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B68"
FT                   /transl_table=1
FT                   /translation="MTEYTVPEVTCVARARIPTVQGTDVFLHLYHNSIDSKEHLAIVFG
FT                   ENIRSRSLFRYRKDDTQQARMVRGAYVGQLYPGRTEADADRRQGLELRFDETGQLVVER
FT                   ATTWTREPTLVRLHSECYTGETAWSARCDCGEQFDQAGKLMAAATEGEVVGGAGHGVIV
FT                   YLRQEGRGIGLGEKLKAYNLQDLGADTVQANELLNHPADARDFSLGRAILLDLGIEDIR
FT                   LLTNNPDKVQQVHCPPALRCIERVPMVPLSWTQPTQGVRSRELDGYLRAKVERMGHMLQ
FT                   RPLVLHTSAAAELPRANTHI"
FT   CDS_pept        182496..183287
FT                   /codon_start=1
FT                   /gene_family="HOG000248003" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751211"
FT                   /locus_tag="ADL295W"
FT                   /orf_name="AGOS_ADL295W"
FT                   /product="ADL295Wp"
FT                   /function="3'-5'-exoribonuclease activity"
FT                   /function="RNA binding"
FT                   /biological_process="RNA processing"
FT                   /protein_id="AAS51625.1"
FT                   /db_xref="GO:0000175"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG058537"
FT                   /db_xref="HOGENOM:HBG397033"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0000252953"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B67"
FT                   /transl_table=1
FT                   /translation="MMLSVTEQLYLIDSLKAIPPIRADGRAAAQFRPLDVAVDFLPNSN
FT                   GSARIITSDGSEALVSVKSKVVDHTVTSELIVVDVDITGQREDSPEVSSMASLVRRILA
FT                   ANVDAGALRLTKKYSFQLSVDVLVLCSQSYPVSLISFSIYAALKTTQLPKLVSGYDDLE
FT                   VEELPLFHDHDLEPLAVEVPLLFTVAVVGDNVLVDPSAEEAGVSSAGLLLTWHGGRVAA
FT                   PLRSIGISEHFCSGFQIAHLLKAIELVKAHAPAVARALYNL"
FT   CDS_pept        complement(183331..187449)
FT                   /codon_start=1
FT                   /gene_family="HOG000141850" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751212"
FT                   /locus_tag="AGOS_ADL294C"
FT                   /product="ADL294Cp"
FT                   /function="RNA binding"
FT                   /function="RNA methyltransferase activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="AAS51626.2"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0008173"
FT                   /db_xref="HOGENOM:HBG058538"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="UniParc:UPI0001DB299F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B66"
FT                   /transl_table=1
FT                   /translation="MLQDRDRNMPSHEPRSSSSSITSDRVADLLSCADFRTCYEELSVL
FT                   SSADRESALAPCCGSLVGAVRSWPGSENEASTAEALGRLCGLARGAWKQFGEALQVEIE
FT                   ALFPEQTSAASIEPADAARCDACVSFLVGFGAANERRAVAVSGDAIAPWSAVLGRLLTL
FT                   HAGSEEYGAQAAAALRHNVDSIVTCACENDELDGRLWALVLRAPEPTPRTWAFPERMKL
FT                   LLRFLARGKLTPRLREEMCGEAYSGAVLRALGSSVHEERKVGLSVLKLTLHLLPEGAGF
FT                   GARHAVEHTALLEMWRRFVTCYEIVALDTALNQLEAASADVLTLFESDLERGWPQVVIL
FT                   TGLHATMESVRKFCLELMFRVRDRSAFDIAALPVLLGAALQAPNFVVAGGRCVFGEKLS
FT                   AFVRDVLLAAGVDECADARLSDGVLAVLRTFERDAYSFDAARIYVSHGVLLALRAHNGC
FT                   VLTDEHLRLVRLVLSAAGEEPVFDSTLQALWLEISLFAGPSSTLPCLFGVLGSHAARYG
FT                   YGLLVPLLSQYRTFLAPYDKTALAGCNEVLVYLAYGVEPESVTQEFLVGIAKAGKSKAF
FT                   QAHYESFIQQLANLSLKEACSECDILVSDGCVDQMIYTQIDLRPVFGELLYQFNLGRLQ
FT                   FFVAVFRRAVAANNVKLVLTADDLAALYAHLKSQFKVGAVRLKDSSYAAFFQLAREVLT
FT                   QRLNAQEGASDVVDVILSLAESNVSADNDNYMANLQITNVLQYIMDNGIALCIDLCAVF
FT                   VEKLVAITDSIWQSLLGERLVLNQKDLHLGIIKTLFHAVVLKDATDDSELSSVLRDCGQ
FT                   DFIRQAASRRSLLPCLTLSIKTFLLGQPSDADRYMWLTELLISVFVHTHENVNVFKLKP
FT                   VVAELFDKHFTLVEAENGLYQHIYGIEEISTKVHVISALIGAPAGFRRGVVEQLLQNDS
FT                   NLLKPNKRTNGPEEIERLGKWQLLLLSMKSIENDMLILYVSDHILPNLFEEPSPLVRIY
FT                   SEWIVAHSLFCSYYNRDVDKLEGTLIAAAKNQTRPAVVVSAQKILYLTLVALKRICVPF
FT                   RLLNMFISVLVPNCASNKPLIRHFSNSLILSLWPEFRAILTGDTVCGIMENLFSEAKKT
FT                   QSKGQYRAGDANIWDLHDDFNLTSIFGGVVMKVTDHCVPYISSAYFTRYLDSTTSIPVG
FT                   VDESKKWLSKRKRQIQEERSVETKRDSPLQTKSGTWETVLDFDSNTPQDAVKRSDLIVV
FT                   ASLVDKPPNLGGICRLSDVLGVGLMTVHDLRVKSHPQFKNVAVTADRWMPIEEVAVADI
FT                   ASFMRQKKLEGYTLIGLEQTDKSVRLDAAFHFPRKSLILLGTEAEGIPGYLLVELDMCL
FT                   EIKQHGVIRSMNIQTATAVVVHSYAVQHM"
FT   CDS_pept        187682..189415
FT                   /codon_start=1
FT                   /gene_family="HOG000034139" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751213"
FT                   /gene_name="ATG20"
FT                   /locus_tag="ADL293W"
FT                   /product="Autophagy-related protein 20 "
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="autophagy"
FT                   /biological_process="cell communication"
FT                   /biological_process="protein transport"
FT                   /cellular_component="endosome membrane"
FT                   /protein_id="AAS51627.1"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0010008"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG124901"
FT                   /db_xref="HOGENOM:HBG203073"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR015404"
FT                   /db_xref="UniParc:UPI0000252955"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75B65"
FT                   /transl_table=1
FT                   /translation="MTEQSEHSNGGVCASSIQPARNGGLCGHGGVGGVGEAEGDPVHTQ
FT                   IIQEDNPFVEHGQSYVAPHSGGGRTSSGSSSSASLQEGLLAPPLAKSSAGEQGRVRILE
FT                   ASKVSEGQGRSYITYTISYRDRVVRRRYSEFESLRKILIKLFPMTLIPPIPEKQSLTSY
FT                   GKSIAGSNANYVLPSEAAGCDLAVSVINGSVNLNDQKMIRHRIRMLTSFLNRLLQNEEV
FT                   TKTSIIGDFLDPNNANWNDVITTSATISSLPKSVLQCNPLDPTNTTPAHASLPIPPLSS
FT                   APQLMGKDGVGTSTKPSAEDMEFSRIEYEYKKYEQLLHTGVYKYNRRITRTMHELKQDL
FT                   ADLSEAFAEFAVEQSKGGDLAELLSYLSNANDEAAAVLDDLVGKIYYNINEPLSEAVHI
FT                   AGAARELIQYRRLKFAQRDMLKKSLLGKEGHLKRLQEQEDDAKAIDQLVDQHLGEGTRI
FT                   NLQRPSEASPNTYKRKLFSRFNKLANIVKETVTYQEQDPKVNIKTVQEDIEQIKESLDV
FT                   SASDLDVITATIRDVQLPAFSRNRDKELYDILKNYSKYMKEYAAKNLEIWKDLRKQEEN
FT                   A"
FT   CDS_pept        complement(189551..190540)
FT                   /codon_start=1
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751214"
FT                   /locus_tag="ADL292C"
FT                   /orf_name="AGOS_ADL292C"
FT                   /product="ADL292Cp"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS51628.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG397702"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000252956"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B64"
FT                   /transl_table=1
FT                   /translation="MKVSTRRNDVDSRGRMSRLPVRRDIAAALYTSLIPRWRSVAEKVV
FT                   ESAMPIVGVQLDPKRDIALVTGGAGGLGKEIVRELRRRQIVTVILDVVPPPDLESLTGV
FT                   HFYACDISLPGRIRVIHENIIRDVGHVTILINNAAITSDLPLDRVDNDKIEQIIRVNLL
FT                   GPYTLIREFLPSMIAIDRGYIVNIASVLGFVTPARLTAYGASKGGLIALHESLVDELEQ
FT                   YTWKDSSNPGYVPLLKSRGVIRSLLVCPGKLTTKMFDNARSPSKIIAPDLDPEYLAKQI
FT                   VNAMECNRSGTLKLPYYTNMMCYFKSLNWPWFRLFRLTAGVDAIIAAK"
FT   CDS_pept        190758..191732
FT                   /codon_start=1
FT                   /gene_family="HOG000113119" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751215"
FT                   /locus_tag="AGOS_ADL291W"
FT                   /product="ADL291Wp"
FT                   /protein_id="AAS51629.2"
FT                   /db_xref="HOGENOM:HBG192176"
FT                   /db_xref="InterPro:IPR013883"
FT                   /db_xref="UniParc:UPI0001DB29A0"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B63"
FT                   /transl_table=1
FT                   /translation="MDQAPEVIRVKRRRDEDSMQALLLEESRLNKKGKYVFKLARTVEL
FT                   QGSNEETPLLKLAASERNVYVLEQQKQTQKCLPEEISEMLEEYLRLETKATASEHKRPS
FT                   KRRASQLPVAQLPSMEFVYDIYIRENLPEDEFVWDKNTVGYIRIVEDNGALVPEQDASA
FT                   DTQQLSDDEDSNEEDYYRNDYPEDEDDDRSILFGSDLEQEAPMANPLQSPVSEIAELIT
FT                   EAGSEDIYDPLFESLGAEPNLLSSLNSNNYVDLDVDALSSASDREDASNGRTFGTDNDD
FT                   LHTDSSFERHNLFPGEEDDPMAIHRDKVLGKLQRILNGANGRV"
FT   CDS_pept        191996..192571
FT                   /codon_start=1
FT                   /gene_family="HOG000039905" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079567"
FT                   /locus_tag="ADL290W"
FT                   /orf_name="AGOS_ADL290W"
FT                   /product="ADL290Wp"
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS51630.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="HOGENOM:HBG297151"
FT                   /db_xref="HOGENOM:HBG606796"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="UniParc:UPI0000252958"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B62"
FT                   /transl_table=1
FT                   /translation="MKYIQTDQVLDIPEGVTVNIKSRVIKVTGPRGTLEKNLKHIDVTF
FT                   TKVSNKQITITVHNGDRKHVAALRTVKSLISNMITGVTKGYKYKMRYVYAHFPINVNVV
FT                   EKDGEKFIEIRNYLGDKRVRAVPVREGVSVEFSTNQKDEIVLSGTSIENVSQNAADIQQ
FT                   ICRARNKDIRKFLDGIYVSEKGVIAEEA"
FT   CDS_pept        complement(192733..194913)
FT                   /codon_start=1
FT                   /gene_family="HOG000113892" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079568"
FT                   /locus_tag="ADL289C"
FT                   /orf_name="AGOS_ADL289C"
FT                   /product="ADL289Cp"
FT                   /biological_process="transport"
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="AAS51631.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="HOGENOM:HBG058540"
FT                   /db_xref="HOGENOM:HBG203071"
FT                   /db_xref="InterPro:IPR007252"
FT                   /db_xref="UniParc:UPI0000252959"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B61"
FT                   /transl_table=1
FT                   /translation="MSGTRTSSQQILKEFASVVTEFQRSLIAGTDNQDPLQLVQEFRSI
FT                   AGEAALVCAEETEDQRDRTQFVNFELEAKLWYLVELLVSFRTSDAPMDDIELHDYNSNA
FT                   VFKKAQLQEDPELYVVWLIIAWIQENLTVSPRPAELPTTKWSNTLLAGGLKSSDLDCPL
FT                   REEGVQIHPKDNQDDHCFYKYMYELILAGKYEEVRRECEYSDNLTLGMIMCGLEDYVDP
FT                   RIDLELAGDYEGHQGIKKRALWRRAVYALSRNPNLDKYEAAIYAFLSGTIPQDIDEQQL
FT                   DWERMLLVYLNQIWNIKIENYLLEKERINKEELIEQMPSQPLSLSAVLNIVASKHVEES
FT                   EHPIRVLMGAVILNTISPAVKSFIDMLLDAVKGVDQENDLLSEPYILRILTHLVIFLDK
FT                   ACPGVIEEGDKSKLVTTYVSLLNLYEQYDLVPVYISCLDEQDIMEAYSFFLSNLVGDSS
FT                   RERQLELCYFFQLPTANILKRTAQRIFNDTEPHYNLADTVTMNSEVTDIDLHLISAVDW
FT                   LMKGRLHVDAVESIIALCRRFLANGKVNSLSTFFEQHNMDDLIKNYELDQLSAKEEYPE
FT                   DRFVQEIGQYTKLITGFRQYKNWENSSHTVSSSKNTSALLQQFQAFASTLRGLVTEFLV
FT                   ELTEHTDMPSEDRDMLYNIRSLYTPYLLIELHNSYTSTAEKLGVPSFLQEAVNLSTMVA
FT                   NETDKIYLLFQNSGKLKEYLHLVAKAVALIGH"
FT   CDS_pept        complement(195137..197914)
FT                   /codon_start=1
FT                   /gene_family="HOG000112129" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775310"
FT                   /locus_tag="ADL288C"
FT                   /orf_name="AGOS_ADL288C"
FT                   /product="ADL288Cp"
FT                   /protein_id="AAS51632.1"
FT                   /db_xref="HOGENOM:HBG058541"
FT                   /db_xref="HOGENOM:HBG203070"
FT                   /db_xref="HSSP:1K4U"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="UniParc:UPI000025295A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B60"
FT                   /transl_table=1
FT                   /translation="MQESLPKAPFKVKAVYSWSGEHEQDLGFLESDIIEVTKVKGNWLY
FT                   GRLLRNKKSGYFPVNYVQVLYEVPNGYIERSPAEPRTQRPPTPPTVSAPAVLLPAMPTR
FT                   SPKSMEKGDLYGHGPHSPALTPAESPRRRMHLEPGMRAGSRLPITHLPKSHSTNMLVPR
FT                   IEYPVRAPRLRSGKLTPGPEPAKRASSSECSSNTGTTFSRRARSKSDLPPLPPIPPIPN
FT                   VTLNVDTEYALDFGHPHTAELATDAPNNNDNHNKLRERHGVYNGEYPTTRSYNDLAIAR
FT                   SPQRHTPRNDGYSSSYGSNYEGYEGYSSGYSDGYAQNQISQSRFLEDSLGMSEDSYCLM
FT                   SDFSATSAGSFARHRFARSFADSTEEDNYPSSPRDISSPSKVSGVFRKFLGSGYQLTGN
FT                   HSSINIKGGLPKLPDLHNLNIADDEGSHWLQAQCHLHRSNTLSAKEKRERERRVLYENS
FT                   DVVLRPQDYINEEINTNDVYHSHKPGLVDIELKSMDLENVDYRTRRRCQQTGPFTVESF
FT                   AHYNFRSGYRSPIEQLRGIFTFCTEFFRLIDDGGKTDFNSTPTNLDSVLHSLCCTPYEL
FT                   TWIFKKMANSLGIQCDLVVGLLKTPNADNMTFRFNHCWLRVLVADEMRFVDVILGNVTN
FT                   PLHEYINNKKQVQGEDFYFLIQPLHLIYTHVPYLYEEQHIVPAIDRCIAMCLPVVFPSF
FT                   FKNDLRLYKYSLGLCELLDSEIFECSIKVPSDVELVSSVVPEGSAAARCRNLNLSLVQY
FT                   KLHKRDRIALIKAVLPPGLSAGTLHIHSGIRGLHDDAMPPLSMIVPLTHSGTSKEYEFV
FT                   ARFPCPDAQKIDMYIKEPQNKYLFSGTEYTFQIICSPADGLTHDPYDAQAAAPNVIVVQ
FT                   SPSGKIYRLKKAESDVEFGVCEARLKVHEPGVWLALITSEAGAGWCTFAKWICV"
FT   CDS_pept        complement(198440..199570)
FT                   /codon_start=1
FT                   /gene_family="HOG000060335" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751216"
FT                   /locus_tag="AGOS_ADL287C"
FT                   /product="ADL287Cp"
FT                   /function="chorismate synthase activity"
FT                   /biological_process="aromatic amino acid family
FT                   biosynthetic process"
FT                   /protein_id="AAS51633.2"
FT                   /db_xref="GO:0004107"
FT                   /db_xref="GO:0009073"
FT                   /db_xref="HOGENOM:HBG003316"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="UniParc:UPI0001DB29A1"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B59"
FT                   /transl_table=1
FT                   /translation="MSSFGQVFRVTTYGESHCKSVGCIVEGVPPGLSLTEEDIQPQLTR
FT                   RRPGQSKLSTPRNEKDRVEIQSGTEFGRTLGTPIGMLVKNEDQRPHDYGDMDDFPRPSH
FT                   ADFTYIEKYGIKASSGGGRSSARETIGRVAAGAIADKFLQQACGVEIVAFVSQIGSVRM
FT                   NRDPFDPKFLQLLNTITREQVDATGPIRCPDASVAGAMVEEIERHRGDKDSIGGVVTCV
FT                   VRNVPTGLGEPCFDKLEAKLAHAMLSIPASKGFEIGSGFAGVALPGSKHNDPFFFDEDS
FT                   NRLRTRTNNSGGVQGGISNGEHIYFSVPFKSAATISQAQATATYAGADGVLAAKGRHDP
FT                   SVTPRATPIVEAMTALVLADAFLLQKAREAARAIVS"
FT   CDS_pept        200120..202138
FT                   /codon_start=1
FT                   /gene_family="HOG000141839" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928299"
FT                   /locus_tag="ADL286W"
FT                   /orf_name="AGOS_ADL286W"
FT                   /product="ADL286Wp"
FT                   /protein_id="AAS51634.1"
FT                   /db_xref="HOGENOM:HBG058542"
FT                   /db_xref="HOGENOM:HBG104158"
FT                   /db_xref="InterPro:IPR007528"
FT                   /db_xref="UniParc:UPI000025295C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B58"
FT                   /transl_table=1
FT                   /translation="MNSVEDLLQLQPKIDALEKERDDIARKVQAVARTEGEQVDDFEAL
FT                   NSKLAGIAEEISGARTLEDVQRLRDNYGELAILDRAETLLREREAGERRAQNACTLAAV
FT                   TEKLGRAAELDYCDLEALHAELEPLARSADAAPQVEQFNELLTERARVPRRDLEHELLE
FT                   RRCDTELFVSTDDSVHELREKAGLLFQLSQLLLPEPRADQLWNFVCMANNFRIKFIYHF
FT                   TSPSAESEQQSIENYFKFLDKYLSENLYKYMDIFEDESKGITRTLIHKQFINHILEPVR
FT                   EKVNVTMTKIAASNSASDVKMLVLLISEIFITDNALKKSHYYDGVGLVSLIDEAALEVW
FT                   QNFEVESAVSQFEKLTTPGASLMSPKNGADFGKLLENMYRYLEPFFSIDYRNLFSVKYQ
FT                   LVDEIFIQLPLKYRSFLLSKNILQNELTAEQQFENTCVKLHSLLLISNILVRFSHDFTF
FT                   IEMTQQINKITDSDYEYIFDEVWESYDEAVIVLRDSIVHRWVKGLSSSLRNYFKYNEWD
FT                   SIATAPEQCSAELVGALAWMKKMTDIFDKYWYPQHIIAQIKVALLENIIKFMLNYVVKL
FT                   NKFSENGLRQLTFDYEALRATLGLPLEHSSVAEELALFEYFNILSMKYTNNKITSKFLD
FT                   AEYVSSHHTRNFRELRESLQVSHLTSDEIADALYRTL"
FT   CDS_pept        complement(202161..204095)
FT                   /codon_start=1
FT                   /gene_family="HOG000094252" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622756"
FT                   /locus_tag="ADL285C"
FT                   /orf_name="AGOS_ADL285C"
FT                   /product="ADL285Cp"
FT                   /protein_id="AAS51635.1"
FT                   /db_xref="HOGENOM:HBG058543"
FT                   /db_xref="HOGENOM:HBG397461"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="InterPro:IPR016445"
FT                   /db_xref="UniParc:UPI000025295D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B57"
FT                   /transl_table=1
FT                   /translation="MGTEPAREVLYHYRSSVRIGEVERYVITYDLYDEEELPERIQLSS
FT                   LWLKVKNVSSLTYRAAYLMGPYMLYCDLRTEDYHHSQKLFSSADMPQFEPAMQPQHEFL
FT                   AELSLHRLQKRYVWLLDVVSQIIFTTNSVVPFEVTIASAKPALEDTATLAPQAGSFNRR
FT                   LTVNRQTTLDLWNLPQQVFDDYTKPEHLVVLTHGLHSNVTADMQYLKETIEQCQQYYPN
FT                   EHIVVKGFGDNVCKTEKGIKYLGGRLGEYIVKQLYNERIKRISFIGHSLGGLTQTFAIA
FT                   YIAINYPWFFEKVDPVNFVALSSPLLGIVTNNPAYVNILLSMGVVGKTGQDLGLQAHQG
FT                   DDQPLLCSLPGHTTRRILRKFKKRTLYANAVNDGIVPLYTSALLYLDYDSILKQLDTQE
FT                   YQVDKQDFFTKTLINPLVKAINVLMPQTQSSSSIPKVSMFDSAMSVLLPPLPEKSYLMN
FT                   PSGDPSVILHDKMYSEADIPEVGQPPEKNIWSSLLLNIGNNEEYKQLEEEIAKKWHKGM
FT                   TWRKVIVHLKPDAHNNIIVRRRFANAYGWPVIDHLVQNHFNGSDYPYTEGETEEAALDE
FT                   LIEQEKKWINRPHNETFFDVGPTGMISSVGEILENIKNSAFQKTASASSLKPSDSFDDD
FT                   EIFRLNGLY"
FT   CDS_pept        complement(204330..205523)
FT                   /codon_start=1
FT                   /gene_family="HOG000074815" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622757"
FT                   /locus_tag="AGOS_ADL284C"
FT                   /product="ADL284Cp"
FT                   /function="translation release factor activity, codon
FT                   specific"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS51636.2"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016149"
FT                   /db_xref="HOGENOM:HBG266905"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniParc:UPI0001DB29BD"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B56"
FT                   /transl_table=1
FT                   /translation="MALRFGRLLLLGRALPVSVRCYSQAEGFRELHPSLIKRATGYAAE
FT                   LETLEKLLSKGESFDVEKQKKYSKLSSIVDTFRAYQDNVHMYRELQDMIAQDASLRTEA
FT                   QAELDELAPTLARSADTLLDKLLPPHPFAEKPCIVELRPGVGGIEAMIFTQDLLNMYIG
FT                   YAQHHRWKWSVTSATENTTGAGLSEAILSIDEPGSYDRLKFESGVHRVQRIPATESKGR
FT                   THTSTAAVVVLPKMAEEAESDAYERTFKPGEIRIDVMRASGKGGQHVNTTDSAVRITHF
FT                   PSGIAIHMQEERSQHRNKAKAFQILRAKLADLERKEREARERSARKDQVSSTDRSDKIR
FT                   TYNFPQNRVTDHRCAVSLHALAEVVTGERLDELIDSMARYDSEQKAKLLLKEMESTT"
FT   CDS_pept        join(205622..205646,205699..206594)
FT                   /codon_start=1
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751217"
FT                   /locus_tag="ADL283W"
FT                   /orf_name="AGOS_ADL283W"
FT                   /product="ADL283Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS51637.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="HSSP:1KE8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000025295F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BH1"
FT                   /transl_table=1
FT                   /translation="MTAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDG
FT                   LDMSAIREVKYLQEIRHANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQAD
FT                   IKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSN
FT                   VVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGT
FT                   PTDKDWPEVSSFSAYNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTT
FT                   RCLLSQYFVELPEATPPTELPKLNK"
FT   CDS_pept        206760..207878
FT                   /codon_start=1
FT                   /gene_family="HOG000094259" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775311"
FT                   /locus_tag="ADL282W"
FT                   /orf_name="AGOS_ADL282W"
FT                   /product="ADL282Wp"
FT                   /function="binding"
FT                   /protein_id="AAS51638.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG058544"
FT                   /db_xref="HOGENOM:HBG397468"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0000252960"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BH0"
FT                   /transl_table=1
FT                   /translation="MLTPMTNPLRLIGAGCRFLSTNNRPPLHKIFPSKKLVNRMLFDLD
FT                   SRLTFRKLLPVYEQVYTQLDSSTGDLVVPRGVRAHDVMIMKKVLEKTRRRTKSSNRHLL
FT                   ALENELLYMAAQMGHKDAAALLAFDTLCNPASQTAADMEYAKLMVKDFYRSGHPLTLKL
FT                   TGDLSLANGDNTTAEEYYMKFLKKEADTFLAGEVYGQLGRISFLRSHFAQAEERFLQAI
FT                   KLTPLEYSVQSYFYLGQLYMNSDPLKARSLLESAASQGFKESFKTLGHLEMNYFCDLTK
FT                   AREWFKLGMELGELECMIGCFDCAITLGDLALAHRASKSLEALAKTDKIYQALYTQFAD
FT                   YRHEKLSLLEEYKAEKALDVSGSIYAAENREK"
FT   CDS_pept        complement(207899..209686)
FT                   /codon_start=1
FT                   /gene_family="HOG000189846" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622758"
FT                   /gene_name="GPI10"
FT                   /locus_tag="ADL281C"
FT                   /product="GPI mannosyltransferase 3 "
FT                   /EC_number="2.4.1.-"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="intrinsic to endoplasmic reticulum
FT                   membrane"
FT                   /protein_id="AAS51639.1"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="GO:0031227"
FT                   /db_xref="HOGENOM:HBG027263"
FT                   /db_xref="HOGENOM:HBG397465"
FT                   /db_xref="InterPro:IPR005599"
FT                   /db_xref="UniParc:UPI0000252961"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75BG9"
FT                   /transl_table=1
FT                   /translation="MKERSILRTLFLWRLINALSIRSFFQADEYWQSLEPAHVKAFGYG
FT                   GLTWEWQHGLRSYAFPMLFEMSYYVAWILGVATRMALQGLAHATALCGAVVPSGAAGVA
FT                   AMKAVWELPEAAQELVEYYGVLYGPRVVMAAVAACGEFYSVLLVRKLYLRVADKGDDQK
FT                   GDAAPVSRLALMLTMTNFFNCFFATRTFINSFEMTLTAVALYHWDWSGGLDVGSLGFSA
FT                   SLAVAAFACLQRPTNVLIWAVLGLFLVLNLVRSRRWQLLLTLVAKVAAAGALAVCANIA
FT                   IDYYFYGGVLLPLLRFIEFNVTTPLAAFYGRAPWHFHLLQSVPLIVGYALPFFVGALLT
FT                   HNFRRGNAGLLGSPIMQIKCVVVLNIALYSCIDHKEFRFLYPLQPLFLSLSALEMHTWL
FT                   QHHHARGTAWLKRVQSLLYVLPVLSITAALVLNTAHEAGVVSVMDYLHSAVPSAESIGF
FT                   IMPCHSTPWQSHLHRNDLGKLWAISCQPPLDLLHQEDAGDQLLTYMDESDHLYENIPEF
FT                   IHKNFPPVFRRDLRSPGRQYAYEWPEFLVVFEHMDEAFMKEYLKDSNYVEVKRFFNTLS
FT                   HWDSRRAGDVIVYHKSPWY"
FT   CDS_pept        209800..212601
FT                   /codon_start=1
FT                   /gene_family="HOG000074709" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751218"
FT                   /locus_tag="ADL280W"
FT                   /orf_name="AGOS_ADL280W"
FT                   /product="ADL280Wp"
FT                   /function="acid-amino acid ligase activity"
FT                   /biological_process="protein modification process "
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS51640.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016881"
FT                   /db_xref="HOGENOM:HBG124622"
FT                   /db_xref="HOGENOM:HBG204273"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="UniParc:UPI0000252962"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BG8"
FT                   /transl_table=1
FT                   /translation="MLNFSGSTKRRNVNLGSSKKINKSELIEKARLERERRAQEKRIQE
FT                   STLCIQRCARRWTARRRVLGSLDGVAAREYGTQILVAFGAGILHYARGDAVAAVVEACS
FT                   VDSATAYWRCTELLEQVARGGETGLVRQLLDKLNAAGARPLTDAGAAPGGRLQRIERLV
FT                   GARLRVLEAMRGELTRRDMNALLAVVPSGGEMRGDEAVQWAALYGVEQARVRVRANLLC
FT                   YLRELAQRLSPEVVLQQGPCSVDTIYYLTYLFAERLGRDPDAIYAVLCACIDQHKSFEF
FT                   DSGSFFFQYVEGIYSYRTASLLAGYLRTHSVPTASQYAKVFLDRAPSPRQAEVLLLGIV
FT                   ADADAMQRLVQECKTSGAVTSASFSLLTECLDIYLSYVNDTVLLGPKSNFPLEDLVVFC
FT                   NLVRDAISQALRAEHDYEVNKMRRALSLLQKLYIRDRRTNFLSAAKGDDFWVIADTTVK
FT                   NCDITSLLLYFDEFYREQLDLFLAQGRARHEVPSGDLVAWENDIKVKFFSEKSSKHASW
FT                   GSLALRKFELVLRAPFLLPFRERVAYFETLIHHDRRRLQGRHTGPALRLPDLYFPSSRR
FT                   QRAIISRNNILEDAYEAYNPLGEDFKDQLAVTFINEFGPEAGIDGGGITKEFLTSVSDE
FT                   GFNKDKYRLFKANSVYELYPSDAATSPQQLQYLHFLGKVLGKCLYEKVLIDVHFADFFL
FT                   HKLLSTSKNMACSFDNLPSFDRELYDNLNKLFDMSTAELQLLDLRMEIVDENTMKIVEL
FT                   VPGGSQIPVTTTNVRQYALAVASYRMNSQLARATFYFQTGMAVIIPPHWIAIFSSSELS
FT                   KLISGGGRDIDLADLRANVTYGGYVESDPTIQHLWQLLLEFTPEQRCKFIKFATSVPRA
FT                   PLLGFQMLNPKFGIRNAGTDYNRLPTASTCVNLLKLPDYQDKDLLREKLLYAINSEARF
FT                   DLS"
FT   CDS_pept        212848..214329
FT                   /codon_start=1
FT                   /gene_family="HOG000246669" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928300"
FT                   /locus_tag="ADL279W"
FT                   /orf_name="AGOS_ADL279W"
FT                   /product="ADL279Wp"
FT                   /protein_id="AAS51641.1"
FT                   /db_xref="HOGENOM:HBG058545"
FT                   /db_xref="HOGENOM:HBG397085"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR018355"
FT                   /db_xref="UniParc:UPI0000252963"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BH7"
FT                   /transl_table=1
FT                   /translation="MFNIAIWFLVRGARGMPVTLQRVARRSATVFPDDNELDMDFVLFT
FT                   FSLVFMLLCYGMMVLIYLGLRYVVRRCFTRRIALSSSDSSRANSGDVPTVLDDELEVRH
FT                   KLAQLSPEEQFYYKQGEEFIKQNPPALMPYQTVAGGGSHGEPADVFDPVINDQTLRYIE
FT                   EEGAQAWEFQPSPSLPPDFVKVENRTELTFMNSNSDVSVATNLPIPLANKVYYFECKIF
FT                   ELCDRLGRPVSHLSENQIVSFGLATSPYPYFRLPGRHHHSVAYDSNGARRLNNSFKLPQ
FT                   ELSSLFPRCEKGDVIGIGYRTRSGTVFFTRNGKKLNEKRIGGHIKGWKIKYLYPIVGAN
FT                   VPCKIHVNFGTYGFVYIEANVKKWGYAKLNGMKLPPPAYEDYDRDVLLESSYEDEVSEG
FT                   ETNSFVEHLHDGHLLPPPPGFEFSTTPTSNCDQFTLNTLPTEPPGYMSDVNAGSKHNGR
FT                   GVGRSENVQSDAPNAELLNANTFANQFINDSSPKR"
FT   CDS_pept        complement(214634..216277)
FT                   /codon_start=1
FT                   /gene_family="HOG000112621" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775312"
FT                   /locus_tag="AGOS_ADL278C"
FT                   /product="ADL278Cp"
FT                   /protein_id="AAS51642.2"
FT                   /db_xref="HOGENOM:HBG058546"
FT                   /db_xref="UniParc:UPI0001DB29BE"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B55"
FT                   /transl_table=1
FT                   /translation="MLRRSLSVVFGRRTIACKSCGIELQNKIKDGPGYFVTPQKAIRPA
FT                   AKQLELAKQLLYGERLRIEKQLTGPDRNTLEKWKELVPPSCKRCMDALHHNRYDTAEFP
FT                   EHTLEDVGKGVPRDAVVYHIAPLWQFPMGLDRRVLQSSKKVCVLFSKIDMVVQRPSHMP
FT                   QDVGAFFQSLLYHDLHVKITNFRFFSALKQWNIQTVRNALSKESYLLGGPNAGKSSLIN
FT                   ALMRTVVYESRRLVSSKQSSATPADLPPKAHLDIHSAGVSTIPNFTRQPQQYDIKGKII
FT                   HDVPGYRTSKSHTFDFNSMIQKDYLLRLRKSDSKTYLTKKYTSINGTESGRCYTVGGLF
FT                   YYVPPAQTINQVTRYMPGDPQKFQSIDKGLEVVRDVYSDRWDKETGSHPLAEYIHVNPA
FT                   LGDKNSFVRHVIPPFQGTIEIVMRDVGYLRVVATGSFKFLGLHEIWVPKGIEVSVREPL
FT                   TDVFRTTIEAYRDSGSVANVAQMIIKRPYISSTYPMAHNETDPLAKMREMYLERTASNL
FT                   SARRLMNRDPLELISQKQKERVNLYWHYCW"
FT   CDS_pept        216506..218590
FT                   /codon_start=1
FT                   /gene_family="HOG000203797" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751219"
FT                   /locus_tag="ADL277W"
FT                   /orf_name="AGOS_ADL277W"
FT                   /product="ADL277Wp"
FT                   /protein_id="AAS51643.1"
FT                   /db_xref="HOGENOM:HBG025414"
FT                   /db_xref="HOGENOM:HBG398050"
FT                   /db_xref="InterPro:IPR005343"
FT                   /db_xref="UniParc:UPI0000252965"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B54"
FT                   /transl_table=1
FT                   /translation="MGKVSKATKKFQSKHLKHTLDHRKQLKQHNQKIKGRRGNKSEDEK
FT                   RALALSKEEQKIKKSTKEEVFKDMSVEKFFEGGFELPKADKKLKQAAQKPDDDGDESSE
FT                   EEDMEQNMAELAEKDPDFYKYLQENDKELLGFGASNPLDAMSDDEDEEGQSTRGNDDAE
FT                   EGDEKVVVSYKLVSQWRKGLAENPTPKLIRNVCSAFKAAVNANQDAAADLYKFAVTDEK
FT                   AFHELMFVALKDIPQAVQKLAAYKVNKGVRTLPSNSTVSRLSSIMKSHAGSLLTLLHDI
FT                   TNTDTAVLVLHSTDQLMPYFLSYRKVLKDIVSAIVEVWSTTQDVETQAAAFAFITNAAR
FT                   EFKKSLLELVLKTTYSSFIKFCRKTNVHTMHLINFQKNSAAALFGIDATVSYNIGFEYI
FT                   RQLAIHLRNSINATTKKTAKSSPADAYKIVYNWQFCHSLDFWSRVLALQCSPENDRTQD
FT                   SPLRQLIYPLVQVTLGTLRLIPTAQFFPLRFYLTRSLLRISQHTGVYIPIYPLLSEILS
FT                   STAFTKAAKKSTLTAFDFDHNIKCNKAYLGTKIYQNGLIEQFVELLAEFYVIYAKNISF
FT                   PELISPAVVALRRYIKSSKNMKFNKMLSVVIEKLNQNADFILDKRAGVDFGPKNKAEVD
FT                   RFLADLPLDATPLGKYVSVQREIKEERARIMRESLEEDDKKSDDEGDLSIPDAPSSEED
FT                   "
FT   CDS_pept        218754..219461
FT                   /codon_start=1
FT                   /gene_family="HOG000000991" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751220"
FT                   /locus_tag="ADL276W"
FT                   /orf_name="AGOS_ADL276W"
FT                   /product="ADL276Wp"
FT                   /protein_id="AAS51644.1"
FT                   /db_xref="HOGENOM:HBG058547"
FT                   /db_xref="InterPro:IPR018468"
FT                   /db_xref="UniParc:UPI0000252966"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B53"
FT                   /transl_table=1
FT                   /translation="MSDSAGLHGSTAMQDPDSTLVEERLAATPKVINKVSKKGFKPPFS
FT                   VKLKRGAICRDGAGTDLGEELRLRERALDAELRQRATQETLLRRAVKIAESYEQLRQND
FT                   SLIEKWRGVCQAAMAYILNSMMLKIGRMGGYKEFKRKEVERMKRQVEYQTNDGVEDQIA
FT                   ELLESDEFLRLPLDEQEEIRERMQERREEAERARERELAKLDAELAATEGEEMTMEELA
FT                   TRLKVDYNMVYPP"
FT   CDS_pept        complement(219552..222977)
FT                   /codon_start=1
FT                   /gene_family="HOG000222962" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622759"
FT                   /locus_tag="AGOS_ADL275C"
FT                   /product="ADL275Cp"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="ribonucleoside binding"
FT                   /protein_id="AAS51645.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0032549"
FT                   /db_xref="HOGENOM:HBG049456"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR007646"
FT                   /db_xref="InterPro:IPR007647"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="UniParc:UPI0001DB29BF"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B52"
FT                   /transl_table=1
FT                   /translation="MAAVEHAHSAHKMDDTFEQLLKPVYKGKKLADAINTAEDKWHLLP
FT                   AFLKVKGLVKQHLDSFNYFVDVDLKKIIKANEMVLSDVDPEFYLKYVDIRVGRRSNSSK
FT                   IDMTPPHECRLRDMTYSAPIFVDIEYTRGRSIVLHKDVEIGKMPIMLRSNKCILNGASE
FT                   EVMAKLNECPLDPGGYFIVNGTEKVILVQEQLSKNRIIVEADEKKAIVQASVTSSTHER
FT                   KSKTYVVTKNDKIYLKHNSIAEEVPIVIVLKACGIVSDLEIMQLVCGNDSSYQDIFAIN
FT                   FEEASKMNIYTQQQALEYIGTKVKTIRRQKLTVLQEGIEAIATTVIAHLTVEALDFREK
FT                   ALYVAMMTRRVIMAIHNPKMVDDRDYVGNKRLELAGQLMSLLFEDLFKKFNNDFKASID
FT                   KVLKKPNRAEMYDALLSINVHSNNITSGLNRAISTGNWSLKRFKMERAGVTHVLSRLSY
FT                   ISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCTSDTPEGEACGLVKNLALMTHITT
FT                   DDEEEPIKNLCYLLGVEDITLLDSASIHLNYGVYLNGTIIGTTRFPARFVNQFRLLRRT
FT                   GKVSEFISIYTNSHQKAVHIATDGGRICRPLIIVRNGKSMVTAGHLRRLLEGELQFDDF
FT                   LKLGLVEYLDVNEENDSYIALYEKDIEEGTTHLEIEPFTVLGAVAGLIPYPHHNQSPRN
FT                   TYQCAMGKQAIGAIAYNQFKRIDTLLYLMIYPQQPMVKSKTIELIDYDKLPAGQNATVA
FT                   VMSYSGYDIEDALVINKSSIDRGFGRCETRKKTTTILKRYPNHTQDIIGGMRVDENGEP
FT                   IWQHQSLGPDGLGEVGMKVTSGQIYINKSIPTNASDSVLNQVQSQYREAPIIYRAPEPS
FT                   HIDQVMMSVSDNDQALIKVLLRQNRRPELGDKFSSRHGQKGVCGIIVQQEDMPFNDQGI
FT                   CPDIIMNPHGFPSRMTVGKMLELVSGKAGVLNGTLEYGTCFGGSQLADMSEILVNNGFN
FT                   YSGKDMLYSGITGECLQAYVFFGPIYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSR
FT                   DGGLRLGEMERDCVIAYGASQLLLERLMLSSDAFEVDVCNKCGLMGYSGWCTSCKSAEH
FT                   IIKMTIPYAAKLLFQELLSMNIAPRLKLEDVFQS"
FT   CDS_pept        223319..224863
FT                   /codon_start=1
FT                   /gene_family="HOG000170529" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751221"
FT                   /gene_name="TFB2"
FT                   /locus_tag="ADL274W"
FT                   /product="RNA polymerase II transcription factor B subunit
FT                   2"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /biological_process="DNA repair"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51646.1"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG146258"
FT                   /db_xref="HOGENOM:HBG318428"
FT                   /db_xref="InterPro:IPR004598"
FT                   /db_xref="UniParc:UPI0000252968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75B51"
FT                   /transl_table=1
FT                   /translation="MEPTPGIIHDGHNLFKNTVNEYLQELPQPVQSRLYQSPATCLAIY
FT                   RLLSPMAKFFIMSMIFQDEEVSLRDLDRWVKPDAKFQLHDAIKSMKLLHLITEGRSGQP
FT                   LMVQLNSIFKESFKNALTGGEVKNSFGNVVEEENDPVTMAMLDSYAADKWETILHFMVG
FT                   TPLTKSPGKNVLSLLRHSKLMEVDESSKELKITNEGFQFLLQDANAQIWTLLLQYLTMA
FT                   ETFQMDPVDVLNLIFMIGALELGKAYSVVGLSETQKTMLQDLRDYGLVFQKQSNLSKFY
FT                   PTRLATMLTSDVVSIRSASGAVNSVLRQRAEGVDGKVLNGTALGDDDLQAGGEGALDGA
FT                   LIVETNFKLYSYSNSPLQIAILSLFIHLKTRFQNMVTGQITRESIRRALHNGITADQII
FT                   AYMETHAHPQMRRLAGDNLEKKLELDPNCRDTLQVLPPTVVDQIKLWQLELDRIISYDG
FT                   YLFRDFDNLQEYQVLAQYARDIGVLLWSDDKKKMFFVSKEGNAQVIDFHKRKFRKK"
FT   CDS_pept        complement(225517..227388)
FT                   /codon_start=1
FT                   /gene_family="HOG000268804" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751222"
FT                   /gene_name="DED1"
FT                   /locus_tag="ADL273C"
FT                   /product="ATP-dependent RNA helicase DED1 "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS51647.2"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001DB29C0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75B50"
FT                   /transl_table=1
FT                   /translation="MSELVNKMENLSVGDSAQKKSAYVPPHVKRRMKEGGSEPSSRNTE
FT                   NFGNGGRFGGSEHNGFGGGRGSWFGGNARGGGPRSSDRGGSSRFGKWVDGKHVPMKRNE
FT                   KLEVQLFGTPEDPNFQSSGINFDNYDDIPVDASGEDVPDPITEFTSPPLDELLLENIKL
FT                   ARFTKPTPVQKYSVPIVAKGRDLMACAQTGSGKTGGFLFPVLSQSFSNGPASTPDESGY
FT                   YMRKAYPTAVVLAPTRELATQIFDEAKKFTYRSWVKPCVVYGGADIRQQIRELERGCDL
FT                   IVATPGRLNDLLERGKISLCSVKYLVLDEADRMLDMGFEPQIRHIVEGCDMPTVENRQT
FT                   LMFSATFPTDIQHLAADFLKDYIFLSVGRVGSTSENITQKVLHVEDIDKRSVLLDLLAA
FT                   SDGGLTLVFVETKRMADALTDFLIMQNLSATAIHGDRTQAERERALAFFRTGRANVLVA
FT                   TAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGLATAFFNRGNKNVVKEL
FT                   VDILEEANQEVPSFLSQIAKEMSYGGGGGKSSRGGRGGYSRGNSTRDFRRHGGGGGSEW
FT                   SSANRASSGWGNANRTGSGWGGSSGFGGSTESWSNASKTVGSNNSWW"
FT   CDS_pept        227863..229557
FT                   /codon_start=1
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928301"
FT                   /locus_tag="ADL272W"
FT                   /orf_name="AGOS_ADL272W"
FT                   /product="ADL272Wp"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS51648.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000025296A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B49"
FT                   /transl_table=1
FT                   /translation="MNMGAKEDCSDAEKLSSEGSEPASLRQSIKPRHVFMISMATGIGT
FT                   GLLVGNGKSIATAGVGGTLIGYLIIGVMVVCCMQSVGELVVAFPSLAGGFNSYGKKFID
FT                   PSLGFCVSWLFCLQWMVVLPLELVTASMTIKYWNSNLSPSLFVSAFYILICIVNFFGSG
FT                   GYAEAEFIFNCVKVMVLASFIVLGIVIITGGLGNSGPIGFQYLKTPGAFNTNYNVFKAT
FT                   AGTLVNAAFSCGGVEFLALSAAEQNRDNMPKSIRRACRQVSIRMFVFYLLSISVVGLLV
FT                   PYDSPMLMGSGSDTTHTSPYVAAIALHGVRIVPHIINAVILIAVVSVANSAMYSSSRTL
FT                   HSLAEQNFAPRYFALLNKHGQPMRCLVVSAIVGLISFIAEYRDQEAVFVWLLSISGLST
FT                   IFTWTTICIAHIRFRNALKLQGQSLDTLGYRSNTGVIGSYIATAINVVVIIVQFWVSLF
FT                   PLENNGKPDAVKFFQNYMAVPVAVLLYLGHKLYTNDWTPWIRTHCVDINTDRDVYAPSD
FT                   DLSTKGVVKLAPAVQSARSIASSALSESPPEPISQKAHQPERPSSGS"
FT   CDS_pept        229871..230953
FT                   /codon_start=1
FT                   /gene_family="HOG000141796" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751223"
FT                   /gene_name="MRP51"
FT                   /locus_tag="ADL271W"
FT                   /product="40S ribosomal protein MRP51, mitochondrial "
FT                   /cellular_component="mitochondrion"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS51649.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="HOGENOM:HBG190528"
FT                   /db_xref="HOGENOM:HBG203893"
FT                   /db_xref="InterPro:IPR016712"
FT                   /db_xref="UniParc:UPI000025296B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75B48"
FT                   /transl_table=1
FT                   /translation="MSSSNLSSILRNSRIAQVPKPKGPLFSPDKKYVPTHQLIENKAST
FT                   MHRQEWGMKSSIPSRSKSRYLIFDELDTQQRLTSFEAIGQYQWNRIRIQELGVVPERAT
FT                   AGNSFQTSADANAPSNPLFSGFSSRLSARTPLSSFFGLTSKSDAKQWKAAEKKVAALRP
FT                   AFKKWLQDHHPHLIIHKDQMDPADFRKRAVEFITEIATRSSGAGGSWKVVGNGGLTYGL
FT                   KGRLQQSPLGIKQNTVVEGRILQTNGMEKSVAAAGFVGNGMLGTNLRKVDYAMGDLVRT
FT                   ARFPFEVKQARLLENGRLLMDMSLIEPKNTARKYGYGAKENKNRTYIFQRGAVNERKIS
FT                   SEESAQQAEELLNILTNFEN"
FT   CDS_pept        complement(231019..231681)
FT                   /codon_start=1
FT                   /gene_family="HOG000228064" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751224"
FT                   /gene_name="HIS3"
FT                   /locus_tag="ADL270C"
FT                   /product="Imidazoleglycerol-phosphate dehydratase "
FT                   /EC_number="4.2.1.19"
FT                   /function="imidazoleglycerol-phosphate dehydratase activity"
FT                   /biological_process="histidine biosynthetic process "
FT                   /protein_id="AAS51650.2"
FT                   /db_xref="GO:0000105"
FT                   /db_xref="GO:0004424"
FT                   /db_xref="HOGENOM:HBG000008"
FT                   /db_xref="HOGENOM:HBG289010"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0001DB29C1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75B47"
FT                   /transl_table=1
FT                   /translation="MSETQRAFVKRITHETQVQIALALNGGPLEIGQSILGGAKTTVAH
FT                   QASSSQVINVQTGVGFLDHMIHALAKHSGWSLIVECVGDLHIDDHHTTEDCGLALGQAL
FT                   REAIGQVRGVKRFGTGFAPLDEALSRAVVDLSNRPYAVVDLGLRREKIGDLSTEMIPHF
FT                   LQSFAESARVTLHVDCLRGTNDHHRSESAFKAVAVALRDALTRTGTDDVPSTKGVLM"
FT   CDS_pept        231840..233033
FT                   /codon_start=1
FT                   /gene_family="HOG000248090" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928302"
FT                   /locus_tag="ADL269W"
FT                   /orf_name="AGOS_ADL269W"
FT                   /product="ADL269Wp"
FT                   /function="RNA binding"
FT                   /function="RNA methyltransferase activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="AAS51651.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0008173"
FT                   /db_xref="HOGENOM:HBG202881"
FT                   /db_xref="HOGENOM:HBG465624"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="UniParc:UPI000025296D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B46"
FT                   /transl_table=1
FT                   /translation="MNRSFIRSLTSKVKSAVKVPHSEHLHGQNKFERNFPVFQRKKAWE
FT                   RDGMDKDEWFRKKYAHVHAREASRKRDAHTETSKTPQVRKRAAAPVGDAQPRRSSFKSR
FT                   HAFDPLTPDPLLDRIYGRNSILLALQSNRREYFVRLLHSGNLDPQIAKLAGQLGIKVQS
FT                   AQRHQLNMMTNNAVHNGLVLEAKPLYPQEINALGAVDHEAGTFELIDQWSNNGTAQKVP
FT                   FLQSAKKRYPVGLYLDEVVDPHNVGAILRSAYFLGADFVAVSHRNSAPLSAAVSKTSSG
FT                   ALEVLPIYSVDKPLQFFERSRDEHDWVFVASHLTQGPGISSHVKNRVLPIEDMADLAQS
FT                   SPVMLVVGNEGTGIRSNLQQRSDFFVQVPFGRADEPQLVDSLNVSVAAALLLRSLLS"
FT   CDS_pept        complement(233154..234038)
FT                   /codon_start=1
FT                   /gene_family="HOG000274106" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751225"
FT                   /locus_tag="ADL268C"
FT                   /orf_name="AGOS_ADL268C"
FT                   /product="ADL268Cp"
FT                   /function="hydrolase activity"
FT                   /function="isopentenyl-diphosphate delta-isomerase activity"
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /protein_id="AAS51652.1"
FT                   /db_xref="GO:0004452"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG158579"
FT                   /db_xref="HOGENOM:HBG416977"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR011876"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniParc:UPI000025296E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B45"
FT                   /transl_table=1
FT                   /translation="MSVVVQGKVVMQRVGKERMSPYAVLVKSLTQEEVLEQFPEIIPIN
FT                   NRPNTHSSASSGDEHKDSVFTGHDEEQIKLMNENCIIVDWDDEPIGAGTKKLCHLMENI
FT                   DKGLLHRAFSVFVFSADGRLLLQQRATEKITFPDLWTNTCCSHPLCVDAEVGLKGTLEA
FT                   KVQGAWTAAVRKLEHELGIPPAQTLKRGKFHFLNRIHYMAPSNGPWGEHEIDYILFYRV
FT                   SDGCTLTVDPNPNEVRNSRWVTQHELKEMFANPELKFTPWFKLICQSYLFEWWGQLSDL
FT                   SRVENDTQIHRMV"
FT   CDS_pept        234560..235933
FT                   /codon_start=1
FT                   /gene_family="HOG000246667" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622760"
FT                   /locus_tag="AGOS_ADL267W"
FT                   /product="ADL267Wp"
FT                   /protein_id="AAS51653.2"
FT                   /db_xref="HOGENOM:HBG058549"
FT                   /db_xref="UniParc:UPI0001DB29C2"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B44"
FT                   /transl_table=1
FT                   /translation="MSSRSNVKRPDSSVRDRKLEPLYAQLKKVDQEVTAVRKQIDEMQV
FT                   GEGSQESKQKLHEQLKEIIRAQSDLKGKRQQIHDRIKQLDAQIKRKTGEVAERVGRKSA
FT                   YSSGEEIRERLAQIDEEISSGGLSLVEEKLRVKEMQALNKLAKDLQQVEPVKRSIEEDR
FT                   AAIAELKAKLNSLNPKEVSAQFESTQAKLNQLQSKNQVVYDQRSRLFTKRSALYSKRDE
FT                   IFAQIKKIRGDFDNEFKAYKKKLDDDRIKREEEERISRVLEDKEEKMGKLQEKLIHAHK
FT                   PAFAYEISAIETALFSLDPTFVKPATNTIDFPGSQPAKPIKKVEADDLVPIVKKREEFF
FT                   PSSAVSKNKKKQASAAAAAAGNGKFSLEPTLIVVLADLDVSVPMTKDDVPATVDQLKAK
FT                   YEDFLARQDEQTSKNVAEAEAALDKLELEYKAKEDQVRKELEEKRAKDQAAKEASASQ"
FT   CDS_pept        complement(236093..237451)
FT                   /codon_start=1
FT                   /gene_family="HOG000240109" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622761"
FT                   /gene_name="MCA1"
FT                   /locus_tag="ADL266C"
FT                   /product="Metacaspase-1"
FT                   /EC_number="3.4.22.-"
FT                   /function="cysteine-type endopeptidase activity "
FT                   /biological_process="apoptosis"
FT                   /biological_process="proteolysis"
FT                   /protein_id="AAS51654.1"
FT                   /db_xref="GO:0004197"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0006915"
FT                   /db_xref="HOGENOM:HBG508555"
FT                   /db_xref="HOGENOM:HBG692861"
FT                   /db_xref="InterPro:IPR011600"
FT                   /db_xref="UniParc:UPI0000252970"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75B43"
FT                   /transl_table=1
FT                   /translation="MYPGAGRPTYHKQQEQKGPYGQPQYQQQYAPPYPERYQQPYYQPP
FT                   PHDGYSRPSMPPPSHNYAAAQYERPSCPPPGYAPHQGGFPAPGPPLQGRPRDLMRSDIQ
FT                   MNHSMDYSNIQGPASYTRPEFVAPPPQERQFLDPGNRSVEYQYSQCTGNRKALLIGINY
FT                   FNSSAELRGCINDVQNIKNFLISRYGYREENMVILTDDQHDPVRIPTKANILRAMHWLV
FT                   QGAQPNDSLFLHYSGHGGETEDLDGDEQDGKDSTLYPVDFETNGHIVDDEIHDILVKPL
FT                   APGVRLTALIDACHSGSALDLPYMYSTKGIIKEPNVWKDIGSNSMQAAMAYVTGNTGDM
FT                   FTSLKSLASTVSRKATGSGGVDTERVRQTKFSPADVIMFSGSKDNQTSADAVENGVATG
FT                   AMSYSFVKVMSQQPQQTYLSLLQNMRTELKGKYTQKPQLSCSHPLDVNLQFVL"
FT   CDS_pept        238360..240408
FT                   /codon_start=1
FT                   /gene_family="HOG000246666" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751226"
FT                   /locus_tag="AGOS_ADL265W"
FT                   /product="ADL265Wp"
FT                   /protein_id="AAS51655.2"
FT                   /db_xref="HOGENOM:HBG058550"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="UniParc:UPI0001DB29C3"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B42"
FT                   /transl_table=1
FT                   /translation="MAQPEPLQQFERQFEEFVKNNPNVLSAARSASRIPESAKAVIILS
FT                   PLSLQHQFPRYWVSKSYKKSIVERPERLLASSLGIAAAITMYPALFTLKSSHHRQTSLL
FT                   SPHVLRVHGNDWPKAILRLCKQSDDRIQKRQLEVPDEWNVGDIYLCRGTIDALQGSIGA
FT                   LESGVDSIFDGPSAASTPNRAFVALRPPGHHSHTSTPSGFCLLNNAHIAVEYAASRYGV
FT                   THAAILDFDLHHGDGTQDICWKRAGFKPDDEEDNAAEYDDFGKRFAEFPKVGYFSLHDI
FT                   NSFPTEQGYAHKTSIKDASVCIMDSHDVNIWNIHLTAYETEEEFNKLYQTKYRAIFAKA
FT                   DEFLRVSQKRMASEGKNYKGLIIISAGFDASEHEQLSMQRHGVHVPTSFYCAFTKDALK
FT                   LAQMHTQGKLLSLLEGGYSDAALVSGVFSHLIGMQNQNWIPEWGSAQVIKEVCRGCRPN
FT                   WKAYKTKRSRDVIRNWAEEVIKLGRSMIPEFQETFFADTATAEPPAARMTRSKHNEIIA
FT                   KVDDSALALRSDTPSPPERKPLGATKATPHVRYASGTVQPLHTDSEDDDKDDYVYDEAL
FT                   NRTFNRTVEDITVDDISKHLETLEIIQEPVPSRQHQLVLDPEPQHDPAASANASSKYRV
FT                   PQLEATQRARRMKSSKPPNIEDSDISMISHFSAADKRRTTQGSRNKW"
FT   CDS_pept        240761..241930
FT                   /codon_start=1
FT                   /gene_family="HOG000160667" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059069"
FT                   /locus_tag="AGOS_ADL265WA"
FT                   /product="ADL265W-Ap"
FT                   /function="glycolipid 2-alpha-mannosyltransferase activity "
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="ADJ41761.1"
FT                   /db_xref="GO:0004377"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="UniParc:UPI0001DB29C4"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGB8"
FT                   /transl_table=1
FT                   /translation="MRINVRIAKILGAVGILLVTASVLIYGTGISYNPSMRTLHGSGNN
FT                   KGNIYRTVTEQEVAPMKREKATFVTLARNSDLYTLLESIMSVEDRFNHKFKYDWVFLND
FT                   EEFTDTFKALTSALVSGNTYYGKVPKEHWSFPEWIDQDRAARVRQMMAEKNVIYGDSIN
FT                   YRFMCRYESGLFYRHELLQPYDYYWRVEPEVRFFCDVDYDVFRFMRDNNKKYGFTISIH
FT                   EYPATIETLWEETRKFMEKHPEHVHPNNMMDFISDDNGLSYNMCHFWSNFEIGSLEFLR
FT                   SKAYSDYFDSLDQAGGFFYERWGDAPVHSIAAALFLDRNEIHHFNDIGYFHPPFQQCPI
FT                   DETFRKEHRCACNADKDFTWNSFSCGSKFYDVNKMKKPAGWYDYVSRNP"
FT   CDS_pept        complement(241979..242968)
FT                   /codon_start=1
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775313"
FT                   /locus_tag="ADL264C"
FT                   /orf_name="AGOS_ADL264C"
FT                   /product="ADL264Cp"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS51656.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0000252972"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B41"
FT                   /transl_table=1
FT                   /translation="MGCGVLAERRDHVPRSRDRMAEQESVVAIEEPSVHVGTPKSNALY
FT                   ENAKSLAAGAVGGVCAVLTGHPFDLLKVRCQSNQASGTVDAVRKILVEARAQSGLSAVN
FT                   MMRGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTWNDNSGKLTTAQLATAGFISAIPT
FT                   TLVMAPTERVKVVLQTQSNHSLGSAAKHILATGGVRSLFRGSLATLARDGPGSALYFAS
FT                   YEATKAYLNARSGTNELSIKNVCLAGGMAGVSMWVGVFPIDTIKTELQSSNTRQTMMEA
FT                   TRKIYNTRGGIKGFFPGIGPALLRSFPANAATFLGVELTHSLFKKYNI"
FT   CDS_pept        243305..244186
FT                   /codon_start=1
FT                   /gene_family="HOG000248215" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751227"
FT                   /locus_tag="AGOS_ADL263W"
FT                   /product="ADL263Wp"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS51657.2"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG252742"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI0001DB29D6"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B40"
FT                   /transl_table=1
FT                   /translation="MAQKAQKHAGVANCPTRSRCSTVAIKMSTPANLFPGLNDIVDVIE
FT                   EFPLEVARYMTLLREIDAKCVHTVPELNAQIGRFLAGSRQPGSPQLQTINRLFQDLMPS
FT                   LEEKMHVSSIAFETLDRLVARVELAYEVALKNQEIPDKLRLGNDNHPAMHLHHELMKKI
FT                   ESKQQSKSQQALRSESRREAMAAKKMHVDPPAPAPASYAPLPLPPAALAAKRRADLPPP
FT                   ARKRKKPRDDYSARPKTNEYGEALYCYCNQVAYGEMVGCDGENCQLEWFHLPCINLETL
FT                   PKGKWYCDDCKR"
FT   CDS_pept        join(244445..244459,244521..245318)
FT                   /codon_start=1
FT                   /gene_family="HOG000233973" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079569"
FT                   /locus_tag="AGOS_ADL262W"
FT                   /product="ADL262Wp"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS51658.2"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003577"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="UniParc:UPI0001DB29D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B39"
FT                   /transl_table=1
FT                   /translation="MAMIKNSIREYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTIED
FT                   SYRKQVVIDGQVSILDILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFEELMTYY
FT                   QQILRVKDVEYVPIFVVGNKSDLEGERQVSFEEGAELARHFNASFLETSAKQAINVEES
FT                   FYGLARLVRDDGIHAGKRLESSPEDPANAAGAEPSAGYSKDDNALDPEAVQGTLANSSV
FT                   GSRAPGAVDHKGETSAVSGSLRSSRAQQQSLNTDGVAAKKSTGCCVIL"
FT   CDS_pept        complement(245598..245999)
FT                   /codon_start=1
FT                   /gene_family="HOG000211854" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622762"
FT                   /locus_tag="ADL261C"
FT                   /orf_name="AGOS_ADL261C"
FT                   /product="ADL261Cp"
FT                   /protein_id="AAS51659.1"
FT                   /db_xref="HOGENOM:HBG058552"
FT                   /db_xref="HOGENOM:HBG329225"
FT                   /db_xref="InterPro:IPR003038"
FT                   /db_xref="UniParc:UPI0000252975"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B38"
FT                   /transl_table=1
FT                   /translation="MVRAVKKKVAGMQAAGPVVGNVLEQFREALQITWRAYSRDLKSDQ
FT                   RLLLIDTLCGGLVTIGLVQVLFIAVIRDTFPFNAFLAGFISCVGQFVLLISLRLQLREQ
FT                   FAGISSQRAFGEFVLASLVLHFICLHFIN"
FT   CDS_pept        246209..246886
FT                   /codon_start=1
FT                   /gene_family="HOG000188365" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751228"
FT                   /gene_name="OCA1"
FT                   /locus_tag="ADL260W"
FT                   /product="Putative tyrosine-protein phosphatase OCA1 "
FT                   /EC_number="3.1.3.48"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /biological_process="response to stress"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS51660.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG253090"
FT                   /db_xref="HOGENOM:HBG527347"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="InterPro:IPR020428"
FT                   /db_xref="UniParc:UPI0000252976"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75B37"
FT                   /transl_table=1
FT                   /translation="MTDNCREDDDNLGTSGDNALSAPTQLLVTPPAPHQTIVPPLNFCP
FT                   VERYLYRSGQPSTVNFPFLLNLNLRTIIWLANEEPQDALLAFCDMHDIRLRFAAINPEG
FT                   GEDDNPWDGLTEHSIVSALQTIVHRDNYPLLVCCGMGRHRTGTVIGCLRRIMGWNLASV
FT                   SEEYRRFTGSRGGRILVELLIEAFDTKSVTIDKANAPEWLATAVSASEASYVPATTYSI
FT                   HEM"
FT   CDS_pept        247089..247703
FT                   /codon_start=1
FT                   /gene_family="HOG000115548" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928303"
FT                   /locus_tag="ADL259W"
FT                   /orf_name="AGOS_ADL259W"
FT                   /product="ADL259Wp"
FT                   /protein_id="AAS51661.1"
FT                   /db_xref="HOGENOM:HBG058553"
FT                   /db_xref="UniParc:UPI0000252977"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B36"
FT                   /transl_table=1
FT                   /translation="MSDFAFCPSKLMRRSAFDSTKETLRSFKSWDTCMDNRVCKIVAIV
FT                   GIVLASIVAIWIVGSLLRCFMRGVSGICDFLCWPCCCYRRHRQRRREEKQRAQVYAPPP
FT                   QVVYQPVVTPEAARYYGKDEYYSERKKGFSSSSNESYDLEAQKAGGSRGRYGKRGAVHD
FT                   EDVNQYEERLWGTQRKTPPAQRQAPYPVDSSASPYGHYNRI"
FT   CDS_pept        248121..249725
FT                   /codon_start=1
FT                   /gene_family="HOG000248839" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751229"
FT                   /locus_tag="ADL258W"
FT                   /orf_name="AGOS_ADL258W"
FT                   /product="ADL258Wp"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAS51662.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058554"
FT                   /db_xref="HOGENOM:HBG397984"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000252978"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B35"
FT                   /transl_table=1
FT                   /translation="MLTRISSTDSSPRAKEDVPQLKLLKEADDGLVDSSSSSPEPDEKI
FT                   GEACVSTSEISKIPHSMLRYSQKWMMVALLTSAGFWSSLGSPAVYPALRNLQREFGVSE
FT                   DLVNIAVVVYLLFQGVAPTVCSGLADTYGRRPVILMGMLIFIVSSIGIACSNSFALVIA
FT                   LRCIQSSGISPIIAINSGVVGDFTLKSERGTFIGAVSGLTLLGQAFGSLIGASLTAAYN
FT                   WRAVFWFMTIGCGVCFLANFLFLPETHRCIVGNLSLKPKRNINFSPVLLLPVIRRQFSL
FT                   QHPHYSSLDDTVAGLDIVAALKIIACPEILLTLLPAGLQFSLWTLSLTSLSQALQSDPY
FT                   NYPLTTVGLCYLPSGICGLLGSFLTGKLIDIWYRYFADRFQRRSANSSGPSAPFNVLEA
FT                   RIVAGLPQNFISVMAFIIFGWSIQGGWHISVPLVASGVGTFCVMSTLSTSSTLLIDLYP
FT                   NRASTASSCYNFIRCTLSALFLAVFARMKASMTIGGTFTFLCSLIFVGNCALIFPMKYG
FT                   MTWRDRRLRRAAEASCN"
FT   CDS_pept        complement(249961..251193)
FT                   /codon_start=1
FT                   /gene_family="HOG000226718" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751230"
FT                   /locus_tag="ADL257C"
FT                   /orf_name="AGOS_ADL257C"
FT                   /product="ADL257Cp"
FT                   /function="ATP binding"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /biological_process="response to heat"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS51663.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0009408"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG436112"
FT                   /db_xref="HOGENOM:HBG635315"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI0000252979"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B34"
FT                   /transl_table=1
FT                   /translation="MVKDTKLYDLLGVSPDANDAQIKKAYRKSALKYHPDKNPSEEAAD
FT                   KFKQITGAYEILSDSQKREMYDQFGEEGLNGGGQGGPGGFGGFGGFGEDIFSQFFGGGG
FT                   ASRPRGPQKGRDIRHDISCTLENLYKGRAAKLALNKTVLCKRCEGRGGKAGSVKKCTSC
FT                   NGQGVKFVTRHMGPMIQRFQTTCEVCNGEGDVIPAADRCKDCDGKKIASERKILEVNIQ
FT                   PGMKHGQKIVFQGEADQQPGQIPGDVVFVVNEQEHPRFVRNGDNLHYEAEIDLLTAIAG
FT                   GQFALEHVSGDWLKIDIVPGEVIAPGMVKVIEGKGMPIQKYGSYGDLLIKFNVKFPKSH
FT                   FADEEALKKLEAILPPKTLPRIPPNAEVEECVLADFEPAKHDSRSGNGRGQSYDSDEEE
FT                   AHTEGVQCASQ"
FT   CDS_pept        251491..252366
FT                   /codon_start=1
FT                   /gene_family="HOG000248841" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751231"
FT                   /locus_tag="ADL256W"
FT                   /orf_name="AGOS_ADL256W"
FT                   /product="ADL256Wp"
FT                   /function="protein methyltransferase activity"
FT                   /protein_id="AAS51664.1"
FT                   /db_xref="GO:0008276"
FT                   /db_xref="HOGENOM:HBG397981"
FT                   /db_xref="HOGENOM:HBG434728"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="UniParc:UPI000025297A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B33"
FT                   /transl_table=1
FT                   /translation="MPRIAPSLMRTACAESRLLPLLLPESRTLEQARTELRWMRAELCG
FT                   AAAVARGCRQRYRGVPLQYVLGTQPFGPLEVRCRRGVLIPRWETEEWACELARRFAARG
FT                   RSLRAADLCTGTGCVGLLLAHSVRGARVTAVDVSEAAVAAARQNAAALRVPLEVVRADV
FT                   RQPGGLLRDGVEVVTCNPPYIPTDALPRECTRSVCRYEPQLALAGDLEFYDNLVDVWLA
FT                   RTDSFVYEVGYAEQSRHVLARIAADPALRGVWRVGFREDARGQPRVVYGYRTAAAGLDA
FT                   VFEGYGRLMH"
FT   CDS_pept        complement(252414..253793)
FT                   /codon_start=1
FT                   /gene_family="HOG000248840" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18928304"
FT                   /gene_name="TRM6"
FT                   /locus_tag="ADL255C"
FT                   /product="tRNA (adenine-N(1)-)-methyltransferase non-
FT                   catalytic subunit TRM6"
FT                   /function="translation initiation factor activity "
FT                   /biological_process="regulation of translational initiation"
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51665.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006446"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="HOGENOM:HBG058555"
FT                   /db_xref="HOGENOM:HBG397982"
FT                   /db_xref="InterPro:IPR007316"
FT                   /db_xref="InterPro:IPR017423"
FT                   /db_xref="UniParc:UPI000025297B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75B32"
FT                   /transl_table=1
FT                   /translation="MDPLRQLVLNQHILVRLPSDNLKIVELKPNGVISLGKFGACHVND
FT                   IIGYPLGTTFEIWYEGDETEVVRGSTVVIGKVRVLENRAEAQVGSEGATPQPAELTQVE
FT                   SSKTNMELLDLGHKVQKLDHKEIERMKQDVTAGDSIISMMIQSHETFHKKTIHSQEKYL
FT                   KRKKQKFAKFFTAEYLGSSGLLRYLIEKGDMQRIMDLSEESLGMALNLANIRSNGTYLC
FT                   MDETGGLIVYAMLERMFGGHEAQHGGTIVVVHENEHPNLDLLKFSNYSEEFIGKHVKTV
FT                   SLLQYFEPPTVEEVEASFTPLDDAQLREMKSNKKGAYYRRLKRYNSDLEVIRLASQITY
FT                   DALIVASTLQLSTLVPRLAGKVHGSRPIVCYSQFRETLLELSHTLYDSLHFLAPTLLET
FT                   RCRPYQTVRGKLHPLMTMRGGGGYLLWCHKVIPADNGAGKIDCDNAAAPACPAAQPDEA
FT                   P"
FT   CDS_pept        254051..255862
FT                   /codon_start=1
FT                   /gene_family="HOG000224258" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751232"
FT                   /locus_tag="ADL254W"
FT                   /orf_name="AGOS_ADL254W"
FT                   /product="ADL254Wp"
FT                   /function="RNA binding"
FT                   /function="S-adenosylmethionine-dependent methyltransferase
FT                   activity"
FT                   /biological_process="rRNA processing"
FT                   /protein_id="AAS51666.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008757"
FT                   /db_xref="HOGENOM:HBG460167"
FT                   /db_xref="HOGENOM:HBG726909"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR011023"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="UniParc:UPI000025297C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B31"
FT                   /transl_table=1
FT                   /translation="MGSRRAKNKQPAPPSLEEFQAKKNKKQQKHEKRSRKNAGEEPIEE
FT                   RKRSKKAKVDNKEVDVQDEADLPEVNLEQLAKERKSLFDEEEVVEEEDLQDEFDLEQEY
FT                   EDDEEVRERPLFSDEEEDAGMEELNAANMEALSMKLDEEEALEAEEAEQELVEAAKLQP
FT                   RADILPNSEQEELEAQGPPDLTAIRTRMLEIVKVLEDFKHMAAEGRSRSEYIDRLLKDI
FT                   CQYFGYTPFLAEKLFNLFSPAEAMEFFEANEVARPVTIRTNTLKTRRRDLAQNLVNRGV
FT                   NLQPIGSWTKVGLQIFDSQVPVGATPEYLAGHYILQAASSFLPVIALDPHENERILDMA
FT                   AAPGGKTTYISAMMKNTGCVFANDANKARTKSLIANIHRLGCTNTIVCNYDAREFPKVI
FT                   GGFDRILLDAPCSGTGVIGKDQSVKVNRTEKDFMQIPHLQKQLILSAIDSVDSNSKHGG
FT                   VIVYSTCSVAVEENEAVVDYALRKRPNVKLVETGLAIGKEGFTSYRGKKFHHTINLTRR
FT                   YYPHTYNVDGFFVAKFQKTGPSKFDDNQHSAKEKEAAARQEAIDEGIIHDDFASFDDKE
FT                   DKRYIEKSKKVGLLKKGKNPHATKPKQ"
FT   CDS_pept        complement(255999..258254)
FT                   /codon_start=1
FT                   /gene_family="HOG000171615" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751233"
FT                   /locus_tag="AGOS_ADL253C"
FT                   /product="ADL253Cp"
FT                   /protein_id="AAS51667.2"
FT                   /db_xref="HOGENOM:HBG351854"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniParc:UPI0001DB29D8"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B30"
FT                   /transl_table=1
FT                   /translation="MRQQGMSRDSSLAPLPVHVVDEPPLVDEPEGFYSAGAEDGGPIAI
FT                   DFGSYEVRAGYVANKEPALVFPTRLARYRDRKASRTYTFVGRDTGLDASIRTQSRSPFD
FT                   GPMVTNWDYVDDMLAYTFHHLGVRGGGGVPNAVVLTERLATLQSQRANWYELLYEAYNL
FT                   QEVTFGIDSLFSFYGERGPGSTGLVVSSGNEDTCVVPVVDGRGVVSEAKRINWGGQQAV
FT                   DYLTGLLALKYPYFPTKLSGSQFETIYREHCYVAEDFEREIDEILQLPTLEAKNVVVEA
FT                   PFTEVVQVQKTEEELRLQAEKRRETGKRLQEQARQRRKEKLVQKEEEYEYYLQIRGQLE
FT                   GQPKKNILATLQNAGFDDEDDFNKYITSLERSLKRARVLDANENEEEPSSTVPNFDLVN
FT                   IPDEELNDEQRREKKKQRLMKANYDARMKAKEEKLEQQKREEDARLRNEQWRKDDLKGW
FT                   IKEKRSQLTGLMKARKEKLKMKEDMKDRKSQAAQKRMKNIASLAEDNTSNNKRSRQQAT
FT                   IDNDPNDTFGANDDDWMIYNDISQNPEALDEALEEEYKVIVEIEKELLEHDPHFTEEDT
FT                   LDAQYDWRNSTLHLFLRGPRPHDSENIHEQHQMHINVERIRVPEVIFQPSIGGLDQAGV
FT                   VELCETVLLKKFDSSRRALSATCEKMAKNVFITGGNTKLPGIRERIVREFTGFLPVGTE
FT                   LKVTLAKDPSLSAWKGMAKFASDPTSYKSSILTKREYEEYGPEYIKEHNLGNAKFMD"
FT   CDS_pept        258796..259470
FT                   /codon_start=1
FT                   /gene_family="HOG000233974" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751234"
FT                   /gene_name="RHO3"
FT                   /locus_tag="ADL252W"
FT                   /product="GTP-binding protein RHO3 "
FT                   /function="GTP binding"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="AAS51668.1"
FT                   /db_xref="EMBL:AAG41252.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="UniParc:UPI000006B550"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HF51"
FT                   /transl_table=1
FT                   /translation="MPLCGSSSSSKHPIERKIVILGDGACGKTSLLNVFTRGYFPKVYE
FT                   PTVFENYIHDIFVDNQHITLSLWDTAGQEEFDRLRSLSYSDTHTIMLCFSVDSRDSLEN
FT                   VKNKWVSEIADHCEGVKLVLVALKCDLRSSDEYGNESAITPGSIQNQKYNGGGGNGLIP
FT                   YDEGLAMAKQIGALRYLECSAKMNRGVNEAFTEAARCALTATPKGARDSAPEAESSSCT
FT                   IM"
FT   mat_peptide     258796..259458
FT                   /gene_name="RHO3"
FT                   /locus_tag="ADL252W"
FT                   /product="GTP-binding protein RHO3 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HF51 "
FT   pro_peptide     259459..259467
FT                   /gene_name="RHO3"
FT                   /locus_tag="ADL252W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HF51 "
FT   CDS_pept        complement(259802..260512)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751235"
FT                   /locus_tag="ADL251C"
FT                   /orf_name="AGOS_ADL251C"
FT                   /product="ADL251Cp"
FT                   /protein_id="AAS51669.1"
FT                   /db_xref="HOGENOM:HBG058557"
FT                   /db_xref="UniParc:UPI000025297E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B28"
FT                   /transl_table=1
FT                   /translation="MDLAPDAPEFTGQFDVGPSPIEYLVPFVTPPSAANNPNIWKSSQP
FT                   PGAVFIFVGAVAAGVFLILIIWYLVTEHISRRETRKSQYEGIEELFKDDYTSAKDTFTV
FT                   GLDMASDPAPPYAEVKPKHVVDSIAAPPSLFGFNALNSPADRYPAQDEERRLEDLRRSM
FT                   YISPTVEVMNLRRHRKAGYEIPGSSFDAQSMRTFDMFTPALSAAERRRSRKFNRNRYPM
FT                   NSVAGSILEPIDGV"
FT   CDS_pept        260969..261514
FT                   /codon_start=1
FT                   /gene_family="HOG000188365" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775314"
FT                   /locus_tag="ADL250W"
FT                   /orf_name="AGOS_ADL250W"
FT                   /product="ADL250Wp"
FT                   /protein_id="AAS51670.1"
FT                   /db_xref="HOGENOM:HBG253090"
FT                   /db_xref="HOGENOM:HBG527347"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="UniParc:UPI000025297F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B27"
FT                   /transl_table=1
FT                   /translation="MYIPPLNFALVVSRDVSLYRSGYPMPLNYPFIKTRLQAGTVIYVG
FT                   DKDISEEYKAFLESEQIRYHHIYMQSCRDDNIQESMEQVLRLVLNVDNYPILIHSNKGK
FT                   HRVGVVVGIIRKLLQGWSVTGIYQEYGIFSGGQKDQADLEYITMFGTKLMVPMDKVPGF
FT                   VQFIGTTPSTDYSSDLSA"
FT   CDS_pept        261676..262839
FT                   /codon_start=1
FT                   /gene_family="HOG000288512" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751236"
FT                   /locus_tag="ADL249W"
FT                   /orf_name="AGOS_ADL249W"
FT                   /product="ADL249Wp"
FT                   /function="histidinol-phosphate transaminase activity "
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="histidine biosynthetic process "
FT                   /protein_id="AAS51671.1"
FT                   /db_xref="GO:0000105"
FT                   /db_xref="GO:0004400"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG502043"
FT                   /db_xref="HOGENOM:HBG646350"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0000252980"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B26"
FT                   /transl_table=1
FT                   /translation="MDFDIKAVIRPNILKLKPYRCARDDFSEGILLDANENAFGPVVKF
FT                   SRLPASLHRYPDPHQLELKGLLASYRNAASAFREEGLAPLTAKNICLGVGSDESIDAII
FT                   RATCSPREQKVMLLPPTYGMYKVCADINDVGYVEVPLISSDNSFQIDEDRILEQLNLDK
FT                   SIKVVFITSPGNPTGACIEVGRVEKLLRNWTAGIVVVDEAYIDFSADKPSLSPLVNKHP
FT                   NLVVLQTLSKASGLAGIRLGFTFASTQIATALNAMKAPYNISQITAIIGIEALQPEALK
FT                   LMQKHIDQINTEKRRIIKALATLNHIENDPVGGLDANFILFRVRGGDNSLAKKLYYSLA
FT                   TESGVIIRFRGTDLGCEGCIRITVGTPEENDVLIKEFTEKLQQLTED"
FT   CDS_pept        complement(262906..267492)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751237"
FT                   /locus_tag="AGOS_ADL248C"
FT                   /product="ADL248Cp"
FT                   /protein_id="AAS51672.2"
FT                   /db_xref="HOGENOM:HBG058558"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI0001DB29D9"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B25"
FT                   /transl_table=1
FT                   /translation="MSVREEFPTKTSEAYGFKPVFSRQLVTSFGENLPFVRYNCLAVSS
FT                   KHRLFAACGAAEVVIGSLEALRQWGESGDELELVARHAAQDVVGVGFCRDVVVYATRAG
FT                   ELWSREVGSTGQWSQRSVGAGTVGMHCVGAYALLLRASGEVLRVHVGNGQQESIALDVC
FT                   DFDARGSEVLYLERGFRLRMANVGGGEERRVELPDDMREEDTQPIAVRYLSREQALVVV
FT                   GEETPDDADEVVYAHKMYVVSLQSGDARESFDILPAFGSVKRNPAYYGCTLYNLASDGR
FT                   QLHVLASSCSSELTLLDDAEVLQPLQDADRAVLRINPDTDNDTSALGLALDVVTRMRVV
FT                   EPCAGVDAASELPLAYVLNNLGVLECWALYQSDALKAGKLSLDATLNELIREAESISSE
FT                   SPEEHIQDISQSPAEPTKSSTFNAISTKSDQPDAAASPENTNIISPSPKPAFGSGRVFG
FT                   TPAFGHQSMESIAPSGATMVPSHGTTFGQDTNSMQTDANPDKTEDQRHQWPSSTSHPFG
FT                   VPPPGTTSNNEPHSSKSNAVTGGNTGNAPENPSSGTSTFGKPAFGSVTTPGTIFGTPGF
FT                   ASAKTAVSAFGQPAFGGSAFGKPVFGEGSSAEPASGEEPGKSAFGESAFGKPAFGESAF
FT                   GKPAFGESAFGKPAFGESAFAKPAFGKPSFGESTATNPKSEESAFGKPAFGANAFGKPA
FT                   FGESPFNKSIPGSPFAKPFGAGLPASSSPFGNLSSTPFGKISSSPFGQLSASPEAKAVS
FT                   PFGKTAFSSSASPSTFGTPVFSAAQDTDQKTNKLEFGTGNSIDTSAPNSKITSPNSATQ
FT                   GAISSATVFPVGKATAAQHNQENFTPTPITKSHEGRKTSVSKDNADFIQNTPTKENPAL
FT                   SLLSLSGSLEQTVSTEGMQTAKEQLTDYSGATSEGITSEEEEDDDSSNELAASGGEDDS
FT                   GEDNEESHDVDEGSVVSPSIGNNKLEDSSGISATAKSENKAEISSMKSITERIKKAANL
FT                   PASSAIMNITSSPDATPDIKRVVSPFSDFTNKLNPPEANNGQAPFSFSALTKKEQESGT
FT                   RREGNPEHATLSDQDSSSAKGSSRRGSIIAKENRYSSSGGAPQSAQVQKPGTSITRPSD
FT                   VAISPQNSASLDSSNSLSDISSNRVSDDDQSSQPPSSDEGESESSEVPPSDPTHGSERQ
FT                   LSTITEESVDLPPSANVSPFATDNSVAYNSNRKMQVDSNVQTRPLQLAHKEVDAIPVTV
FT                   NTFCQAAPATADKELQTDSSPELDSAINAFEGDEQYLSEQYAPRRLEKFYTEAYLADIK
FT                   YTSKNPTTKAVEKTCHVINAELSTLRSNISNIGKFIDDQSKSPYPKSAESLCNVGGWRI
FT                   AEAAQLMDIVKRQQATFNDTFNAIKKLDTESQLDYSSLLKSEYMLKDYYLQLNCLNKES
FT                   DNVLRDLSLPQMKIRNSIRSKLVNLTSRIKELTNMIQMMKLYTVRGNNKNAAIVRKLMN
FT                   DSMERGSLLEEIQSLRQEVSRLAIANTPVDEVSGALSTRDIDSTAIVKETLTLNVKHQL
FT                   GEFFKSRI"
FT   CDS_pept        complement(267638..268813)
FT                   /codon_start=1
FT                   /gene_family="HOG000188277" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751238"
FT                   /locus_tag="AGOS_ADL247C"
FT                   /product="ADL247Cp"
FT                   /function="voltage-gated anion channel activity "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="AAS51673.2"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0008308"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG058559"
FT                   /db_xref="InterPro:IPR001925"
FT                   /db_xref="UniParc:UPI0001DB29DA"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B24"
FT                   /transl_table=1
FT                   /translation="MPRTEISMFSKPSRTPQPSSEAFNGIYLDGMTWQLLLSPGITVEL
FT                   FIFAETSRCLSLQHLSAVHHDKSARFQPRAAIGQKPTAAISPAPSINSASASIARRTRS
FT                   PHTVSIMAPPFFSDIAKDINGLLNRDFYHSTPAALDVKTSAPNGVGFTVKGKTSPKDGS
FT                   VAANVEARVADKATGLTLTQGWSSANVLDTKVELANLTPGLRSELVTSCVPGTSNAAKL
FT                   NLSFVQPAFTARGFFDLLKGPSFVGDLTLAHEGFVGGAEVGYDIAAATVSRYAVALGYR
FT                   TGLYSVALGVNNAQITTASFFQRVNPALEVGAKAALNPAAGSKVNIEFATRYALDLTAQ
FT                   VKAKIADSGLVALSYKQLLRPGVELGVGASFDALKLAEPVHKLGWSLSFSA"
FT   CDS_pept        268902..271415
FT                   /codon_start=1
FT                   /gene_family="HOG000144413" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928305"
FT                   /locus_tag="ADL246W"
FT                   /orf_name="AGOS_ADL246W"
FT                   /product="ADL246Wp"
FT                   /protein_id="AAS51674.1"
FT                   /db_xref="HOGENOM:HBG058560"
FT                   /db_xref="UniParc:UPI0000252983"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B23"
FT                   /transl_table=1
FT                   /translation="MGLEDGGRIIVEMETVDTQVQSLLPVQPADGGAARPELAGSRRSS
FT                   SLQLVEQEGAGDDEEKPRFAAALEPSHPPVISHNPLSPHASMTALRNKKSSLLIHSLPT
FT                   AVVNEDEGREHEGTPAGVAALAGGEGGMDGGGGEGSSLAPPAFTTRTLEHHHLDKPIAA
FT                   RLDEEARSIVNYIAVEDAVDQDSTRHSKEPSTKADFFAARLASAVGENEISDSEETFVY
FT                   ESTANSTKNSYEPISSNLVLTQSSLGKPYGIPAKLSTPMLTKNKKLLERLKTTRHSSIA
FT                   VMPSVISDHATAPQAGPAPHQPQQCASQQQQTSDDLKSIHSNRQRRAQYTQMGQSDIQS
FT                   VKSFNNQPMHSPGKRLSVLSLTKAVAEARQSRNTSNHSGKLRPTAHNNGNSGTLKMKNN
FT                   HLYPLRTTASRIFDANGASLRRYSGVPDNINLEDYVEQENGELTPNKFTYRSSSEIDSD
FT                   DDNVLNEDEGLSYVEEDEDDVQSMFYYHGNPQHAAGHTVNPNQVSSGNDNINHNSDKHS
FT                   ASMNNNNGSHVSLNRKYKSHYGALGKFSHLPHKLNYEQNERIGPDDDLEALYYFRNNSS
FT                   NGNAASNGGSKNAGGSSGNNNNHSKHFDFFFHPDELSPLKSKKRRSHTVYSGYYNPHNF
FT                   YTKRSTWNKFKSFVYLTFIVTSLLALGFISGFLLATNKELHDFQIKTIDNVLASADELV
FT                   FDIKASSFNPGFFTVGVQDVNLDIFAKTSHLDQTDADGDNRGAAFETVLLGTVYTLETP
FT                   LRFQGGFLSRNYGVSMSGVKLLHPGAADTAADADKWRALIRYEFDLIVRGNMKYSIPFF
FT                   KSEKSVVVQAQTSVDPNRADVRAPT"
FT   CDS_pept        272127..273437
FT                   /codon_start=1
FT                   /gene_family="HOG000066070" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751239"
FT                   /locus_tag="ADL245W"
FT                   /orf_name="AGOS_ADL245W"
FT                   /product="ADL245Wp"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /function="protein tyrosine/serine/threonine phosphatase
FT                   activity"
FT                   /biological_process="protein dephosphorylation "
FT                   /protein_id="AAS51675.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008138"
FT                   /db_xref="HOGENOM:HBG058561"
FT                   /db_xref="HOGENOM:HBG202697"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="UniParc:UPI0000252984"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B22"
FT                   /transl_table=1
FT                   /translation="MSGSLLDLKSRSPKSLQSKNRKKLSLKISNGSPGPKVMMLEPPAE
FT                   VAGRGDAQIYTLPALAPAPGQRGRGAEDKGGALKLTVETALRPRGEERIRFRPPPMLAR
FT                   GGVPAYLQDCEELGACTPVPADAPLTRSWVFRRGGAAGGCRVENAGCDGADEDDEGTLH
FT                   SALRYNDVLNGNAYPGEPLCVLVPGLFLYSEPTIEQVLQFDVVVNVAKEITDFTSQIPE
FT                   GSGTQYYHFKWSHTSKICSNLEELTALIHTALCDGKRVLVHCQCGVSRSASLIVAYIMR
FT                   YRSMPLNDAYNYLKNVAKDISPNMSLIFQLMEWGEQLKSKDGHSSCSPASCSLSSLASE
FT                   NLSEQPRSCRPRSAVGPKSAFSSPDISSDLSPENTPRTPMEFLNAPSLSQKYPQTAEQS
FT                   EPSKHDPLQLGSELCMKCSVVLDTFSQPSAEVVDKNW"
FT   CDS_pept        273826..277116
FT                   /codon_start=1
FT                   /gene_family="HOG000112933" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751240"
FT                   /locus_tag="AGOS_ADL244W"
FT                   /product="ADL244Wp"
FT                   /protein_id="AAS51676.2"
FT                   /db_xref="HOGENOM:HBG058562"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001DB29DB"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B21"
FT                   /transl_table=1
FT                   /translation="MSDQDKQDGTGQVKKRSLSSYLLNVSARKAELENLAKHEKDGPIS
FT                   ASIGDRNEAANAGGIDDSPNQQGSGGQQASEERPAMPAINAEELEGGTSQELLARGDKN
FT                   AKAVSEDVSVAAGALETQKPARWQECGGENGTVEKEQDDPREPHGTVMHAEGTAPGGAA
FT                   SVASDAVDDERAQQRSEVLDAVGPWVESQRIDSVTTAGWAKNDEQESSLSEIDSDAPTE
FT                   PASPPKPRLGRLVRGDQLGSAPSNAKWHTRPAAATHDSDSELSDLADLKPVPLSSSILH
FT                   GESSPTKAQSAVSSSPKKALPHPAHSTYSKSNSSSSKKMKHVAVSKIVKPRKGVYRDAG
FT                   GRTRLQVACDKGKYDLARKLIEEGYDVNDQDNAGNSPLHEAALNGHLEVVKLLIRHGAN
FT                   VNIQSYEMFKDTPLIDASANGHLDVVRELLQNGADPTIVNAKGLTAIESIEDDSDLDEE
FT                   EVQIVREIKALLRKSARKHKKEDGDVKSLPQRSKAKEGHSEEDESVQGSAAFDKDFYWT
FT                   DITSKLGKEKLFRASKEGRLAYVGAYLENGGHADFRSFMESVKFGHEDIASLFLAFGAQ
FT                   VNAVGRDGQTALMAAVGRGHLNTVKLLLEAGADPTKRDKDGHSVLYYARHSPLGLVDDK
FT                   ELTKLRDAILENNGVLSEEDKLCLDKDHGKTTPLNVKLEEQEALTQIKSSSNVKEKLPE
FT                   KPESPLHSTKANPTKERIGSSPTYHLSPKSEKTREQTPMRAHISEHEVVTDDEKGDYSS
FT                   VKVKKRRIGSPSAAAASDDRSYRPATSEKARTASPHKLKRSVSAVSISSDTAESGTKRS
FT                   KLEGLSSTHSQQQETPEERDARLKREEQYKLKRLESKRKKEQEFLQKLADDERKREEEK
FT                   ERAEQERRRQQEEERLRKTQQEQLLRDQQEIEKRIAIRDQYPLGLKLVDFQNHTDYNRY
FT                   LPVPYIVREGARYLLDLHAAVLCKNPEISRGATRAVPVAPENLPQLWNIYKFLFLYGGY
FT                   GPGHYLVDFSHLSLEEQLQLEHQEYLRFVRIPLHWLPYDDIPWPSSELRTAVDASMREL
FT                   QLLAPPHVAPAPLDLSRTPQSVPSAPTPAKFRHRPAIAVWLSGVTSLW"
FT   CDS_pept        join(277412,277525..277976)
FT                   /codon_start=1
FT                   /gene_family="HOG000175160" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079570"
FT                   /locus_tag="ADL243W"
FT                   /orf_name="AGOS_ADL243W"
FT                   /product="ADL243Wp"
FT                   /function="cytochrome-c oxidase activity"
FT                   /protein_id="AAS51677.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="HOGENOM:HBG058563"
FT                   /db_xref="HOGENOM:HBG395767"
FT                   /db_xref="InterPro:IPR004203"
FT                   /db_xref="UniParc:UPI0000252986"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B20"
FT                   /transl_table=1
FT                   /translation="MLRSSISRVVRVSPVRHAQTQAISKAAIADLHSRWEDLPAAEQND
FT                   IVAKLSERQKLPWKELTDTEKQAAWYISYGAWGPRRPVHGKGDAAFIAKGVALGVALTA
FT                   LCFGLVRMGAADAPKTMTKEWQLKSDEYLKSKNANPWGGYSQVQSK"
FT   CDS_pept        278360..279478
FT                   /codon_start=1
FT                   /gene_family="HOG000157349" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928306"
FT                   /locus_tag="ADL242W"
FT                   /orf_name="AGOS_ADL242W"
FT                   /product="ADL242Wp"
FT                   /protein_id="AAS51678.1"
FT                   /db_xref="HOGENOM:HBG057656"
FT                   /db_xref="HOGENOM:HBG395766"
FT                   /db_xref="UniParc:UPI0000252987"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B19"
FT                   /transl_table=1
FT                   /translation="MSFSFGFANAELSDDELLPNSFEVGNEGAQESSNKIGNPLDAEWL
FT                   KSTDIPQPTLVHLDKLLESLTNVRVSFEEVHTPQRAIKLFRRELFDVKHQLMSEVDAES
FT                   DSPDHKAELDILMGETNEDVRKNVYEGGLKSWECSLDLVDFLGLQDPKSSPCIAELGCG
FT                   TALPSQYLFLQYLQQESHLGLTLLLSDYNESVLRLATLPNLIITWAKQVLSQEQWAALQ
FT                   LSRDENIAIMQDELLLTQELLSAFRSDLEQKKIELYFISGTWSRGFLNLLKEIRWSPSS
FT                   ELLLLTSETIYQPETLPVIAELILDLISEARRGGYSARAYAAAKDIYFGVGGSVAEFEQ
FT                   YVTSKTLERSLPLQLTTHKVNAGLKRSIIAIE"
FT   CDS_pept        279620..280777
FT                   /codon_start=1
FT                   /gene_family="HOG000111881" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751241"
FT                   /locus_tag="ADL241W"
FT                   /orf_name="AGOS_ADL241W"
FT                   /product="ADL241Wp"
FT                   /protein_id="AAS51679.1"
FT                   /db_xref="HOGENOM:HBG058564"
FT                   /db_xref="HOGENOM:HBG202698"
FT                   /db_xref="InterPro:IPR019465"
FT                   /db_xref="UniParc:UPI0000252988"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B18"
FT                   /transl_table=1
FT                   /translation="MSDSAELQDFEVLLEDNFNHSQFARELIRAINNKFDTTKLDLYTP
FT                   LKQVNYDIVEVDKRIDRIIKDEPLKLLEQLDKRKLGREKVGTTLKPSLDYLTASFERLQ
FT                   TAVLEPYEDALKLQSALGKIHQTSHLLRDALIYMHMAAQVESLPLQVKDPSRVSHLSTL
FT                   FSQLRINLEQNPNLRSLQLIKKLEEGPLREKRGALLKYVLETLLGYCEDNHKLKHNLPE
FT                   VQKLLVTLYSLSPREFSAVLDKVALKKIQASHQALTKTITAVRTLNTVMEDVVSNGVAL
FT                   HHLEKTLEEIPLETTTLHAEYISRKKYSSITANYWIQVANAYKREFEISYRRGGPVGKS
FT                   LSNNAVFIRNTITESMKKGWNIDGLKEYQEALLASISILDNRRKT"
FT   CDS_pept        join(complement(281731..281753),complement(280857..281562))
FT                   /codon_start=1
FT                   /gene_family="HOG000247978" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928307"
FT                   /locus_tag="ADL240C"
FT                   /orf_name="AGOS_ADL240C"
FT                   /product="ADL240Cp"
FT                   /protein_id="AAS51680.1"
FT                   /db_xref="HOGENOM:HBG058565"
FT                   /db_xref="HOGENOM:HBG202700"
FT                   /db_xref="InterPro:IPR018555"
FT                   /db_xref="UniParc:UPI0000252989"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B17"
FT                   /transl_table=1
FT                   /translation="MIFFTSKSVSREEVFANCSDVSDGEASPVLPSIELEFFDAGPQEV
FT                   HAADDNQAKEDEFDFPLFSFGMASKVPDDPQNEDASNDNDEPRGRDSTTKLMKVTLRSP
FT                   SPEVINNQRPRTYYFAEYSAQELMRFQSAAIQYDQIITEASKDAACSRSLHRRRIFDLK
FT                   YHNDKIEAEIQRALKNKKRRPGKKQRLARKQGTIRNAEREAQAKEIKKMIKKKFHKRGG
FT                   KKNKKKDSVAADVKPKFRTE"
FT   CDS_pept        complement(281872..284547)
FT                   /codon_start=1
FT                   /gene_family="HOG000196365" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775315"
FT                   /gene_name="SEC24"
FT                   /locus_tag="ADL239C"
FT                   /product="Protein transport protein SEC24 "
FT                   /function="zinc ion binding"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="COPII vesicle coat"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="AAS51681.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030127"
FT                   /db_xref="HOGENOM:HBG353109"
FT                   /db_xref="HOGENOM:HBG746961"
FT                   /db_xref="HSSP:1M2V"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="UniParc:UPI000025298A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75B16"
FT                   /transl_table=1
FT                   /translation="MSGHKKRVYPEAQYQYGAQPAAPSQGFPPGPAMSPPMQAQQFLTP
FT                   AQQQLHQQIDQATSSMGNMNLHNVPVVDPSTFYQAGVASPPVAPHAVAGTQYNEQPYGH
FT                   MSIGKPMNQLYPIDLFQELPPPITDLSLPPPPLLVPAERIVVPSEEANASPDYLRCTLN
FT                   AIPKTNGLLKKSKLPLAMVIRPYLHLEDSIDPPPLNMDGCIVRCRRCRSYINPFVTFLE
FT                   GGRRWRCNFCNLANDVPQAFDMDMQGVPINRYDRNEIQRAVVEYLAPKEYAVRQPPPSC
FT                   YAFVFDVSQNAIKNGLLATAARTLLESLDSLPNYDERTRITILAVDHTIHYFSVPLDEE
FT                   GDHIRMMDVVDLDEPFLPMPDTMFVSLKDCRNNLEKLLSQIPDIFQSNILPKFALGPAL
FT                   KAAHNLIKGIGGKIIVVSATLPNIGIGKLNKRNEASVANTSKEASQLLSCGDSFYKNFT
FT                   IDCNKTQVTIDMFLASDDYVDFASVSNLGRYTGGQTHFYPGFTALNMIDVTKFSKEFSK
FT                   HITMDLSMEAVMRARGSTGLRMSRFYGHFFNRSSDLCAFPTFPRDQSYVFEISIDEQIV
FT                   RDYVYLQIAVLLSQNTGQRRIRVITVCIPTTDSLAEVYASADQLAMTVYHSQKAIEKVM
FT                   SSGFEDAREYLDRSVQEVLATYKKEIAMSNTAGGAPLRLCANLRMWPLLMHSLTKHMAF
FT                   RSGIIPADHRAAALNALESLPLPYFIKNIYPSVYSLHDMPDEAGLPNENGEIVLPQPIN
FT                   ATSSLFERYGLYLLDTGMDMFLWLGGDAVPELVMDVFGTQDIMQIQVGKGELPILENSE
FT                   FNERVRNVIVKLREHDDIITYPTLHIVRGASPSEPMNHASAREVASLRLWATSQLVEDK
FT                   VQSSFTYREFLQSMKTKTSK"
FT   CDS_pept        285308..287368
FT                   /codon_start=1
FT                   /gene_family="HOG000197526" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751242"
FT                   /locus_tag="AGOS_ADL238W"
FT                   /product="ADL238Wp"
FT                   /protein_id="AAS51682.2"
FT                   /db_xref="HOGENOM:HBG058566"
FT                   /db_xref="InterPro:IPR001229"
FT                   /db_xref="InterPro:IPR021917"
FT                   /db_xref="UniParc:UPI0001DB29DC"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B15"
FT                   /transl_table=1
FT                   /translation="MASIELFNLVDGYEVYSPALVIHGRCRSEKASSIQVHHPELPFLT
FT                   YQVHCQTFKALVHLVPGANVLTFTTDENEHITVTCTYAPQAEAPPIHLCILVAKDSPMV
FT                   FDSPAVQRQREGGCGMDLAIKKLRCGARLMQAFTNEQMLRNGFGHRCFQFAEEVTTDTL
FT                   FREPKERRTIKIHIVRSKLSTAEIRDPNLAQQNPNGSNTGGLFNVALEALQEYGGPFGD
FT                   SSQPVQAAVIFMDTHWDPQAKLITAHAALGGGAGHIRLAIFGSHGLYSWPPSLELVPYY
FT                   MSDPTPSSIMEVANDCNECGTHWECLTVTLGAFMHEIGHLLGCPHQEHGVMLRDYVTLN
FT                   RSFMTMEGYSSRTNSCGAPAPIRPAEECTWHRLDLLRFLYHPSFANPTNYSDPSFKGVG
FT                   VLSNFPFPRPTLYPCGNRQAVVSAQGGIYCIELISGDLARAHIEYLPLSLGGQGPQTDV
FT                   LLSLDDLRARIPQQHLVDCKGIFKVAVHAVNSESAEFDDFPSKIYAQEISMAPYGYPAL
FT                   VTGIKGTMLGNPEGGGDAGIISIFPREVEAVRVYHGYALDGIRFYFRSPQQINDDAAGS
FT                   HDYFRKLKNSLKGPSRNRSASALFGRETNNYSDFVLSPDESLLGFNVRSGCWIDAVQII
FT                   TSQGRTSPLFGNTSGGGLGTLVPPTGYEVLALHGRVGQWVDAMGIIYGNGG"
FT   CDS_pept        complement(287522..289792)
FT                   /codon_start=1
FT                   /gene_family="HOG000251753" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751243"
FT                   /locus_tag="ADL237C"
FT                   /orf_name="AGOS_ADL237C"
FT                   /product="ADL237Cp"
FT                   /function="6-phosphofructo-2-kinase activity"
FT                   /function="ATP binding"
FT                   /biological_process="fructose 2,6-bisphosphate metabolic
FT                   process"
FT                   /protein_id="AAS51683.1"
FT                   /db_xref="GO:0003873"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006003"
FT                   /db_xref="HOGENOM:HBG058567"
FT                   /db_xref="HOGENOM:HBG395770"
FT                   /db_xref="HSSP:1K6M"
FT                   /db_xref="InterPro:IPR003094"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR013079"
FT                   /db_xref="InterPro:IPR016260"
FT                   /db_xref="UniParc:UPI000025298C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B14"
FT                   /transl_table=1
FT                   /translation="MFKSVTYSEDKHLTDTDSEVEPHDTSKHRGRRHGAAGSGEESKHV
FT                   RLDVEGVPGLVQPEDAEEPGELPAFKRRPLSDTPLASQWASPTSSGESSTESTPVLSPS
FT                   HSSGDLQGLDNKTEARASGNGGLPRVRRKAPTTMDVPGLTRSKTSPDGMISKHDPGSKL
FT                   VVVMVGLPATGKSFITNKLSRFLNYSFYYCKVFNVGNTRREYGKQHELMEQDSRFFDPS
FT                   NDEAKALREKWAMDTLNELLDYLLDGPGSVAIFDATNSTQERRRKIYDKIKSRNSQLNV
FT                   LFLESICSDRQTVEKNIRLKLLGPDYKGKDPELSLRDFKDRLANYVRAYEAVEDSEGFQ
FT                   YIKMIDVGKKVISYNIQGFLASQTVYYLLNFNLAERQIWITRNGESEYNVLGRIGGDSK
FT                   LTPRGRKYARALAQFIDSKRREFNEHEYEQFCKLNDEGTPTDEFVPTSFYVWTSMLRRA
FT                   EDTAADFNEDIFPIKQMRMLDELSAGDCEGMTYEEIHQKYPEEFEERLIDKLRYRYRGI
FT                   GGESYMDVINRLRPVITELERITDNVLIITHRVVARVLLGYFLNLSRDIIANLDVPLHS
FT                   VYCLEPKPYGITWSLYEYCDETDTFSKVPQTQLNTMKVKEVGLVHNERRYSLVPAAPPT
FT                   NNSDDIPLQSRNSSGISLPPYSSSSSSTTPSISSGGISVTSRMVPPLRQPPAYQTHPSF
FT                   LARSKSDDPLTKRLLNPNKHSIELQKLHEKLSVLRANDHISSGDDEDNDNNDINGSEIG
FT                   GTP"
FT   CDS_pept        join(290422..290441,290494..291364)
FT                   /codon_start=1
FT                   /gene_family="HOG000164685" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751244"
FT                   /locus_tag="ADL236W"
FT                   /orf_name="AGOS_ADL236W"
FT                   /product="ADL236Wp"
FT                   /protein_id="AAS51684.1"
FT                   /db_xref="HOGENOM:HBG058568"
FT                   /db_xref="HOGENOM:HBG737456"
FT                   /db_xref="InterPro:IPR005301"
FT                   /db_xref="UniParc:UPI000025298D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B13"
FT                   /transl_table=1
FT                   /translation="MSFLQNFHLSPGQTIRSTRGFKWNTAKQQDGGGYGAGSGHLTAGG
FT                   GTGTLLGAHAITSTAVEASPGGLFTTPQKPTMSQPITDFNYTPSHQKPYIVQSPGTVVT
FT                   SHKDIKQIVETTLGSEGVLNQAVKLPKGENLDEWIAVHCVDFYNQINMLYGSITEFCSP
FT                   QTCPRMIATNEYEYLWNVYPGNPPVSVAAPKYVEYLMNWCQQQFDNEDLFPAKTNVPLK
FT                   NGFNDKIAKPILKRLFRVYAHIYCHHFNEILELNLQTVLNTSFRHFCLFSEEFHMLKPS
FT                   DYGPLLELVEEFKDR"
FT   CDS_pept        291551..293299
FT                   /codon_start=1
FT                   /gene_family="HOG000209670" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775316"
FT                   /gene_name="ALG11"
FT                   /locus_tag="ADL235W"
FT                   /product="Alpha-1,2-mannosyltransferase ALG11 "
FT                   /EC_number="2.4.1.-"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="biosynthetic process"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS51685.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG058569"
FT                   /db_xref="HOGENOM:HBG525304"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniParc:UPI000025298E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75B12"
FT                   /transl_table=1
FT                   /translation="MESCWLTMESYQAALVVCIVSGLILAVAGYGNVRRLACEFLLKPP
FT                   KRFRDDICEALLRGPENDQKPVLVDFGWRHGAVRRQMLLASAKASAYSNERHGSKIHIS
FT                   PDDIARGRSFADALDVHRRSGRILFGFFHPFCNAGGGGEKVLWKAVETTLKQSLNNIVV
FT                   VYTGDCDTTGARILSNVEHRFGSQLDSERIVFIFLRHRKWVESRTWPRMTLLGQALGSI
FT                   VLSIEAALCCPPDVWCDTMGYPFGYPFVSWLCRIPIITYTHYPVVSIDMLDKLRMMPEF
FT                   RNSPTLWAKFLYWRIFMRCYTFAGSFVDLAVTNSTWTYNHINAIWSRTGNVSIIYPPCS
FT                   TENLVIENAHDMWDRKHQAVVIAQFRPEKRHALILRSFSNFVKKTGSNMKLLMLGSTRG
FT                   QEDRDYVKKLEQLAYSELAIPKESLEFITDCKYEKMKKYLQESSFGINAMWNEHFGIAV
FT                   VEYAASGLITLAHASAGPLLDIIVPWDIEGDKQLERGSDKNRTGFFFKDRSDPDFCKIT
FT                   AEFPTLEELFVRADQLTDEERLAISQRAKRCVLHKFSDLKFSEDWAQVVDRTIQLLHTL
FT                   RNDKVE"
FT   CDS_pept        complement(293563..295773)
FT                   /codon_start=1
FT                   /gene_family="HOG000066129" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775317"
FT                   /locus_tag="ADL234C"
FT                   /orf_name="AGOS_ADL234C"
FT                   /product="ADL234Cp"
FT                   /protein_id="AAS51686.1"
FT                   /db_xref="HOGENOM:HBG124790"
FT                   /db_xref="HOGENOM:HBG203048"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI000025298F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B11"
FT                   /transl_table=1
FT                   /translation="MPPAGPARRVNASWAQFRTVTNIRAPRNTTPQLLLPLPQSRLAAP
FT                   APGAAATDPAVGPPQARQSCTRRNPGRALIKGGAYGRRVRTRGLRWRRRAAIVCRGEQK
FT                   NWRAGAQESENTVLDQDKTQSNLTWTGHTGWAMSYNNTMTSNGTEMRSPVYLGPEQAAG
FT                   RPAAAKAVDTVLQEGFGAGQGVVQGTVNSQTLESLRQHTRNASTFSSTSAGLGRTRASL
FT                   QRQRAGQTDPRSPLVTLMPVNANPTEVLAGRFASWRAVIKAIIVYLTETASIQDELVRQ
FT                   HLRLSHAVSFPFFSVENVRQPSTPEEKAIQQFFLPLGSGSIQDLPTILTGYHAQMASMA
FT                   SKASKELTNEVIPRLEDMRRDLLVKIKEIKSLQSDFKNSCAKEVSETKQMLRTFHESVE
FT                   QARYGTPKSDPYLTRILLDKQLKRQLAEENFLHQAFNNLQASGKELEKVVVMEIQSALT
FT                   VYARILGREAQLVFDSVITKLDMGFLSRDPVFEWDDFIARDPNFVEPSVPMRSLKDITY
FT                   KHQYDPLTYKLQCGFLERRSKFLKSYSRGFYVLTPSFLHEFKTCDRKKDVSPVMSLSLS
FT                   DCTVAEHSKRDSSDFKFILHAKQNGIIHRGHNWVFRVDSYDTMMEWFNNIKKLTSISNP
FT                   TEKAKWITEHLNLDVNGRPKRHSLLRDNQSTTTTRTSSNLDSPNNAVQYMPNYDGHTNT
FT                   NTTLSSPGTSYILESPGGATIQIPLSNKKEANNSLLPPKPVS"
FT   CDS_pept        296204..298075
FT                   /codon_start=1
FT                   /gene_family="HOG000293296" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18928308"
FT                   /locus_tag="ADL233W"
FT                   /orf_name="AGOS_ADL233W"
FT                   /product="Leukotriene A-4 hydrolase "
FT                   /EC_number="3.3.2.6"
FT                   /function="leukotriene-A4 hydrolase activity"
FT                   /function="metallopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="leukotriene biosynthetic process "
FT                   /biological_process="proteolysis"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51687.2"
FT                   /db_xref="GO:0004463"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008237"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0019370"
FT                   /db_xref="HOGENOM:HBG134045"
FT                   /db_xref="HOGENOM:HBG444814"
FT                   /db_xref="HSSP:1HS6"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR015211"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001DB29F5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75B10"
FT                   /transl_table=1
FT                   /translation="MKLPAVLEERRAAATDRSTLSNYEDFAVRHTNLELEVAFDERQIR
FT                   AEVCYDLEQTGKGVAEVHLDTSYVQLECILVDGKRVPWELRERQEPLGSQLVITPEGGL
FT                   PARFQLTCRSVTTARSTAVQWLGGAQTAGKPYVYTQLESVHARSLVPCFDTPACKSPFT
FT                   VRVRSPLRAVVAGQEQPGSGKDGVYVFEQPVPIPIYLLGLAAGDIACAPLGPRSNVYCE
FT                   PALLEAAAGEFGGEIERFLDAAEELLPRYIWGNYNLLVCPSSYPYGGMEVAGTSFISPS
FT                   VIAYDRSNNDLIVHEMAHSWSGNLITNANWGHFWLNEGWTVYLERRITGALHGEDTRQF
FT                   SSLLGMAELEVAIRASNGASFALVEDVSESVNPDNVVSLAAYEKGSALLLHLERELGGT
FT                   AAFDPFIKHYFGKFGGQSLTTWQFLDILFDFFADKREKLERIDWKTWLFAPGMPPKLTY
FT                   STSLADDVYDLAEQWLEKAVQLRLPEEFAAEFSGSVLAAFTTAQQILFLNTIIQGGVSP
FT                   DNTFDWTQHPVAAAALLSVYADTLGKSRNQEIIYRRYNFQLTAGMEDAYPEITTWLGST
FT                   GRMKHVRPIYRRLASIDKALAASTFQEHREKYHPICRAAIQADLGLS"
FT   CDS_pept        join(298270..298293,298346..298852)
FT                   /codon_start=1
FT                   /gene_family="HOG000181878" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751245"
FT                   /locus_tag="ADL232W"
FT                   /orf_name="AGOS_ADL232W"
FT                   /product="ADL232Wp"
FT                   /protein_id="AAS51688.1"
FT                   /db_xref="HOGENOM:HBG056405"
FT                   /db_xref="HOGENOM:HBG738032"
FT                   /db_xref="InterPro:IPR004895"
FT                   /db_xref="UniParc:UPI0000252991"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B09"
FT                   /transl_table=1
FT                   /translation="MNYLSNISQASRLADSINVDRIKTELGSIPSRLSTMRPPREFFNV
FT                   RRFSKPQNFGEVQSRVGYNLRYYSTNYTAIVILLFIYTLLTNLLLFFVIVFVVAGFTGI
FT                   NRLQGADLSTPFGPITTSQLYTGLIGIATVLGIFASPFSTLMWLVGISAVTIFSHASFL
FT                   EKPIETVFEEETV"
FT   CDS_pept        299206..300303
FT                   /codon_start=1
FT                   /gene_family="HOG000095251" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751246"
FT                   /locus_tag="AGOS_ADL231W"
FT                   /product="ADL231Wp"
FT                   /protein_id="AAS51689.2"
FT                   /db_xref="HOGENOM:HBG058570"
FT                   /db_xref="InterPro:IPR021216"
FT                   /db_xref="UniParc:UPI0001DB29F6"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B08"
FT                   /transl_table=1
FT                   /translation="MHDALSRDTAAEESQEISRKSSVSSQKEAVPAISSLLGPQVANWP
FT                   YSETSLIHALELKVEQEKTKQQYYKLENVNRSIDLVKTALEAQVPGHFIPLLFKYMVNE
FT                   DAKHDVLGEIGNWGPAGPTRNAAGAMPVAEARTKAPVGYRFPPETHILAPEEGTPVRAV
FT                   ARSPTVKNERRKTRSPARSSTADDRDRALSKLAQDNEGERKLRSAFLAPAPLHGSRGHR
FT                   RNISLPSLQLYHRQTPLQQATGSPEKKPLRTVLNFGSWQSYNPHLQKTISSQQGVRKHR
FT                   RARSASTFGVIDLNQAPQSRPTDADTRSRRSTRPQSPRSTPESGKPPASNTYDLECENF
FT                   NLPSEPGTHETPMRKPNFANDLLNS"
FT   CDS_pept        complement(300366..301826)
FT                   /codon_start=1
FT                   /gene_family="HOG000248098" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928309"
FT                   /locus_tag="ADL230C"
FT                   /orf_name="AGOS_ADL230C"
FT                   /product="ADL230Cp"
FT                   /protein_id="AAS51690.1"
FT                   /db_xref="HOGENOM:HBG356266"
FT                   /db_xref="HOGENOM:HBG396305"
FT                   /db_xref="InterPro:IPR007009"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="UniParc:UPI0000252993"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B07"
FT                   /transl_table=1
FT                   /translation="MLTPKFKLTQDEEYIYVDISISSIRFNASGLELVVDDTLFVFHLS
FT                   PYYLRLRFPHALVDDERCKAEYKAADESIFIKIPKLNKGEVFEDLDLPTKLLARHGEVL
FT                   AADAVAQAQDSGPRGPLIQEISSTETQPDKSTEDTLASGEEFNWEIKQVPHVEGVSALQ
FT                   TRYGFDNQYDSVIGVSISNGNDINELDDPEHTGPNERVLERIRKENLKFDPEYYISEYM
FT                   TCKYGSGEDLDINGIKSLLQYVPPFPKMYLKWYKHAEDKSASFPVEFSPKEDELMRNEL
FT                   PKKSYLIQDTTQLYVAILSLLFAHTFEQVENEGIHNTESAWTIGKLTPQIACLDLQLLP
FT                   GEVIQEFPVVRAAVVAGTRRALAYPLHRNFDLVCKCWNYVYYLLRAGKRLILRALLDIY
FT                   ELYRLHEVYYVYNKVFLGDLCSWFVSNGNENVTRSLAFELKKELGTLTKTAIDFDCLTG
FT                   CDESGELTSENLTLAEMELLAEAEYQQT"
FT   CDS_pept        301968..303248
FT                   /codon_start=1
FT                   /gene_family="HOG000164743" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18928310"
FT                   /gene_name="DPH1"
FT                   /locus_tag="ADL229W"
FT                   /product="Diphthamide biosynthesis protein 1 "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS51691.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG024106"
FT                   /db_xref="HOGENOM:HBG435469"
FT                   /db_xref="InterPro:IPR002728"
FT                   /db_xref="InterPro:IPR016435"
FT                   /db_xref="UniParc:UPI0000252994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AZ9"
FT                   /transl_table=1
FT                   /translation="MSTADEVTKKPRRRFVGVSRGENKVSTKQVSGDEAKELVRSAKSN
FT                   TGARRAINQIPDEILNDENLQEAIKLLPSNYNFEIHKTVWNIRKHNAKRVALQMPEGLL
FT                   IYSLVISDILEQFCNCETVVMGDVSYGACCIDDFTARALGCDFIVHYAHSCLVPVDVTS
FT                   IKILYVFVTIGIDEDHLMKTLQKNFAKGTSLAVFGTIQFNPAIHSIREKLLYSESHMLY
FT                   ITPPQIKPLSKGEVLGCTSQRLPKEQFAAMVYVGDGRFHLESAMIHNPDIPAFRYDPYS
FT                   RKFTRETYDQHQLVEVRSSAIEKARNSQCFGLILGALGRQGNLATVANLEKKLRAAGKK
FT                   VVRIILSEIFPQKLAMFDHIDAFVQVACPRLSIDWGYAFNKPLLTPYETNVMLGQDRMF
FT                   NEKYYPMDYYEVNGYGRGKQPTHDNVI"
FT   CDS_pept        complement(303288..305708)
FT                   /codon_start=1
FT                   /gene_family="HOG000111882" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775318"
FT                   /gene_name="COG6"
FT                   /locus_tag="ADL228C"
FT                   /product="Conserved oligomeric Golgi complex subunit 6 "
FT                   /biological_process="protein transport"
FT                   /cellular_component="Golgi membrane"
FT                   /protein_id="AAS51692.2"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG058571"
FT                   /db_xref="HOGENOM:HBG202704"
FT                   /db_xref="InterPro:IPR010490"
FT                   /db_xref="UniParc:UPI0001DB29F7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AZ8"
FT                   /transl_table=1
FT                   /translation="MDFLDYQAYGVPLTGTDDELLPEPASNLSLLAASGPSVSELNTSI
FT                   QGDSTPPLLNTDSNFNFEGKDNLHERMEMYSELTVKLLPIQPGLVRDIFEDVTPQSSDF
FT                   QHLLKKGNNVTSAVLVKRLSHVLNDMNHPNYQSDLQLKKALMILQDNQGVLGLDGSKLV
FT                   RPDFLGSLSRKTLRSQLEKELLKDHLATLENFQPIARRIMRLRQPVKNIQEISEKVLDA
FT                   QEAQNKSPLQDPLVSEVREKLEMLKLKKRVLVGIRESLTLNQLEDEQLRNGEIEDSYLD
FT                   VLDKMMEIKERSTYLIAMNYEKAGKALLGNINQYLQLANKRIYNYLLGFLYDYESNTKT
FT                   FGERNFEGDNVGLSLFQRCLVYLSNDLEYFNDFMKKVTSMRSKKLLDEFLIPFVIDNNE
FT                   GRSIILSAHDPARYLGDVLAHVHSLLANEGDFLKSLFKYQEERMADMTQSIFQKNKDIL
FT                   QSLHVNMLNDIMSTLSNSVRIRLEQIVRFEEEATVTFDISQLLSLYKLMFTKQGMLDDN
FT                   KLVKVFDDLAVLAKTKTMNYYTEFLSEAVKEEPEVTDLLPPKWLSKYLSDLTALFDKIN
FT                   GSSEQTGIVDKNFFTKLVKTPCESTFLKQAELCFPLAKKDRRVKFDLLVLEINGLDMIV
FT                   SRLGPYRTNIFSDEYGSEVYDSLKRSLDTLLGQLEVHQTRNILESTGLELYYNLFNMIF
FT                   PVASVQDPLDYDMYLSAQENQIMKLETIETNIAQKLSDYLPKALLDVQDTWLLYLASPK
FT                   FADDIASRSFHVFANFYVVFKSVLLNIFPDDHQRINSIFIYSEEEVKMLLGIN"
FT   CDS_pept        complement(306217..308226)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751247"
FT                   /locus_tag="ADL227C"
FT                   /orf_name="AGOS_ADL227C"
FT                   /product="ADL227Cp"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="AAS51693.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG058572"
FT                   /db_xref="InterPro:IPR003163"
FT                   /db_xref="UniParc:UPI0000252996"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AZ7"
FT                   /transl_table=1
FT                   /translation="MARQVNYPCTALERAGRVELTGHAVDDYQRCFFLQLGRQEGGGLL
FT                   ERANRAMSVRTASYRTNSAVQFYDVGAPDAARLAGAAGARKERRTLECFEYQIPDITQG
FT                   GEAGDGRGWDGLAVEAGSVIKVLEPRGAAAPDISFLTKNQQFKLHKMHYSEQAGHVINP
FT                   NNVILWDYKTGYVFFTGIWRLYQDVMRGMCNLPRVGTRGEEENSQQRQWQCYKELEYSL
FT                   KACLYEPYGSKVRPEAGHRRQRLSSSRTPHTSASNCSSASINTHTSSAVASGSSYTDVH
FT                   WNQVDPTWKQRLCRLYQQEKNLDFTPEFQDCYKRIRGGYIKIQGTWLPMEICKRLCIRF
FT                   CFPIRYFLVPIFGEGFLQECHNWYFTHRLKQDLCSSTLSPPIADVALAAVETSYTLVTG
FT                   KAMDYASISPRSTSIPQTVLPTVKQESSDTELLDASQNLLDISRRTSLQSDHYVSPNTP
FT                   PSMLAAPTYSRAFVRQGSERYSLDLNPSCQLKGAHRDGRPVAGYKERSCSWSSSTSPLG
FT                   SVQRQESLPPISTLINSLPNFNLEAAEMPNSLALEYKKERQELQASFSSYPRTNYPSQL
FT                   PLNHICSNFNGGKAPDSLQKPTAYHSFSHLLGMQEQSAHSPDTPQLRARKIPTDAPAGV
FT                   GYSSVAPDWATLCAASEALCSYTEGVSIGYNERA"
FT   CDS_pept        complement(309113..309742)
FT                   /codon_start=1
FT                   /gene_family="HOG000125184" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079571"
FT                   /locus_tag="ADL226C"
FT                   /orf_name="AGOS_ADL226C"
FT                   /product="ADL226Cp"
FT                   /function="carbonate dehydratase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="carbon utilization"
FT                   /protein_id="AAS51694.1"
FT                   /db_xref="GO:0004089"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0015976"
FT                   /db_xref="HOGENOM:HBG189808"
FT                   /db_xref="HOGENOM:HBG711150"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="UniParc:UPI0000252997"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AZ6"
FT                   /transl_table=1
FT                   /translation="MTQGPLFSLSPASTLDDLLEANQRWRRQQEQRKPALFRSHAAGQT
FT                   PHTLFLACCDSRYSEACLGVEPGEAFTYRTIANIMDPADPGFRAALEFALHVLQVSRIV
FT                   LCGHTNCGGVSTCLTGTRRALATPQCSSLHAHLDSLDALCSANKPALASLPPAVQAEQL
FT                   VIANVRAQYRALSQDAAVRAAVQQRHLTLHALLYHVDTGALTVVAP"
FT   CDS_pept        310366..312186
FT                   /codon_start=1
FT                   /gene_family="HOG000182646" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751248"
FT                   /locus_tag="AGOS_ADL225W"
FT                   /product="ADL225Wp"
FT                   /function="glucan 1,4-alpha-glucosidase activity "
FT                   /biological_process="polysaccharide metabolic process "
FT                   /protein_id="AAS51695.2"
FT                   /db_xref="GO:0004339"
FT                   /db_xref="GO:0005976"
FT                   /db_xref="HOGENOM:HBG058573"
FT                   /db_xref="InterPro:IPR000165"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniParc:UPI0001DB29F8"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AZ5"
FT                   /transl_table=1
FT                   /translation="MDKIQTTYTGRRSRSQWVRSPWTLTVVSLAIIWFFHDAFLSFGAA
FT                   NAGSGGETAAAAIWDFFRSAETVTVVDFNNRAAAPAGSLQRRLRLRDITPGTISRGDFG
FT                   KWVQEEAVISKERLLANIADMNLNNNLHSALGVAEGAPLASPSRVRPNYFYQWVRDGAI
FT                   TINTITNTILDHPGDFNITLAGTVIKYLKNVYVLQRLDNPSGRFDEDLSGLGEPKFMVD
FT                   NTAFNSPWGRPQNDGPALRAITTMNFLQRLNSQGMSLEYVLKRYRLEYGQESLEVPFQN
FT                   EQELFDKVLYYDLMFIIKNWEKEGFDLWEEVVGIHFFTALCQLKALKMAEYLLTKGVLH
FT                   PDEALLSILRETIGRMTTYISRDGGFINPHINFIVSTPRLLGQRSGLDIGTLIGSILTH
FT                   DELGSDDVPAVAIPFNVDHPAILNVLYELTTRMLKLYPINHDRVNLNMGVGLGRYPEDV
FT                   YNGYDTSEGNPWFLATSTAAELLYKLIYRHHIASQDLVVDLDGDNWQSAFWNLIFDGLR
FT                   PTSNGGSSTLVIPYGSQAFNQTMGAVFNYADSFLDKIRLHVSDCGEMSEQFNKYTGFLE
FT                   GARDLSWSYGSFLNSLRWRSAAYQLLSSQE"
FT   CDS_pept        complement(312332..312829)
FT                   /codon_start=1
FT                   /gene_family="HOG000000963" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751249"
FT                   /locus_tag="ADL224C"
FT                   /orf_name="AGOS_ADL224C"
FT                   /product="ADL224Cp"
FT                   /protein_id="AAS51696.1"
FT                   /db_xref="HOGENOM:HBG190436"
FT                   /db_xref="HOGENOM:HBG395736"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="UniParc:UPI0000252999"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AZ4"
FT                   /transl_table=1
FT                   /translation="MSAYTSLVSGYRGLLRTLVRCGRRSRLEQAQQDAKKQIAVHTYRR
FT                   MQLVREQQQVADPAERARINAQLAALAKNVQALKAAETGRSHELLFYPRAAELRALLLA
FT                   PAEGPALERRAEHLAEVSGFVVNQHQYAELVERYNPGLRMSQEEKVKRTAAKVGLRVPD
FT                   AE"
FT   CDS_pept        313343..314431
FT                   /codon_start=1
FT                   /gene_family="HOG000021113" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079572"
FT                   /locus_tag="ADL223W"
FT                   /orf_name="AGOS_ADL223W"
FT                   /product="ADL223Wp"
FT                   /function="NAD+ or NADH binding"
FT                   /function="isocitrate dehydrogenase (NAD+) activity "
FT                   /function="magnesium ion binding"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="AAS51697.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004449"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="HOGENOM:HBG435977"
FT                   /db_xref="HOGENOM:HBG518924"
FT                   /db_xref="HSSP:1A05"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="InterPro:IPR004434"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="UniParc:UPI000025299A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AZ3"
FT                   /transl_table=1
FT                   /translation="MFRNTLSHITKRGYAAGREQLLPKKYGGRYTVTLIPGDGIGKEVT
FT                   DSVVQIFEAENVPVDWESVELSALEENHEGVQKAVESLKRNKVGLKGIWHTPADQTGHG
FT                   SLNVAFRKQLDIFANVALFKSFPGVKTKLQDVDLVIIRENTEGEYSGLEHESVPGVVES
FT                   LKIMTKAKSERIARFAFDFALKNNRKAVCAVHKANIMKLGDGLFRNTVSEIGAKEYPEV
FT                   NVSSIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANFGREYAV
FT                   FEPGCRHVGLDIKGQDVANPTAMILSSTLMLRHLGLNEYADRISRATYETIAEGKRTTK
FT                   DIGGTATTTEFTNAVIDKLATL"
FT   CDS_pept        314729..316279
FT                   /codon_start=1
FT                   /gene_family="HOG000000964" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18928311"
FT                   /gene_name="FYV10"
FT                   /locus_tag="ADL222W"
FT                   /product="Protein FYV10"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51698.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG058574"
FT                   /db_xref="HOGENOM:HBG203053"
FT                   /db_xref="InterPro:IPR006595"
FT                   /db_xref="UniParc:UPI000025299B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AZ2"
FT                   /transl_table=1
FT                   /translation="MSVMNEPTVDFHLKLNEQQFHIPNELLKRNLKQCQKLIDKEATAL
FT                   EKSFEELDRLVRNPQNDESSMALLNEIIQKVERLERKLTKRVNVELQLLQRIDARIKYY
FT                   QQLDQIKQSGDRNRLLEWYQSYTNLLISDYLTRNSMYEGEDDISCSSTPPPARLKRKLS
FT                   SASSQLTTATSNNDPDRSHVNPGVEYLKQQGLDLLLDYDILLTTNRISKQLTINHELGP
FT                   LLDWIKENATYLKHTSSMLEFEARFQEYIEYVKVEDYSKAITCFQTHLVKFLYSNPLDL
FT                   QQAAGLLVFIKACKSNISSYVPTPRHEEIVKQQTLLQSKEDFWSFFFLKLPKSSKKDHK
FT                   TNIEVKNNELAASVDIKRYMELLDDRRWEKLNEMFLKAYYSMYGISYHDPLLIYLSLGI
FT                   SSLKTKDCLHERRAFVSPNNELSEFLSSEVLRNACPVCSPEFAPIAQKLPYAHQVQSRL
FT                   FENPVMLPSGNVYDAEKLKALAQTLRKRKLVVMGEDEVLDPIAGHTYALTDFITMYPT"
FT   CDS_pept        complement(316328..317284)
FT                   /codon_start=1
FT                   /gene_family="HOG000000965" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751250"
FT                   /locus_tag="ADL221C"
FT                   /orf_name="AGOS_ADL221C"
FT                   /product="ADL221Cp"
FT                   /protein_id="AAS51699.1"
FT                   /db_xref="HOGENOM:HBG058576"
FT                   /db_xref="HOGENOM:HBG396782"
FT                   /db_xref="InterPro:IPR019446"
FT                   /db_xref="UniParc:UPI000025299C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AZ1"
FT                   /transl_table=1
FT                   /translation="MARKLKGKASAKGLKGALARYQESEQTKAKVKRKLEHESSKGKSS
FT                   KQVNRNRKLQQEHEKKFVPFLPDSTLLLVGEGDFSFAKSILDCGYIKAENLIITSYDSG
FT                   VKELELKYPKSFRENYDYLVSESVRIFFNIDATKLVSSFKLSKKNPWQKVMGPEWKAKP
FT                   LENVLFNFPHTGHGIKDQDRNIREHQELLFGYFDSCKQLFKLANKKVGDDHLSGYEVGK
FT                   EQSSDDMGRIILSLFAGDPYDSWQPKVLAKENGLKLERSHKFQWDTFPGYRHRRTNNEQ
FT                   DTTKPAAEREARIFIFEKNDGKRHNQSKRRSNDSDSE"
FT   CDS_pept        complement(317449..317940)
FT                   /codon_start=1
FT                   /gene_family="HOG000144412" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928312"
FT                   /locus_tag="ADL220C"
FT                   /orf_name="AGOS_ADL220C"
FT                   /product="ADL220Cp"
FT                   /protein_id="AAS51700.1"
FT                   /db_xref="HOGENOM:HBG058577"
FT                   /db_xref="InterPro:IPR019328"
FT                   /db_xref="UniParc:UPI000025299D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AZ0"
FT                   /transl_table=1
FT                   /translation="MVLDIYKDSAGFYVRFDVKPARFYTQWFVRLLFWTGLQALGYFAL
FT                   QRLRANSFLLLQNIALGLLTLLLIRAPTIDSLYVFKSYGIQLSTTQGCLLLPEFLNERL
FT                   FEVKTFIPSDDLVAMVINEGFEGLAVVFYMCIIAKRSRQLKIVFPVCSVVEQYMLNASY
FT                   "
FT   CDS_pept        complement(318182..319870)
FT                   /codon_start=1
FT                   /gene_family="HOG000066069" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751251"
FT                   /locus_tag="ADL219C"
FT                   /orf_name="AGOS_ADL219C"
FT                   /product="ADL219Cp"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51701.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG190563"
FT                   /db_xref="HOGENOM:HBG202705"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017174"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="UniParc:UPI000025299E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AY9"
FT                   /transl_table=1
FT                   /translation="MSSIVNKSGTRFTPKVRQRRPASAAPTQPHSTTTSAGKPSEPQPT
FT                   RADTSEEGGDGDEPAGPKDPSLVEDDDPLSHTQLTKDLKASQMSTQLPVATMSPQPEAH
FT                   GRSSRLDSLSHQVSVFKSGFLEQPGAPIPVSDAQRSRRLSTMSNLQTKKQRPPAIPEAD
FT                   VSLQAIKKRRMSARSSTSRKSGSAQRISVVPRAAASESYVVPPAGAPLKKESADDLFQT
FT                   TASFYERYTISTLKEIPKNIADEDSARYTVNEDSITMADLCKPLFPIGEVSDNFHRAKE
FT                   AAKAKMEARKKRRELRQMAKRQFKPLSELSAEEQEKLKQERKNAAEALLNAEIPDEMPQ
FT                   QTIQLKLQSDGKLGIDEESTVVDRHKNASYGNAHKERLDSNPFENLCNSSTYGRQKYTD
FT                   PWTTDELIRFYQALSMWGTDFNLIAQLFPYRTRRQIKAKFVNEERKHPVVIELALKSKL
FT                   PPDFEQYCKTIKKEIGTIEEFNNKLEQLQVEHEQYLKQIEIEKQNAREQDLQHQTSKEK
FT                   ERGSEKRFSSRQEQLKAYRKSEIVLGTIDDVKRKRAEELEAAAEQ"
FT   CDS_pept        complement(320124..321335)
FT                   /codon_start=1
FT                   /gene_family="HOG000204857" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622763"
FT                   /locus_tag="ADL218C"
FT                   /orf_name="AGOS_ADL218C"
FT                   /product="ADL218Cp"
FT                   /protein_id="AAS51702.1"
FT                   /db_xref="HOGENOM:HBG397845"
FT                   /db_xref="HOGENOM:HBG436204"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000025299F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AY8"
FT                   /transl_table=1
FT                   /translation="MSYILQQKVSFGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATG
FT                   KSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPA
FT                   LSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLL
FT                   LSGSTDGYVNVYDLKQSEEDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELND
FT                   KSEHANEPQPQLFGDVREPWACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAAN
FT                   AIVLPQAHGDEVVRDVLVPASSPELLYSAGEDGNMAIWKSTLGPLNVPVDFWDYSKKET
FT                   VLEDLPSSGLDDTHSAQHNDQASSLSGQSQPEQQEYRQVQSDGMRRNRSSKHSKKHSAR
FT                   FTPY"
FT   tRNA            complement(321428..321501)
FT                   /gene_name="tRNA-Ile"
FT   CDS_pept        321941..324463
FT                   /codon_start=1
FT                   /gene_family="HOG000247884" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622764"
FT                   /locus_tag="AGOS_ADL217W"
FT                   /product="ADL217Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS51703.2"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG190562"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001DB29F9"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AY7"
FT                   /transl_table=1
FT                   /translation="MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPG
FT                   PIQGSLACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEV
FT                   YLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIEN
FT                   VLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPV
FT                   DEKSDIWALGVFLYKVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEH
FT                   PVQRPNICQVLEEVSRIQGVPCPLPNFYLERMKHGACTPVHHSASQPALPLATHQFSTS
FT                   TPMVTHPQPPANQMSPLPHGIQPITSNMVYMMHNTTPNIKDIPRENPAATIQKNALYSM
FT                   SGSEHLSALSSDMHFNRPQLENSHTFSGVGPRSSSNPIKIPRNEIQKFLSGTPPTSAKK
FT                   PTYVDSETQTGDIITSNKSGSRPFAMSLSPLSSPELFSEQSTGNSLLGRLSRKTIRSPT
FT                   SDKGSNPLKSKSSVGDDLASLLSSPSRNLSFPAQSSKSSKRNSADLSSRKSPVLNKSRI
FT                   AMSYSGPEKSSATGLESSSSSLFGSQNGEHRPPSSTDRHKSNSTSFRLVPTKKGQTSIQ
FT                   ERVHKLLATSAQEDVSKKASKKTTNSATSAKLEHQKGDEQSISTGSMSKIDAISMDLSS
FT                   IAAGNVSKSQFTSVENVLKAAANGSVTAGKKPTTSETSKSAVSASATNTRKAPNSSENA
FT                   TKLPNVVSPTKRANTVETPQRSPADPVSAKVASSMDSKTKDKKQPPTKPPKPAHLRPKL
FT                   PPKPSHLKSPSVDKKRMSKDASTLISEC"
FT   CDS_pept        complement(324645..326753)
FT                   /codon_start=1
FT                   /gene_family="HOG000161343" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079573"
FT                   /locus_tag="AGOS_ADL216C"
FT                   /product="ADL216Cp"
FT                   /protein_id="AAS51704.2"
FT                   /db_xref="HOGENOM:HBG058578"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR017321"
FT                   /db_xref="InterPro:IPR019154"
FT                   /db_xref="UniParc:UPI0001DB29FA"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AY6"
FT                   /transl_table=1
FT                   /translation="MEERTQQKRKLEEGSPDGEANGGQASRKAIVQKRPVIVPPVRPKI
FT                   SYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSG
FT                   IDEIGELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNND
FT                   SLISARLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNI
FT                   LKNYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQC
FT                   GDGKGEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIG
FT                   QCHVSPACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQP
FT                   LKQPKPEAIVTIDMVIKEQSKYWNCFKGRHGNDGINWREGVNDSLTSKNFPLQSAVRQH
FT                   QFRRLAKEYKFVTLPLLNMELPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHI
FT                   DPSTSIIVDTTVSVINWALGRNYGVIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLK
FT                   TFPHLARVAFVGIGDAYSGFVHLLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDW
FT                   YFKNSLVFTSTYHPCWGTDGNDSKKPRKKFGRVLRCTCDGMNNIVEERLEEATDFILDS
FT                   FEEWSESE"
FT   CDS_pept        327023..328477
FT                   /codon_start=1
FT                   /gene_family="HOG000203203" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751252"
FT                   /locus_tag="ADL215W"
FT                   /orf_name="AGOS_ADL215W"
FT                   /product="ADL215Wp"
FT                   /protein_id="AAS51705.1"
FT                   /db_xref="HOGENOM:HBG072242"
FT                   /db_xref="HOGENOM:HBG736383"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="UniParc:UPI00002529A2"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AY5"
FT                   /transl_table=1
FT                   /translation="MEFYRDASWVLEYIEQEFARKSKVAGSLHSLVLQSHKKYKLKSDV
FT                   RHVYAIVASFWKYKAYLDRIIEKSGLLKDVPRKKGEPAFKRSTLGLVVHDLLLSKKKRI
FT                   HMGKHPLKAFVLKHQTRLRGEYAKQLVKLGVADLSVLVQDEREDATPVRWIRLNPFRIR
FT                   GQREEVLQELQKKFPRRVADWRELTPGSIYEDEYVAGLYGVHPADKITSHELYKRGKII
FT                   IQDRASCFPAQILAPGRSDVIIDACAAPGNKTTHVAAHIFPEGGADHAQIHAFERDPQR
FT                   AKTLRKMIATAGCDNAIEVHVGDFTRDAQPEIFKNVTGFIVDPSCSGSGIFGRQLVDAT
FT                   QETQKGTETDPSADVPEEETFEATKSAVELKNRLAKLSSFQFQIVKHAMSFPSAKKLIY
FT                   STCSVHAEENERVVIDLLLDSKVQKGGWKVASRSKVIPAWPRRGHQAEFEEVFPDQAEE
FT                   LAGGCIRVLPKEDGGIGFFAVCFERE"
FT   CDS_pept        complement(328533..329636)
FT                   /codon_start=1
FT                   /gene_family="HOG000021111" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079574"
FT                   /locus_tag="ADL214C"
FT                   /orf_name="AGOS_ADL214C"
FT                   /product="ADL214Cp"
FT                   /function="NAD+ or NADH binding"
FT                   /function="magnesium ion binding"
FT                   /function="oxidoreductase activity, acting on the CH-OH
FT                   group of donors, NAD or NADP as acceptor"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS51706.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0016616"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG435977"
FT                   /db_xref="HOGENOM:HBG518924"
FT                   /db_xref="HSSP:1AI2"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="UniParc:UPI00002529A3"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AY4"
FT                   /transl_table=1
FT                   /translation="MHRSSATSLIHKATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEA
FT                   IGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYS
FT                   SPIVALRRQLGLYANIRPVKSVSGTGQPVDLVIVRENTEDLYVQQERTYVDAATGKRVA
FT                   EAIKRISEPATERIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYE
FT                   ANKKSYGSIEYNEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPS
FT                   VNVGNNIIIGEPCHGSAPDIAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNL
FT                   KDRQVVSPDLGGKNTTQEVLDDILARI"
FT   CDS_pept        330087..332813
FT                   /codon_start=1
FT                   /gene_family="HOG000112499" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622765"
FT                   /locus_tag="AGOS_ADL213W"
FT                   /product="ADL213Wp"
FT                   /function="nucleic acid binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51707.2"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG190560"
FT                   /db_xref="InterPro:IPR000967"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="UniParc:UPI0001DB29FB"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AY3"
FT                   /transl_table=1
FT                   /translation="MLRDMPLDATAELEGIPYYEQTVLELRDGETYQCLICTVEMDASC
FT                   PMYACHQCYRVYDYECIRRWALKATSTTVDRTWKCPNCYHVNRKVPPKNRHTCWCGKQV
FT                   NLDPNYINPNSCGQTCGAPICQHGCSKLCHLGPHEECMVRIDFKCRCGKLTEEIPCYEA
FT                   KAAKRNFSCDQPCGLPMPCGIHKCERVCHNGPCGPCKEEIAGDIKCYCGLTTRNKMVCS
FT                   EVSVVARSKVSKYKSWIGAFACDRMREVPYSCGKHSFHEKCIAPPSLPKRTPCPYSPEN
FT                   CTTCPCGKTQLAELGSTRTACTDHISSCGKVCGKQLSCGNHTCPMTCHDGNCMDPCLVI
FT                   TEQKCACEQRRFLVPCQFPHSPSCTAKCESLMSCRRHRCAERCCSGRPHSVKRNSRRRR
FT                   ESPDDESEVEAQHVCLKDCNRVLLCGIHMCNYKCHAGKCPPCLESDSNDLICPCGKTIV
FT                   PAPVRCGTKLPRCTHPCRNSLLDTWPCGHSPPSHNCHPLDEPCPPCTITVKKTCRCGKN
FT                   EIRTFCYNDDVSCSRPCKKPLSYCNHFCQVPCHSDGQCQQTCKQACGLPRKACEHVCKA
FT                   KCHGHTACPESPCTEKKTITCSCGHKSSTKICSEYAGKDDGIGASQHLSCDEDCAKFQR
FT                   HQQLMRAFGVVEKATSEEDEALLLAQRSQSFDDLHLPFTEYVLSVFTKQSQWCTQIEQY
FT                   LIKLMDDSSPKALHFKPMRAAQRRFVHELSSSFGLYSESQDPEPKRSVYVKKTGISRVP
FT                   AIGLSKAAPLYTSFKKLEREFKANSESAVTKKLVSVHIDDSPESQHDAAINAILLSGLT
FT                   SFASESALRDCFADYFSQTLLNCPQYVVRGTEGYIFPTDYLSLSANAEKDLTKLAGYFR
FT                   LLFQEQNLWTDISTCKLDSNLNRIGSCESPAADCLGQ"
FT   CDS_pept        332928..333683
FT                   /codon_start=1
FT                   /gene_family="HOG000187553" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775319"
FT                   /locus_tag="ADL212W"
FT                   /orf_name="AGOS_ADL212W"
FT                   /product="ADL212Wp"
FT                   /protein_id="AAS51708.1"
FT                   /db_xref="HOGENOM:HBG058579"
FT                   /db_xref="HOGENOM:HBG324388"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI00002529A5"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AY2"
FT                   /transl_table=1
FT                   /translation="MTETFTAVFEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGES
FT                   GCGGKVWIAGNLLCEFILEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGK
FT                   YNGATDTNVYITDIEGLCPLMQKNVELNGLDGMVHPRPLFWGEPLSDEFTRQPIDLVLA
FT                   ADCVYLEKAFPLLEKTLLDLTAGESQPLVLMSYKKRRKADKKFFIKIKKEFDIIEIKDF
FT                   KSYEDYRRQRTYLFQLVRKPARAPHALAP"
FT   CDS_pept        complement(333761..334537)
FT                   /codon_start=1
FT                   /gene_family="HOG000066128" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751253"
FT                   /gene_name="RSM25"
FT                   /locus_tag="ADL211C"
FT                   /product="37S ribosomal protein S25, mitochondrial "
FT                   /cellular_component="mitochondrion"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS51709.2"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="HOGENOM:HBG124419"
FT                   /db_xref="HOGENOM:HBG324291"
FT                   /db_xref="InterPro:IPR016939"
FT                   /db_xref="UniParc:UPI0001DB2A16"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AY1"
FT                   /transl_table=1
FT                   /translation="MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFARE
FT                   PKLHDPVSGKYKGELDIMTDRLNRNTETYKTRAGSSDRQTAAVHKPSKLRFIEDKLRSL
FT                   FFQQHPWELSRPKVLVENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLA
FT                   AYDQARFEFYRLRMQQELEEQIAYEEATMVGAVFKTTAVEHGLQQEQKVLDKWKEDVVA
FT                   GLQLMSAKKNSTKQSWAEATEEKEEQDSAEPEELKL"
FT   CDS_pept        334762..334980
FT                   /codon_start=1
FT                   /gene_family="HOG000231410" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751254"
FT                   /locus_tag="ADL210W"
FT                   /orf_name="AGOS_ADL210W"
FT                   /product="ADL210Wp"
FT                   /protein_id="AAS51710.1"
FT                   /db_xref="HOGENOM:HBG028540"
FT                   /db_xref="HOGENOM:HBG713182"
FT                   /db_xref="InterPro:IPR009653"
FT                   /db_xref="UniParc:UPI00002529A7"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AY0"
FT                   /transl_table=1
FT                   /translation="MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIFW
FT                   KFARIGERASPYVSIACIAMAINQINS"
FT   CDS_pept        complement(335259..337373)
FT                   /codon_start=1
FT                   /gene_family="HOG000208576" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079575"
FT                   /locus_tag="ADL209C"
FT                   /orf_name="AGOS_ADL209C"
FT                   /product="ADL209Cp"
FT                   /protein_id="AAS51711.1"
FT                   /db_xref="HOGENOM:HBG333844"
FT                   /db_xref="HOGENOM:HBG597089"
FT                   /db_xref="InterPro:IPR010678"
FT                   /db_xref="UniParc:UPI00002529A8"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AX9"
FT                   /transl_table=1
FT                   /translation="MGITDSHGIMDGKRGRKQLRNITRIGRAIHVQEDEAKSREEHTVE
FT                   EAQAGEQTSNRKRGNHPAEDDGGARESQSYGALLTLLSAEHGKQRKKRLRKAEAEAAEA
FT                   AEAGEDPEEAITAALENSAQDAEDAEDAFDDSGESDEEQDHFDVHFNRVSAADVAQLDA
FT                   AFKNGRAQYRVQKEARGEEEILYSKPVASSEGTEGPVRVPARSLRGYAIKQRLRMHNGL
FT                   TADDPEKPLTPQQKVLLDPMFQYQDILYEYEGYDREREYRELYTLHILNHVYKTRDRIL
FT                   KNNQKLQDNPDQELLDQGFTRPKALVVVPTRATAYDVVDLLLQQSGIEQVDKKSKFKDQ
FT                   FYDPSLPPASKPKSFQHVFKGNTNDFFVLGMKFTRKAIRLYSNFYQSDVIVCSPLGLQL
FT                   IIENTDKKKRQDDFLSSIEVMVLDQLHSIEFQNIAHVSNIFAHINKIPQQQRDADFSRI
FT                   RMWYIEDQAKLFRQTMVFTRYISPFANALLNRKCANWAGRVKSHRVVSAEKSVIGQLGL
FT                   KLRQIFQRFEVLGGSTVDEPDFRFKFFTSVVVPGIEKTTGYDSGILLYIPEYTDFIRVR
FT                   NYLKDKTRILFGDINEYSDQRQLTSNRALFQLGRIKVLLYTERLHHFRRFELKGVKSVI
FT                   LYKPPSNPEFYQELLRYIGKSAFLGVADLNIATVRCLYSKMDSLALERIVGTKRAAVLT
FT                   HGQNEVYEFK"
FT   CDS_pept        337560..339068
FT                   /codon_start=1
FT                   /gene_family="HOG000208846" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775320"
FT                   /locus_tag="ADL208W"
FT                   /orf_name="AGOS_ADL208W"
FT                   /product="ADL208Wp"
FT                   /protein_id="AAS51712.1"
FT                   /db_xref="HOGENOM:HBG058581"
FT                   /db_xref="HOGENOM:HBG398099"
FT                   /db_xref="InterPro:IPR013635"
FT                   /db_xref="UniParc:UPI00002529A9"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AX8"
FT                   /transl_table=1
FT                   /translation="MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTL
FT                   FILYFVTTTLKITAATRGDEWKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGS
FT                   DPKGARGGFIFDGNMNESLLQLLGRSRDDRATMAYLHYYRYVVRPWQYMLLHATPCFTL
FT                   TEGFFTVLAIQVIGETGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPL
FT                   SVHTATLLGFTLSLVFGLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEI
FT                   FQVVHNTWQMQQGTLPKNSLLAYYKNFILNAENLWDVLLKKAFLLHSVELDQAPSSVVV
FT                   KDALVLVQQQWWNKSQQLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFR
FT                   VIVFYSATRIIPALQRATGGTQSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCI
FT                   WGCFPWLQSEANRDRWVVDAWGFWNWCNLFFTLLIYAVELIGSR"
FT   ncRNA           complement(339133..339210)
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR66"
FT                   /product="AgSNR66"
FT   ncRNA           complement(339273..339560)
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNRNME1"
FT                   /product="AgSNRNME1"
FT   CDS_pept        339659..340741
FT                   /codon_start=1
FT                   /gene_family="HOG000217621" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751255"
FT                   /gene_name="SSN8"
FT                   /locus_tag="ADL207W"
FT                   /product="RNA polymerase II holoenzyme cyclin-like subunit "
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51713.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG396776"
FT                   /db_xref="HOGENOM:HBG436057"
FT                   /db_xref="HSSP:1ZP2"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR015429"
FT                   /db_xref="UniParc:UPI00002529AA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AX7"
FT                   /transl_table=1
FT                   /translation="MPPIVDRVAAMPMICDTRPGVGETASRNMSASYWDSSQRNKWQYS
FT                   RESLARTRQKLWMLECQLYPQGTNILMEGGGKDAQPVTKNIPITHRDLHYDRDYNLRIY
FT                   CYFLIMKLGRRLNVRQYALATAHVYLARFCLKASIREVNLYLLVTTCIYLACKVEECPQ
FT                   HIRTLVNEARSLWPEFVPPDPTKVTEFEFYLIEELQSYMIVHYPYRAMEQIAAALRRPP
FT                   YNLVLSPDDLQNSWSLINDSYITDVHLLYPPHVIAMACLFITVCLRSAAGARDLQETFN
FT                   RFMADSQVDLHEVMDTIQDFITLYDHWDKYNEPWIKFLLHNLYLRPHAGGTTVSGAAAG
FT                   SAGPAGSVLTPNGTITGSTS"
FT   CDS_pept        340998..342116
FT                   /codon_start=1
FT                   /gene_family="HOG000093927" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751256"
FT                   /locus_tag="ADL206W"
FT                   /orf_name="AGOS_ADL206W"
FT                   /product="ADL206Wp"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS51714.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG058582"
FT                   /db_xref="HOGENOM:HBG396775"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="InterPro:IPR013599"
FT                   /db_xref="InterPro:IPR016439"
FT                   /db_xref="UniParc:UPI00002529AB"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AX6"
FT                   /transl_table=1
FT                   /translation="MSGQVRQRFAKDQHAGSQIEVEYGSKDAAFEADKSVELEEREELL
FT                   PIRGQLAVSKVDLYTVYASGALLVALAVGFLRQAAWCDKFLRLQYASVESPGKYDIGID
FT                   DAYIVGTFVVVLCLVRSSLLEFVLKPLAHYKFRISSGKIQQRYGEQSWSMLYYTASWVT
FT                   GFYLYYHSPYFLNCDHIYLNWPHDKMAGVFKVYYLVQIASWLQQIIVLNVEEKRKDYWQ
FT                   MFAHHIITVALTTGSYYYYFNRIGHVILIIMDVVDILLSSAKILKYCGFSVACDYMFVV
FT                   FLGFWVVLRHGVYNYILHHAWAKSRGLMQNQRCGVHAPGTRCWTPLVIDIFVLLLAGLQ
FT                   LITVIWSFLIVKVFMKVIRGSGAEDVRSDDEE"
FT   CDS_pept        complement(342339..343745)
FT                   /codon_start=1
FT                   /gene_family="HOG000173527" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622766"
FT                   /locus_tag="ADL205C"
FT                   /orf_name="AGOS_ADL205C"
FT                   /product="ADL205Cp"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS51715.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG210671"
FT                   /db_xref="HOGENOM:HBG332582"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI00002529AC"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AX5"
FT                   /transl_table=1
FT                   /translation="MVPTATVGSSTVNLIKTIVGAGLLAVPYAFRADGVCVAAVLVAVA
FT                   AITSGFGLVVLAKASKALVNPRQSSFFALCQITYPRLAVVFDFAMFTQCFGVGVSYLII
FT                   VGDLFPGLLGGTREAWIAASAAVVVPLSHLRRFDSLKYSSVLGLVAIAYLALMIVAAWI
FT                   EGLTTGYAHYERGEVRWLRPASLREMVSTFSIIVFAFTGSMNMFSIINELGDNSMRNIQ
FT                   RIVYYSIAASTALFILVGMAGYLTFGSNVAQNVILNFDPDAVSTQVGSLALGLMVLLSF
FT                   PLLFHPGRIAFNNMVHWAHVTYCGYRPLKSEEQPGDAGASICLEVEDEEDRLILSAEGS
FT                   ESYQSLPRGANSNEDSGSSAEVDRQAVPFDGPRFYIVTWLLLLVLYLVAFKVRSFAYVL
FT                   ALVGATGSTAISFTLPGLFGYRLIGTDSLMKGNMLSRQDHLYRCASLGLVGYGIVVTIV
FT                   SLMVVIYFGI"
FT   CDS_pept        343959..344612
FT                   /codon_start=1
FT                   /gene_family="HOG000188365" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751257"
FT                   /locus_tag="ADL204W"
FT                   /orf_name="AGOS_ADL204W"
FT                   /product="ADL204Wp"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /protein_id="AAS51716.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="HOGENOM:HBG253090"
FT                   /db_xref="HOGENOM:HBG527347"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020428"
FT                   /db_xref="UniParc:UPI00002529AD"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AX4"
FT                   /transl_table=1
FT                   /translation="MDGTNGGGTAGAQGGKEGQAMAERRWNDVGRSAGATDGEPGPAGP
FT                   DRYGGEVVPPENFSPVVGEIYRSSFPRPENFAFLQERVRLRSILVLIPEEYPPENQEFV
FT                   ERAGIQLFQVGMSGNKEPFVNIPRDVLTRALAIALDPANHPILIHCNRGKHRTGCLVGC
FT                   IRKLQNWSLTMIFDEYRRFAFPKARAMDQQFIEMYEDRELIVEAVRRRWLPIAW"
FT   CDS_pept        complement(344626..345054)
FT                   /codon_start=1
FT                   /gene_family="HOG000248619" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079576"
FT                   /locus_tag="ADL203C"
FT                   /orf_name="AGOS_ADL203C"
FT                   /product="ADL203Cp"
FT                   /protein_id="AAS51717.1"
FT                   /db_xref="HOGENOM:HBG058583"
FT                   /db_xref="HOGENOM:HBG398105"
FT                   /db_xref="InterPro:IPR019419"
FT                   /db_xref="UniParc:UPI00002529AE"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AX3"
FT                   /transl_table=1
FT                   /translation="MWGAIQQIRDLSYTPGIAWLNSAMLLATPVLSPAQPAAAATVPQA
FT                   GGWLARAARPKHIGPTAKTSLLFSAAQALGGWIIHDGDLESGSGFLAAWSALYLVVGGR
FT                   GSVRALRYGRLWPLVLAASSGLGGLAYGERFLSGRFLA"
FT   CDS_pept        complement(345190..345600)
FT                   /codon_start=1
FT                   /gene_family="HOG000155290" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622767"
FT                   /gene_name="HHT1"
FT                   /locus_tag="ADL202C"
FT                   /product="Histone H3"
FT                   /function="DNA binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51718.1"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG493811"
FT                   /db_xref="HOGENOM:HBG715487"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI00000009B9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757N1"
FT                   /transl_table=1
FT                   /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPG
FT                   TVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSL
FT                   FEDTNLAAIHAKRVTIQKKDIKLARRLRGERS"
FT   mat_peptide     complement(345193..345597)
FT                   /gene_name="HHT1"
FT                   /locus_tag="ADL202C"
FT                   /product="Histone H3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757N1 "
FT   CDS_pept        346054..346365
FT                   /codon_start=1
FT                   /gene_family="HOG000234654" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079577"
FT                   /gene_name="HHF1"
FT                   /locus_tag="ADL201W"
FT                   /product="Histone H4.1"
FT                   /function="DNA binding"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51719.2"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG210755"
FT                   /db_xref="HOGENOM:HBG385452"
FT                   /db_xref="InterPro:IPR001951"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR019809"
FT                   /db_xref="UniParc:UPI000042B79D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757K0"
FT                   /transl_table=1
FT                   /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVK
FT                   RISGLIYEDVRAVLKSFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG"
FT   mat_peptide     346057..346362
FT                   /gene_name="HHF1"
FT                   /locus_tag="ADL201W"
FT                   /product="Histone H4.1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757K0 "
FT   CDS_pept        join(complement(347454..347505),complement(346470..347401))
FT                   /codon_start=1
FT                   /gene_family="HOG000141851" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751258"
FT                   /locus_tag="AGOS_ADL200C"
FT                   /product="ADL200Cp"
FT                   /protein_id="AAS51720.2"
FT                   /db_xref="HOGENOM:HBG058585"
FT                   /db_xref="InterPro:IPR013907"
FT                   /db_xref="UniParc:UPI0001DB2A17"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AX0"
FT                   /transl_table=1
FT                   /translation="MSFQGYDQYQPDYSRQELSRKDKRRHNIESKVAKISQNFVVDKDV
FT                   HYRDRLTHLQTDLTSLHQGNNLQFMRMLRDLEEERDLELIRLRFYEEYRVQRSSIEFQE
FT                   DIEKTKEEHEKMIKLCKEKLYESFEKKIIKLQEERLLTDVANAHSYSMDHPRTKQAKPT
FT                   RSLQSAWDSSTSELGGGTGAGGASANESGTETGAERRSLRKRVTNNAAARIINEESEYV
FT                   SNRDSSGPYGGSRTGTGSAANAAMAGGSQNNSDSEFLQYISDSNELYTLLFGSEERDTE
FT                   KKKLRSTQRLSTKSAPPLQSLTPDEVTEDIALIRQLTGQPPAPFRI"
FT   CDS_pept        347833..349110
FT                   /codon_start=1
FT                   /gene_family="HOG000000750" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622768"
FT                   /locus_tag="AGOS_ADL199W"
FT                   /product="ADL199Wp"
FT                   /protein_id="AAS51721.2"
FT                   /db_xref="HOGENOM:HBG058586"
FT                   /db_xref="InterPro:IPR003402"
FT                   /db_xref="UniParc:UPI0001DB2A18"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AW9"
FT                   /transl_table=1
FT                   /translation="MSGDVEHLETQSMAPVEFIVDQARVIKAIKLELEAAGAFRGIETN
FT                   GGSKIVRSSLDVSADTAARICTTYQVSSREYSAGAPRVPRTLEGFAESYLHAQGFSEVE
FT                   TAALLRAMPQRYTLYPPLVLFSHSGARSFEHDAWGAAFARMDKDAFFAAMLASGCFPTG
FT                   YTHVAANRPIVATDAMRRPFNIAPLYGELLAQGDAAGAQLWEQPTAADFARSVWCSVVQ
FT                   NGIRQTWSPVFTMFSRGNIKEKKRILDTYPDVAGRDVVDLYAGIGYFTLSYLARGARSV
FT                   YCFELNPWSFEGLRRGLAVNAYPGSCYAYNESNESAPARLAGRDLDVRHINLGLLPSSR
FT                   PGWGIAMGLALAHGCRPITTLHIHENAAASELHALADTVADELRALAATCSPGLHVRPR
FT                   HLEKIKTFAPDVWHVCLDVDVSRSAE"
FT   CDS_pept        349510..351153
FT                   /codon_start=1
FT                   /gene_family="HOG000184665" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928313"
FT                   /locus_tag="AGOS_ADL198W"
FT                   /product="ADL198Wp"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS51722.2"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058587"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001DB2A19"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AW8"
FT                   /transl_table=1
FT                   /translation="MCFEDYLNAQTVGSDVSPDKARMNSSNKANGGMRMQEKEGSPAYD
FT                   MESEMTADGVSLFNSFHTNPTTTLTVPQVILSPYDQDESFGTPTQHLGQPFQAPTINIQ
FT                   TPLEGAVGSPALDMSSPMNLPQYAEGIDVDQLRLPNTPNRDSYLSASMSDQSVSAYNAH
FT                   SPETAHFLRHQNVAVSPQVSYLRTGNDDFDELLSLHSGTTENSEYFQIHDVDDLNAILD
FT                   DNVHLFYSPHTGDSFDAHQLPVNDISASPATTPQYAPLINVHRVDGTLPPSSISVTPSP
FT                   RTSFNDEDNRPNLDFLSVKGNEEFALTDDDELEDAHEQMRQGRRYKRRSSTKSLRSQSI
FT                   ANTPSQEDKAHTLNKNREKLLELAALHIPNSSSANSLSPTSLGPSTGPAETSSPADHSA
FT                   PLDEGETALNLSGNTRRKSLQKNPAIYSCNLCDKKFTRPYNLKSHLRTHTDERPFSCSV
FT                   CGKAFARQHDRKRHEDLHSGKKRYVCGGKLKGGATWGCGKKFARSDALGRHFKTESGRR
FT                   CIAPLYDEASKERAANNMAPLTENDQFWLS"
FT   CDS_pept        complement(351433..352605)
FT                   /codon_start=1
FT                   /gene_family="HOG000246777" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18928574"
FT                   /gene_name="PFA3"
FT                   /locus_tag="ADL197C"
FT                   /product="Palmitoyltransferase PFA3 "
FT                   /EC_number="2.3.1.-"
FT                   /function="acyltransferase activity"
FT                   /function="zinc ion binding"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="AAS51723.1"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG124393"
FT                   /db_xref="HOGENOM:HBG396839"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniParc:UPI00002529B3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AW7"
FT                   /transl_table=1
FT                   /translation="MASLSPGMINFAMAVIFPAGMVVMSYMSSSNFLLFTIADLLALPL
FT                   SSQQGTHRGSKAICQVSGYAMHICSLIPILFPKLLTCGLALYSAVVLWLKVSVIGSFIQ
FT                   GTVLLTLVPLILYAYFSTIAVGPGSPLDFEELRIRDLNDVETGMEFPPDFLAAKTVTLD
FT                   STGRHRYCVKCKVWKPDRCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFLLYAS
FT                   VYAFWICIITTWDLVVWFRAHSYERELLNVHLVCLWALSAAATVALTAFCAFNIYLVCK
FT                   NETTGEYQRRSTLNSDLEMYADCTNGPRTVIENPFDLGSRRRNWAAVMGDTWKEWLLPI
FT                   RTTASQKARHSFDESGLYFKIDEQAHAKLAESMALQARLITRFNSKRAVQ"
FT   CDS_pept        352859..353278
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928575"
FT                   /locus_tag="ADL196W"
FT                   /orf_name="AGOS_ADL196W"
FT                   /product="ADL196Wp"
FT                   /protein_id="AAS51724.2"
FT                   /db_xref="HOGENOM:HBG352200"
FT                   /db_xref="UniParc:UPI000042B79E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AW6"
FT                   /transl_table=1
FT                   /translation="MAFPNASKKNRPTLKVGDLCYARVSSAEKDLEAVLECMDSSTGRD
FT                   AGFGQLDGGMVAEVSLGFARELLLNEAFPLLPEMARHAQFEVAIGVNGKIWVKAETVRT
FT                   TLCCIRAIEACQERPQAEFKTTVKRVFKELREGTE"
FT   CDS_pept        complement(353336..355915)
FT                   /codon_start=1
FT                   /gene_family="HOG000168063" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752321"
FT                   /locus_tag="AGOS_ADL195C"
FT                   /product="ADL195Cp"
FT                   /protein_id="AAS51725.2"
FT                   /db_xref="HOGENOM:HBG434519"
FT                   /db_xref="InterPro:IPR002013"
FT                   /db_xref="UniParc:UPI0001DB2A1A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AW5"
FT                   /transl_table=1
FT                   /translation="MQFVDLAGTGAASLAHKSMNSLLPGLPKQRKIKKFTMTKYTIYET
FT                   SKRMYIVGSNKRETMFRILEIDLTKPKDVLLVVEDNVFFTRGDVMKILRNIEESEKDGL
FT                   NKKLTGHGLLGFIRFTDCYYLVVVTNVSHVAVLGGHSIYHIDDTQLVPISTSYKKPDAT
FT                   EARFLATFQNLDLSRTFYFSYTYDVTNTLQTNMLRRKLEGVGREDIVVPSGIPEYNEMF
FT                   LWNTHLLDEVISCIDTVYDWFQPIIHGFIDQVNVSLGGKSIFVTLIARRSHHFAGARFL
FT                   KRGVSNHGYVANEVETEQIVSDMVLTSFHAPGNMYYDNDRYTSFVQHRGSIPLFWSQEA
FT                   SNLTAKPPIEINVMDPFYSAAAKHFDSLFQRYGGGPIQILNLVKTKEKNPRETKLLVEF
FT                   ENCVNYLNHFLPQDKKLQYTSWDMSRASKSHGQVVIEFLERYASQSLETTGIFHNGRNF
FT                   ETTRTQEGVCRTNCIDCLDRTNAAQFVIGKRALGVQLHALGIIDNTYLEYDSDIIDILT
FT                   ELFHDHGDTIALQYGGSHLVNTMETYRKINQWRSHSRDLIESIKRFYSNSFVDAQRQEA
FT                   TNLFLGHYVYQEGQPMLWDMNTDFYLHNVYNIGEPKRSYTHWWNEFHIQSIRGIIKTEI
FT                   VDSHNDITKEKLAMNVRGYPSSYDNYWNEYYMPRLLVSFQDLFAYNMNSTRRYHEEEKQ
FT                   KDRLLSPFVSKKQSSLNTKLRAITTKNASAKQKPADNSKKKRNQEDEFDLCKLELSKVL
FT                   TRARGLEKKLDSAILDFNGTGGPDATSSSGYIYDNYLPHSACSPAFSSTLSVHNTDREI
FT                   YERSVRMDAYTLLDDYKTYFDTPISLNCDQRALYERTYRYFEPFSKL"
FT   CDS_pept        356159..358258
FT                   /codon_start=1
FT                   /gene_family="HOG000246544" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15752322"
FT                   /gene_name="PPM2"
FT                   /gene_synonym="TYW4"
FT                   /locus_tag="ADL194W"
FT                   /product="Leucine carboxyl methyltransferase 2 "
FT                   /EC_number="2.1.1.-"
FT                   /function="methyltransferase activity"
FT                   /biological_process="tRNA processing"
FT                   /protein_id="AAS51726.1"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG058588"
FT                   /db_xref="HOGENOM:HBG395489"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR021121"
FT                   /db_xref="UniParc:UPI00002529B6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AW4"
FT                   /transl_table=1
FT                   /translation="MSSMPVHIERPAELTAKQRLQLEKKVRSMKYADLAVQGTNTSSIA
FT                   SKRSVERLYADVLGTKVQGSNGQPREYFKYFVSKPLRRSPCINRGYWLRLMAIRTSLRC
FT                   IAEGTGQRDILVVNLGCGYDPLPFQLLDHTDDAQSEFDDRMSFVDVDYPDLIAKKLEIV
FT                   KNTPELQHILGGAAGDAAGPVVYRTAKYMAAACDLNDSAAFGALTESFHPRSDEVVVFI
FT                   AEVSLAYMRPERADAIIEACGRIPNSHFILLEQLLPAGEHSPFSRTMLSHFKSNDSPLQ
FT                   SVSSYPTISEQEVRFKRLGFKNVNAGDMHQLWRSLDKELVSKVQAVEPFDELEEFYLFC
FT                   HHYIIAHATNDLSFRFGPKYAFPQVPQSPSKSCSSNSPMELVTAVDTDLLQRKFGASVV
FT                   VDSDTILFSFGCLHNKLENILVMGDHDGAFKISKGPAPPARMCHTFTKLDDRTIFLVGG
FT                   RQSPTKPLGDAWLLKLRDGEWHWEMCAPLMYPRFRHNCVNVGKGKALIYGGETDGATFL
FT                   IYDCESNTYYEPVYPRTFPRKVSAAMCYDFQSNRGYILGGALDNMEVDDTLCTFAFDAR
FT                   TNSIEILETSSHPLYQRYGAKSVVREAGHMLIVGGVSPHMLFNDTTSIIEVELTTNKVN
FT                   CLQIPSSLWKNHAQLLVGFELQIMSDGTVLIFGGGAVCYGFGAAWNGILRLGRETIAAI
FT                   PLRIL"
FT   CDS_pept        complement(358352..359749)
FT                   /codon_start=1
FT                   /gene_family="HOG000141871" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079822"
FT                   /locus_tag="AGOS_ADL193C"
FT                   /product="ADL193Cp"
FT                   /protein_id="AAS51727.2"
FT                   /db_xref="HOGENOM:HBG058589"
FT                   /db_xref="InterPro:IPR022703"
FT                   /db_xref="UniParc:UPI0001DB2A1B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AW3"
FT                   /transl_table=1
FT                   /translation="MNVQEDESTDFEDDSRTESVQMYLGEYPENAEREGSGEMLGGKLA
FT                   RLKTRFMSPRVYLARKRLLVLFLSNMLFLACLVLVVFSLHVGVLVNQQQYLGRLPMLMV
FT                   VQDEDAGMSAELLRAAEHAAGRWTTVHGAAAWSHFGLEEDADLDEYLQSLIRKHRYWMA
FT                   LHVRPGATEALRRSLDDPGAPVFNSSEFFKVYYETVRDFNAMGSVRKLMETLEANFRAY
FT                   YLDTWLPGELRERANTIDLSSTGSNIVAAGSMRWSYVDLGPFYDPSLYGILQVGMIICL
FT                   LLTFFQLAMISALHTELSLLLRTSHLLLYRYIVSYASYLLLSLFYSIVPIIYHLDMEKA
FT                   YGRAGFLVFWMTTWLFMTALGGANENVISVIFEYCPRFVGFWLMFWIVFNITPTFYSLH
FT                   LANDFYKYGYITPIYNARECYKVLLFDTDRGYLKVAYVVLVAWTVLNAALFPLALKIVN
FT                   IKSGKQK"
FT   CDS_pept        360186..361412
FT                   /codon_start=1
FT                   /gene_family="HOG000209056" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928576"
FT                   /locus_tag="AGOS_ADL192W"
FT                   /product="ADL192Wp"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS51728.2"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG356600"
FT                   /db_xref="InterPro:IPR005045"
FT                   /db_xref="UniParc:UPI0001DB2A1C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AW2"
FT                   /transl_table=1
FT                   /translation="MAGIKLSNVGLFRRRDKEAERKEEEEDLDASDFEDEPTQPRKQKS
FT                   RRPKDTRFTQQRIASVNHVATPRTVVPVYLVLAVVFAAAGAVLLLQSRRVDELIMYYHD
FT                   CERRAPRGRFAEMAAEDYTQAFHKMPEFARAPQWSYEPARDAAEDGVCRLRFQVPYLLE
FT                   GPIYVSYLIENFYANHRRFVLSFSEEQINGKNATYKDVYDSVGINCRPLVANEEGKLYY
FT                   PCGLIANSMFNDSFPFSLEGVGRTPNYVLSDRHINWSDDKNRFRNTKYSPKDVVPPPHW
FT                   RKRFPDGYNEKNMPNIEEWEEFQNWMRTSTLPKFSKLIRRGDGALSAGQYEMSIGLHWP
FT                   VDGWKGGKKAVYLSTTTSTGGHNDFLGIVYLAGSGICCLIAILILVARFFGGRKIGDPR
FT                   FLSWNKIKY"
FT   CDS_pept        361663..362934
FT                   /codon_start=1
FT                   /gene_family="HOG000020206" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775575"
FT                   /gene_name="ARG8"
FT                   /locus_tag="ADL191W"
FT                   /product="Acetylornithine aminotransferase, mitochondrial "
FT                   /EC_number="2.6.1.11"
FT                   /function="N2-acetyl-L-ornithine:2-oxoglutarate 5-
FT                   aminotransferase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="arginine biosynthetic process "
FT                   /cellular_component="mitochondrial matrix"
FT                   /protein_id="AAS51729.1"
FT                   /db_xref="GO:0003992"
FT                   /db_xref="GO:0005759"
FT                   /db_xref="GO:0006526"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG408326"
FT                   /db_xref="HOGENOM:HBG725944"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI00002529B9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AW1"
FT                   /transl_table=1
FT                   /translation="MVNQRVVHLCAKRSFSLTASMQKYFVDVYAKPDLVLTRGRGSRLF
FT                   DDVNKREYIDFVAGIAVTSLGHSDPAIAEVIAAQSATLVHTSNLFHNSEALKFAEKLVE
FT                   STKRFGGQQDAEKVYFCNSGTEANEAALKFSRRRALRTDPQKQGFIAFENSFHGRTMGS
FT                   LSVTSKAKYRLPFGDMVPHVTFLNIHDPVEKLVSFIVENAPKTAAMILEPIQGEGGVHR
FT                   VPEDKLVALGRLCKKHDIVLIYDEIQCGLGRTGKLWAHSNLPADAHPDIFTTAKALGNG
FT                   FPMGATVVNSKVNEVLSVGDHGTTYGGNPLACAVGNHVLDRIAQQPFLDDVKAKANVFT
FT                   AGLLALQKKYPFIREIRGDGLLIGVEFTVDVSDIISKSRERGLLITAAGPNTLRIIPAL
FT                   TIEEDTIRQGLEILESVVGEISSS"
FT   CDS_pept        complement(363136..364152)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752323"
FT                   /locus_tag="ADL190C"
FT                   /orf_name="AGOS_ADL190C"
FT                   /product="ADL190Cp"
FT                   /protein_id="AAS51730.1"
FT                   /db_xref="HOGENOM:HBG058590"
FT                   /db_xref="UniParc:UPI00002529BA"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AW0"
FT                   /transl_table=1
FT                   /translation="MLVGRTQLLLLLASSVTAASPEPGRLSVDLVENEVVNGDIEGMMP
FT                   VNKAPADDVAAAAAAAPAVAPAAAPAQANQPAAAAPAAQANQPAAAAPAAQANEPAAAA
FT                   QANQPAAAAPAAQANQPAAAAPAAQANQPAAAAPAAQANEPAAAAQANQPAAAAPAAQA
FT                   NQPAAAAPAAQANEPAAAAQANQPAAQATHSKSTTASPTKAKDGSESTGVPDPSTILDY
FT                   WTHDGVWHTTDSYATIIDHGSFKTTLRQTTSYWFHTTLPDGSVSAYQSAYFQPFSKLYE
FT                   SVDTPKSGEVGMGTLSGSIGVVKPPVYVDNQGGAGTIQNNISLFSLCGTVLLVMSLL"
FT   CDS_pept        365092..367659
FT                   /codon_start=1
FT                   /gene_family="HOG000170275" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752324"
FT                   /locus_tag="AGOS_ADL189W"
FT                   /product="ADL189Wp"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS51731.2"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058591"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="UniParc:UPI0001DB2A1D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AV9"
FT                   /transl_table=1
FT                   /translation="MSKGAMSPIKSNPDSIRRVFSVEDNSNEIQNDVRKQGYQEGVALL
FT                   SKSRAGMSNASTPQLQSAVPALCDHRHNLRGISEDQGQFSGSDWEAEVIPQALGDQESI
FT                   RTVESFTLRERQHAINETHPFGIRIWKPALYKKYRSVQQAANEDIHETKYRHISLVLHL
FT                   SNIVWSATVGIFLFTILYLAGLSVRIFGLLSQSASDYSTIFFKLGRYLLWPFGKVVYIV
FT                   SDEQYLQEDKDEGVSIQQFYKWISGKGNRLFYHNSGADNHSSMAFERELPYGSITREFA
FT                   ESNLISDGCPDTDAGDSIPHRRLFGRGQWTIGRIVFYLIFHVFIQPIMMILVLVLWLGV
FT                   FTIPMSNIIWNLMYHCRRHPLALDFKHVQHTHQYPDDETIGDKNVLLCTFRCAGWHYYK
FT                   FTVDGTNVIVMNLISIVIFTIFDFYFLKRYLGLQLWITGDFNIFCLCLLSIIPLAFYIG
FT                   QAVASISAQTSMGLGAVINAFFSTIVEVYLYCVALKQSKGLLVEGSMIGSILAAVLLLP
FT                   GMSMCGGALNRKTQRYNPASAGVSSAMLIFSMLVMFVPTIFYDLYGDWDLICEGEVPLE
FT                   AKERCRFAQPPLKFDSLYLHVLKPVSIICAVVLFLAYMIGLWFTLRTHAAMIWQLPISD
FT                   QHQDIHAQLQAQQAHSFLQSPKNPVAPHAAISSGNNVAEEPKGHAAPNWSRNKSTWILL
FT                   CATLFYAIIAEILVDCVDEVLKEIPSLNPKFLGLTVFALIPNTTEFLNAISFAMHGNVA
FT                   LSMEIGSAYALQVCLLQIPALVIYSLVYTSGLDHSLIKIREQMFTLVFPQWDLIACMIS
FT                   GFLFTYLYAEGKSNYFKGSILILLYIVITVVFYYQGFIDDNYW"
FT   CDS_pept        complement(367905..368540)
FT                   /codon_start=1
FT                   /gene_family="HOG000186751" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20623064"
FT                   /gene_name="TIF45"
FT                   /locus_tag="ADL188C"
FT                   /product="Eukaryotic translation initiation factor 4E "
FT                   /function="translation initiation factor activity "
FT                   /biological_process="regulation of translation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS51732.2"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006417"
FT                   /db_xref="HOGENOM:HBG346234"
FT                   /db_xref="HOGENOM:HBG559144"
FT                   /db_xref="InterPro:IPR001040"
FT                   /db_xref="InterPro:IPR019770"
FT                   /db_xref="UniParc:UPI0001DB2A1E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AV8"
FT                   /transl_table=1
FT                   /translation="MSVEEVTQKAQALSVGDNEERKTVLTDSKDFDLKHPLNSKWTLWY
FT                   TKPPVGDNESWSDLLRPVTSFTTVEEFWAIQNAIPKPRELPLKSDYHLFRNDIRPEWED
FT                   EANSRGGKWSFQFKVRNPPIDDLWLRALLAVIGESIDEDESEINGVVINVRRSGFKIGL
FT                   WTKSVRQAPLSKVGAKFKAVLQLDDSDTLEFFAHSSANDKNAKPALVL"
FT   CDS_pept        368856..369713
FT                   /codon_start=1
FT                   /gene_family="HOG000007143" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752325"
FT                   /locus_tag="ADL187W"
FT                   /orf_name="AGOS_ADL187W"
FT                   /product="ADL187Wp"
FT                   /protein_id="AAS51733.1"
FT                   /db_xref="HOGENOM:HBG413371"
FT                   /db_xref="HOGENOM:HBG678036"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI00002529BD"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AV7"
FT                   /transl_table=1
FT                   /translation="MVIQQMFKMVVGGTAVVITACLGALYVYQSKLVYPSWAQGARKHV
FT                   DTPDLYGLPYQELRLRTRDGVEIRAFDIRNLRSKGTILVLAPNGGNIGYFLSVAELLYR
FT                   QMGLSVFLYSYRGYGYSEGEPSEQGLKLDADRVMEYMRKDEFYRTQRLVLYGRSLGGAN
FT                   ALYIARKYGAQCDALILENTFLSIPKVIPYVFPYLRYVSFLCREVWNSEEEIRLVDETI
FT                   PILFLSGLKDEIVPPSHMQALYSLSKSSGKKFVTFADGYHNDTIIQNGYWDVVHDFLQK
FT                   HDVI"
FT   CDS_pept        complement(369765..373850)
FT                   /codon_start=1
FT                   /gene_family="HOG000141811" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752326"
FT                   /locus_tag="AGOS_ADL186C"
FT                   /product="ADL186Cp"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS51734.2"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058592"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0001DB2A1F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AV6"
FT                   /transl_table=1
FT                   /translation="MGARRESGLHSFLNRKTPPTADMQQGSGGTRPQPFSRFTYGSKSA
FT                   QSSGGMGGQVACSPKGRGSQRSLLSSNFPFMESVFEDRTAAPQRTPTPRDERSEYFGEA
FT                   EGSSGLRSSLQCNRELASLDKINDAQARMVVVAGKSHLGLYKFDEAYRMQQVHDYMTPG
FT                   SLGGGTKFSSSMRRNMRKISTISDVKAGFHHHKNYIAICGTSTSVSIYDINRASAKDSP
FT                   LITTLSEHSRSINSVDFNMGQTHLLISGGQDGCIKVWDLRSHSYKVNRSDLNFNSGSDS
FT                   VRDVKWMPTYDFASLGADTSLCSSGRSNKFASVHDSGLLLTFDMRQPNQVERKINAHSG
FT                   PGLCMHWHPHMDYIISGGRDGKCALWYVGDKVNSMVSVPQGHNSATSYSINTAPITTGY
FT                   LETVINTSHPVSKLKFRPKYVHNMLNSLIATSSMGEDSDVTIYSLARKHIPQNILTTAA
FT                   PSLGFVWWNEDIVFNIDKQSVISAWDIRYEPTLLDNLPKGIVKWRDMDGSGLVFVAQEK
FT                   GTYSMDNGGVTDSVGKGAANRMSNTTLNSTNNMGRDQEVFTYSFQQQYKHQDQEAADRE
FT                   SDHDKELEKERETEVDQHYHYLREQEREHHQEYQEWEHEPFGRHDDHQGNPQTDFYSHA
FT                   YSDRPMLSKALSTYSSKIASPILSYYGAQTLSHHTSIVSNSPSISGAALEYPGGIESPI
FT                   MITLDLPQVFGSVRASRLADRKTSKNKGNAPAVRESAVDIFKYLVRELELCHVQERNDP
FT                   KSISVDDRSKSLDDTELKIQLMENIGLSEHNTWATLIRSTTSMDTNDPAGSHTQGHSKL
FT                   VDMVKLQGSNILSPDNSDMEDDLGDKLDEMGTARLQENVNHLVGLIFLSTHNAETYASV
FT                   NDLQNFKIWMLIRDSLLNDLKEAADGSTGRRDASGGAANSDKNGIYTTTSTVNHARQDS
FT                   ITSNFSSFEPSDISRSDGEEKLNLGRLSEQNLKATNQNTTAKLDDTRKLASSSSLNSSE
FT                   PLLLLEGGNQAKEQSIGLSDLKTCLKERYTASNESVLDIEEESSATVAYSSKQANTECS
FT                   SSIPIRKTEARTSFIDTIMTNLRSPGLSHLDVDNDAIFGKGKTSTSLGSGASKRSSMHS
FT                   TDSYHKRPYSSPITYSKITTAAQKAKLGLADHDGLPNRGSISFLANIDAAHADKLLLGK
FT                   LGLASSPDDGKLLPPWDTGRLIQQLYRYSVETGNIILTVCIILLFQTMYKVTSTRIVKS
FT                   TLAEFITILHRYEMFEISAHLLKNCPWDDILGAGSGQSTVRLFCENCGKLIVNEHSKTI
FT                   LSKRHQAGESNMTNFGYWYCDSCRKPNSLCVYCEQPMKKLALSFLNCGHGGHFECLQQW
FT                   FLDEGMSECPSGCSGVLL"
FT   CDS_pept        374322..375755
FT                   /codon_start=1
FT                   /gene_family="HOG000095266" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20623065"
FT                   /locus_tag="ADL185W"
FT                   /orf_name="AGOS_ADL185W"
FT                   /product="ADL185Wp"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAS51735.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058593"
FT                   /db_xref="HOGENOM:HBG202858"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00002529BF"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AV5"
FT                   /transl_table=1
FT                   /translation="MTSSSGTSASLPLLREEEQVWTAEDHIPGSQGTELRDWASPAPET
FT                   AQKGCVKEVEYEGEVVRVYPADYRAVPAIRWQIGAAFVMFLILGINDQSTGSLMPVLTR
FT                   EYAVTKVQVALIFAVQCIAYTIGSVATDALHRALGMRGALLLAAGTCVVTYSALSLKPP
FT                   TFYWYLPCFFYLGVAFAVIDSGCNVLLGGLDVHNTELLGMLHAAYGVASFITPPLANSI
FT                   AKNHYWPRFFLVPLALSLVSFVMCFFAFRHETAAKYRYVCSGGEDADTEEAARERQFRR
FT                   VVRNPVILLAAAFLFLYLGSEVSTGSWTLTYLLECKRNEPMAMSYVVTAYWAGLTLGRI
FT                   ASGFVSRHFFANEYRAGLFYACTTLAMHVLFMATGFVAPHGTRYFVVMALFLFLAGIFI
FT                   GPLFPNCCVVTLQLLPKRLQLNGVSVAVALGSIGGAILPFAVGNILDAVGFDWFPSIAV
FT                   VIVLMFNVIWWLYPSLVKF"
FT   CDS_pept        375975..377324
FT                   /codon_start=1
FT                   /gene_family="HOG000213918" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15752327"
FT                   /gene_name="PSF2"
FT                   /locus_tag="ADL184W"
FT                   /product="Polyadenylation factor subunit 2 "
FT                   /biological_process="cell division"
FT                   /biological_process="chromosome segregation"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="mitosis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51736.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0007059"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG268234"
FT                   /db_xref="HOGENOM:HBG736644"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00002529C0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AV4"
FT                   /transl_table=1
FT                   /translation="MNSANDGSVKKYVSQRRTVDMSSPYDRLYFYKKHAIPLRTIQPES
FT                   TYTADIMPPDAYRDHRRVLNIPTKFTHLSSNKVKHVIPAITWTPEGRRLVVATYSGEFS
FT                   LWNGSSFNFESIMQAHDSAVTVMQYSHAGDWLISGDADGTIKIWQPNFNMVKVLDRAHT
FT                   ECMRDISFSYSDQKFVTCSDDNVLKIWNFSNGQQERVLSGHHWDVKSCDWHPKMGLIVS
FT                   GSKDNLIKLWDPRTGRNVSTILGLKHTVIKTKFQPTQGNLLAVVSKDKSIKIYDMRQHM
FT                   RELQTIRDDMDYMSLSWHPINETIFSVGCYNGAIKHFDLLHDNSNSTPACHTIPYAHEK
FT                   SVTSLAYSPVGHILASAAKDRTIRFWARSRPVDPNAFDDPTYNNKKVNAWYFGINNNIN
FT                   AVRPKTEHGIALPPANETNLGTPQPSILGSESIAANNGNVPASGLPGLSF"
FT   CDS_pept        complement(377596..378786)
FT                   /codon_start=1
FT                   /gene_family="HOG000252881" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20623066"
FT                   /locus_tag="ADL183C"
FT                   /orf_name="AGOS_ADL183C"
FT                   /product="ADL183Cp"
FT                   /function="6-phosphofructo-2-kinase activity"
FT                   /function="ATP binding"
FT                   /biological_process="fructose 2,6-bisphosphate metabolic
FT                   process"
FT                   /protein_id="AAS51737.1"
FT                   /db_xref="GO:0003873"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006003"
FT                   /db_xref="HOGENOM:HBG058594"
FT                   /db_xref="HOGENOM:HBG202863"
FT                   /db_xref="InterPro:IPR003094"
FT                   /db_xref="InterPro:IPR013079"
FT                   /db_xref="InterPro:IPR014379"
FT                   /db_xref="UniParc:UPI00002529C1"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AV3"
FT                   /transl_table=1
FT                   /translation="MTDREGPLPSNALRSHSTSMNSLFSFQNENSYSSILEYYDGAAES
FT                   PPPSLTQEAGEEGSPLTLNYDGRHWNALREAPVLQGTEKFLVVLVGLPAVGKSTISGHL
FT                   IRFLQNNPRLSHLRCGVFNAGQVRRDLTYSGRSMKLANSSGEDLFNPKNSDKKNMYARI
FT                   TLERLFRELDADRCDIAIFDATNSTISRRRFIFQQVHEYNTRLGSDINITPIVLQVTCN
FT                   DENFIRFNIHNKTFNQDYFDKPYEYAVRDFAQRLKHYYTQYVPFTEDEFTTTIEAYMHI
FT                   EGRTPGTYRGSLFFFSIINAGLDTDLSAPKVGFAPQISSAVAEVVAAFGDFVDHYAQMY
FT                   GHKYITHANEFMKNGRNTIPSLGNEPISLTSRPSYLSTLCSIIDDQYFNSLHSLRK"
FT   CDS_pept        complement(379274..379873)
FT                   /codon_start=1
FT                   /gene_family="HOG000000771" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079823"
FT                   /gene_name="MED7"
FT                   /locus_tag="ADL182C"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 7"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="AAS51738.1"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG058595"
FT                   /db_xref="HOGENOM:HBG396607"
FT                   /db_xref="HSSP:1YKH"
FT                   /db_xref="InterPro:IPR009244"
FT                   /db_xref="UniParc:UPI00002529C2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AV2"
FT                   /transl_table=1
FT                   /translation="MSDSNNISSLYPPPPPYVKFFTKDNLERLAEYQSSHVTTDPEQIT
FT                   CELDFLIPPPVPSAGHYRAFGSVWQVKDELPDLETVGLRNLYDDRGQHGNNYQYKIKEL
FT                   HKLLKSLLLNMLELVSVLSVNPERFPDKVEHIRTILFNIHHLLNEYRPHQSRESLIMLL
FT                   EEQLEHKKEEIANIHAICDKVQAKLAAMCKQYIADD"
FT   CDS_pept        380121..380450
FT                   /codon_start=1
FT                   /gene_family="HOG000171951" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752328"
FT                   /locus_tag="AGOS_ADL181W"
FT                   /product="ADL181Wp"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS51739.2"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG346242"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0001DB2A3F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AV1"
FT                   /transl_table=1
FT                   /translation="MDVDEPYEATTAPSEGEAPKKKFQIKKWTAVAFWSWDIAVENCAI
FT                   CRNHIMEPCIQCQPNAMTDTENECVAAWGTCNHAFHLHCINKWLLTRNACPLDNKTWQF
FT                   AKYGK"
FT   CDS_pept        complement(380515..381477)
FT                   /codon_start=1
FT                   /gene_family="HOG000018970" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752329"
FT                   /locus_tag="ADL180C"
FT                   /orf_name="AGOS_ADL180C"
FT                   /product="ADL180Cp"
FT                   /function="prephenate dehydratase activity"
FT                   /biological_process="L-phenylalanine biosynthetic process "
FT                   /protein_id="AAS51740.1"
FT                   /db_xref="GO:0004664"
FT                   /db_xref="GO:0009094"
FT                   /db_xref="HOGENOM:HBG411300"
FT                   /db_xref="HOGENOM:HBG693866"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="UniParc:UPI00002529C4"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AV0"
FT                   /transl_table=1
FT                   /translation="MTRIAYLGPSGTYTHQATIQQFGVEDNEMIPMVSIQKCFSALLKD
FT                   ESISYAVLPAENSTNGQVVFTYDLLRDYMLETPNAARGCMLPGFAIVAEQYVAVEHCLA
FT                   SPLPMTADELKNANIERIYSHPQVWGQVGKYLEELARVTGKALSRCDAGSTSQAVDRCL
FT                   RDYREDKTVTLAIASALACRISGAHIVQSHISDVADNTTRFLIIQRRKQEPLQILPGRQ
FT                   PTPSGERIHLVAFTTDRQGAGSLTDVLLVLKRYGIDMRSITSRPFRRCSTSSKWQYVFF
FT                   VEYSDELDVPWDSFHAEVGAHCREWCHWGTFYRNNRYYS"
FT   CDS_pept        complement(381671..382624)
FT                   /codon_start=1
FT                   /gene_family="HOG000034183" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752330"
FT                   /locus_tag="AGOS_ADL179C"
FT                   /product="ADL179Cp"
FT                   /biological_process="protein complex assembly"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="AAS51741.2"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006461"
FT                   /db_xref="HOGENOM:HBG058597"
FT                   /db_xref="InterPro:IPR010591"
FT                   /db_xref="UniParc:UPI0001DB2A40"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AU9"
FT                   /transl_table=1
FT                   /translation="MSSLGRSVFNRAFDNCKRAALLNKRGLEPWTPRYWYSSKTVEDRY
FT                   REKLLETARSKGFKTIEELKANLKDELEARKQKLNRIDPLKELEAYEQRTKMAENNAKA
FT                   ARLRGPVDASTPRAPFKTLDSYLDVEKIRQLSKQEVEFLWRARWMNKDGVLNAVVPVDV
FT                   FERMSGYARANPAFVLPLQRDATGAGEEQGGQPVEMHYVQWQFVGPKTVHCIITSLAEF
FT                   KLHKEFARPHSTFQFHLELADQKKVVFMNGQIESDSNVTLQDAQLLLLNVQRFYGAMGD
FT                   ATQAAKQRIKILQDFTAGSVDFKVDDLIALAQSLET"
FT   CDS_pept        382988..383776
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752331"
FT                   /locus_tag="ADL178W"
FT                   /orf_name="AGOS_ADL178W"
FT                   /product="ADL178Wp"
FT                   /protein_id="AAS51742.1"
FT                   /db_xref="HOGENOM:HBG058598"
FT                   /db_xref="UniParc:UPI00002529C6"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AU8"
FT                   /transl_table=1
FT                   /translation="MMSSAAADDLLLELMDEFQPHLQSHRHKLQTWRRLLREFNRRTGG
FT                   SIRQERTLRMRFERMKETLESGGEVHVLQPGLLETLVREYNGSRGGNRRVEVGEHEWNG
FT                   CQPAGFEPLGSDLTSGTNSADEREESEPPPLDTMDVFPATEMRLLVERERYNLLRQSLV
FT                   SFDDCSPEAGLSGGSSYCGSTSSHTSLLTPALSMKGVCTDGLHEVGRQLQSQAVLDIIC
FT                   GELQQLRQQQETLEQHIFERLDRLAALLAQKPENAGVRGH"
FT   CDS_pept        complement(383809..386526)
FT                   /codon_start=1
FT                   /gene_family="HOG000248450" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079824"
FT                   /locus_tag="AGOS_ADL177C"
FT                   /product="ADL177Cp"
FT                   /function="binding"
FT                   /protein_id="AAS51743.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG434583"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001DB2A41"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AU7"
FT                   /transl_table=1
FT                   /translation="MDAYSVLLNAHLLLASPVNALADKSGCDAVELSWARNILSSKSYS
FT                   VVADAFAGVIFDLGEVADEQGLLAALQLTVRQMVAENRGKSLLVAVALLQTFIQNNYTG
FT                   PVVPLDFERDVLRCGEKGADLKRWLVTLLSVQGQIAYELCTNPAYLVLALLFLEELTGA
FT                   QSLFLQSAEDIAVPSISADGTAPLEAVAHWWRFRALLVQISLIAEPVGPQPLIASSLLD
FT                   SIELVHAVVRGLPVDTPETLKRQLYVIYYLENVKCALSINTEHLCLPVLQKVQKLTDFQ
FT                   FVLTGARAKRTKFQQKAHAGLIILARSSSASLNEQEGDAASAPGALALNSDLLFEKPHF
FT                   ESIGNEPLEEQLIKKQKLDGTAGLDETRLLPVALRQEDIPIELREVDPNNQPRLSDYDN
FT                   IQLLLRLYAIRQTSPARDPIVDEELASIIGRVVYQDGQKNWSVFARALWERSVLETTKA
FT                   KTIERGILQMQSLVEELGLKIQHRYTPESDAEELTPASDRMKYIHQLPFLPRWALDREL
FT                   AEKYMSMGILRSAVEIYERLELHCDAALCYAAVGDEKQASLILQKRIENNPNDARAYSI
FT                   LGDIRQDPALWEKSWEVGKYVNAKNSLGKFYYSPPANSGVSRDFNLSLKHLNDSLRLYP
FT                   LSFDTWYFYGCIGLECGKVDLAAEAFSRCVALDDTHALSWSNLSAAYTEQGKIKEAHSC
FT                   LKRAIASDSQRNWRIWENYMTVSVKLHEWEDVLLACRHLIELGRDKKGERAIDMPVLEK
FT                   LSELLTSTDYPGDPQMLSYFQRSCVSLICELLPSVITSSARCWRIVARVELWRKRPYAA
FT                   LECHEKAYRSMAHNPDLEINEGVWNSTVDTCEELVAAYESLGPMEGKHGAGDLVCKDWK
FT                   YKARSTIKSLLNKGRNSWEGSEGWEKLVQLRNNL"
FT   CDS_pept        join(386736..386742,386801..387621)
FT                   /codon_start=1
FT                   /gene_family="HOG000248662" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775576"
FT                   /locus_tag="ADL176W"
FT                   /orf_name="AGOS_ADL176W"
FT                   /product="ADL176Wp"
FT                   /function="nucleic acid binding"
FT                   /protein_id="AAS51744.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG176493"
FT                   /db_xref="HOGENOM:HBG512106"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014646"
FT                   /db_xref="InterPro:IPR014892"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI00002529C8"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AU6"
FT                   /transl_table=1
FT                   /translation="MATYQQPFNEFSTVTGGGFDSQASAGRPGSTGGQSTATLTPVTIK
FT                   QILEAKQQVQDGPYVVHSMELHNICFVGVVRNVVDNTANVNVTVEDGTGQIEFRQWSND
FT                   QKDMERASQGETAEYNSELSQQFQIGNYVKVFATLREFGGKMNIQYALVKPVENFNEVL
FT                   AHHLAAIKCYALANGRLAPPAAPFNAAAGAQGGQSLFVQDNDYSSAKPATQRILDFCRD
FT                   QCKDKDANTFSVHTKFIAQSLSMLEDDVRMHCQTLTEQGFIYPTFDENSYFTL"
FT   CDS_pept        387873..389297
FT                   /codon_start=1
FT                   /gene_family="HOG000164982" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079825"
FT                   /locus_tag="ADL175W"
FT                   /orf_name="AGOS_ADL175W"
FT                   /product="ADL175Wp"
FT                   /function="catalytic activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="AAS51745.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG056738"
FT                   /db_xref="HOGENOM:HBG737647"
FT                   /db_xref="InterPro:IPR004886"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI00002529C9"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AU5"
FT                   /transl_table=1
FT                   /translation="MVTRTSIRLLYSILFILHARAFIHPIEIRGKHFVDSFTEQPFFIK
FT                   GLDYQPGGSSRVDGKQDPLSDPQKCARDIMLFQQLGINTIRVYSLNPDLNHDVCMTMLA
FT                   AAGIYLFLDVNSPLQNQHLNRYEPWSTYSEPYLQHVFKLIEQFSHYNNTLGFFAGNEVV
FT                   NDGRSAQTSPPYLKALVGDMKQYIARHSPRPIPVGYSAVDDLKFRVSLARYLECYDANN
FT                   KFNDVDFYGVNSYQWCGQQTFQTSGYDKLVDAYREYSKPVFFSEFGCNEVLPRQFQEVE
FT                   ALYSKEMYTVFSGGLVYEFNQEANNYGLVDSDAEGNIKLLPDFDTLKKVYGKVHMPTAE
FT                   DLQRGLEKDRAAAMAVSSKSRCVQQYDNLEITIAVPNLANSMIRNGVQVEPGSYVDLSE
FT                   DKLRTTYKIFDVSGKEILKGSRVEVVEVFDGSNLAKMRKLRRARYRNGAATSFPTSAIV
FT                   LTTIGIIELLFQFSVI"
FT   CDS_pept        complement(389338..391407)
FT                   /codon_start=1
FT                   /gene_family="HOG000141854" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079826"
FT                   /locus_tag="AGOS_ADL174C"
FT                   /product="ADL174Cp"
FT                   /protein_id="AAS51746.2"
FT                   /db_xref="HOGENOM:HBG058599"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniParc:UPI0001DB2A42"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AU4"
FT                   /transl_table=1
FT                   /translation="MRRLQLFKGNRATRCQEDGSCSRTAARRSAQTVGLLDLPPAALER
FT                   IAQFLDKQGVRALGMASKALYEGVCHKLLYRNVTIESKKQLLKFNATLASSLRALCVGD
FT                   SITRGQWHADTVLCIEFVNPESNDSLPSSYGSFNQGTAHTLYGSSVFSGFQRKCYAQRP
FT                   SRINLDGLSNKHILSMFGHNDPDAHFDCLESEYVQYTYLELMVAALDRLSKLQRVILSD
FT                   IAPSFVVPIRFSVLNDGSAAFAKLVENPKRSMTREDLRDFKLSSTWLKEYKKKYRNLPS
FT                   YRTVELRAARCKAPVNLRPSLLCCFGTFQELILSNFALSNESFDTPFEYLPMQLIEGSK
FT                   GVWDLSSPASSLVLDACYVLPGSGIMSGLHSYFAQVSHLALFGIRSLCDILLCRCLPAL
FT                   CELSIDCASKCFLSHEPVESDYYTGAAFEFNAQDNESTVETLVERIAPLTLLAPPPTTA
FT                   VVILLNHGILNRSMHSYPRKAGTITTEQEKYFTSFGISKFYYSFHYFKSLWDRISNENI
FT                   NLKLINVSFTNVCPLEPQEFWQRFRNYQNDDQATISGIISIHSPAFASITRNTWDSDFI
FT                   EHYLSYFNANEEIDITSSPASYQDNGDTAIVDPSMLNNYHDLKMFKDIPDANFWFFLNI
FT                   VSGFKSVDFHVCDVNVLFGSFDWERMLGPILLGRKPLKIKDCRGNIRFSYDPCG"
FT   CDS_pept        complement(391567..392139)
FT                   /codon_start=1
FT                   /gene_family="HOG000141576" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20623067"
FT                   /locus_tag="ADL173C"
FT                   /orf_name="AGOS_ADL173C"
FT                   /product="ADL173Cp"
FT                   /protein_id="AAS51747.1"
FT                   /db_xref="HOGENOM:HBG058600"
FT                   /db_xref="HOGENOM:HBG448469"
FT                   /db_xref="InterPro:IPR007853"
FT                   /db_xref="UniParc:UPI00002529CB"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AU3"
FT                   /transl_table=1
FT                   /translation="MLRRSMGPLRIAGLLRPSRNCMQYVLGPVFGGHLVAHRFHSGSPQ
FT                   LQNSQKPPIADEFRHIGSIKVDKPMMMIAFTCKKCDTRSSHTMSKQAYTKGTVLIQCPG
FT                   CKNRHLIADHLKIFRDDSVTVQDILAAKGESVSLTTEDLAFEDIPEQLRPLIGHHASDA
FT                   PEELRRKLDNETLHALPAQDGEKQGSS"
FT   CDS_pept        392313..393374
FT                   /codon_start=1
FT                   /gene_family="HOG000000865" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079827"
FT                   /locus_tag="ADL172W"
FT                   /orf_name="AGOS_ADL172W"
FT                   /product="ADL172Wp"
FT                   /protein_id="AAS51748.1"
FT                   /db_xref="HOGENOM:HBG058601"
FT                   /db_xref="UniParc:UPI00002529CC"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AU2"
FT                   /transl_table=1
FT                   /translation="MSLDMDTRPLSPQKEQEIASKILQRAELAQMTRQLKLGLSRVASP
FT                   KKGSSAASCPNAVNKTAVLRGPGPRMKDGLGVCMGAIAGRCSPIKMSRSAPAISRLLLG
FT                   KAKTGCATTPDEKENEEGQSPAKRHKQGAGAADGRGGPQRGALMDMIKPLPSTPKSHRE
FT                   AAPRRPAVGASAGTLPHGSEDVGADLLMYLATSPYASAAKQHHTSSPRVPMTPSYLHHA
FT                   SSAGDPRPAQAWQHPSPHAVPKMSQNYAAAQAGASPSMLLGQEAFHELGDSPGMSMYMS
FT                   PQTHRLKGNGGYLLPTASISDPSVLGDTGRPPSSQSLTSHLLRTPNFNMNDYVHNLFSP
FT                   SPRIDPPGSSGNI"
FT   CDS_pept        393670..396069
FT                   /codon_start=1
FT                   /gene_family="HOG000171963" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752332"
FT                   /locus_tag="ADL171W"
FT                   /orf_name="AGOS_ADL171W"
FT                   /product="ADL171Wp"
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS51749.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="HOGENOM:HBG058602"
FT                   /db_xref="HOGENOM:HBG396603"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniParc:UPI00002529CD"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AU1"
FT                   /transl_table=1
FT                   /translation="MSNPKERNDDGRLSPCASVEPSLMSTRTEDHNDLYDHRQHPVAIA
FT                   RKQSVADDSGPMGRNVLTNPRGSSEKQKSREENSQARLGRIRSGKLVDESQDEYPEHVR
FT                   PIPRATVSKSSAGWPARAPHSASQQTLYGFPRERADTEKDAGVSGTDGGLKSRRGSRTL
FT                   SIVDTGLRRKMSRAQSETSSQGGNLHFLSRTFSHKSQDSGLVNVRRNRRMSADSDDSNA
FT                   SRESQETEEDVCFPMQQPEHTRINGIDFDELEEFAQESLRANLTMNINVGVSKGDDVDM
FT                   KCSGSPGSSTGTSTSISSAAMKYTPKGNFKQKDSSNETAPGISFGNNKVETGEYLPMND
FT                   LSSYANESAAYDTMDNGNIPADNYKIPDRFSFFCSEAGETVHAPDIPSLVQDGETFREL
FT                   FRDGAVTWWLDCSCPTDEEMRCIAKAFGIHPLTAEDIRMQEPREKVELFKSYYFVCFHT
FT                   FENDPESADFLEPINMYIVVFRNGVLTFHFSPVSHSANVRRRVRQLRDYVDVNSDWICY
FT                   ALIDDITDSFAPVIQTIEYEADVIEDCVFMTGDLDVSRMLQTIGEGRRKTMTLMRLLSG
FT                   KADVIKMFAKRCQDEANGIGPALTSEINIANLQASGHDPLSARLGSNIQHHHVQRTQPR
FT                   ADIALYLGDIQDHVLTMFQNLLSYEKIFSRSHGNYLAQLQVESFRCNNRVTEMLGKVTM
FT                   IGTMLVPLNLVTGLFGMNVTVPGEATGELHWFFGILAILVGSAVGLWFLSSWWISKANS
FT                   PRSLNDTVMSGTRSILNFARRNRNDQCRPEGNKSVISCPSKYARYY"
FT   CDS_pept        complement(396251..397882)
FT                   /codon_start=1
FT                   /gene_family="HOG000248807" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079828"
FT                   /locus_tag="AGOS_ADL170C"
FT                   /product="ADL170Cp"
FT                   /protein_id="AAS51750.2"
FT                   /db_xref="HOGENOM:HBG359175"
FT                   /db_xref="InterPro:IPR007851"
FT                   /db_xref="InterPro:IPR018034"
FT                   /db_xref="UniParc:UPI0001DB2A43"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AU0"
FT                   /transl_table=1
FT                   /translation="MPRKKSAAKKAKEAAKKAELEAQAAVIEDVPEENHTASDEESTSE
FT                   EEDDYGELITEDVEEGIKNVLEAIRTKDTSELLNPTVRFFEEPEAAVAKLAQAERHKPI
FT                   YLKDYHRMNLLAGETFAKDGEDFETMDGKPSFAAEQRQERAQILAEINEEVGKAEEDDE
FT                   DEFLTKKKPSSEVAQKTALPDPSVDDEQFLQAFVEQQAWIPRKGDKTVDLDRGEAFEED
FT                   DKEFEDAVEQFETAYNFRYEDPNAAEIVSYARTQATIRRSAASTRKRKRDEEKQEKDKD
FT                   RQEREKAIQKKKKETVYQLSDVLDKIRKEYGAEISEPMVQKLTATLLNGSYDDSKWDEV
FT                   VGELFDEEFYQQEGKPTWDENDEIMGDFYAGNADDDDDAAPTEDHANGEKEKKSKKEGT
FT                   KEKKAKKQEKKELRNIIEESVEQNKLALIEKVEEERGRTKEKDLDIKFRYREVSPESFG
FT                   LTTREIFMADDAALNEYIGLKKFAPYRAKELRNKDKRKVMKAKRLKEWRKKVFNNENGL
FT                   ADEDEALDTQAAPKKEKSRSKHKTSK"
FT   CDS_pept        398277..398807
FT                   /codon_start=1
FT                   /gene_family="HOG000200861" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775577"
FT                   /locus_tag="ADL169W"
FT                   /orf_name="AGOS_ADL169W"
FT                   /product="ADL169Wp"
FT                   /protein_id="AAS51751.1"
FT                   /db_xref="HOGENOM:HBG056182"
FT                   /db_xref="HOGENOM:HBG328134"
FT                   /db_xref="InterPro:IPR007919"
FT                   /db_xref="UniParc:UPI00002529CF"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AT9"
FT                   /transl_table=1
FT                   /translation="MDQDQNRLFRLPFHLPHRLVTRKGGVYLAGALYVLGIWLFVDCLL
FT                   YSKYVNPSKLHVTFVDWIPVLCSTSGMLVVSMIDKNRLLEDALASGSFVGSNQRAWQAQ
FT                   MVLFLGFALLAGGFAGALAVLVLKFLVKGYNTYPVLTMGVNNVLGNLFIMLSCIVLWMA
FT                   QSVEDEYSYSLTL"
FT   CDS_pept        complement(398959..400047)
FT                   /codon_start=1
FT                   /gene_family="HOG000233017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752333"
FT                   /locus_tag="ADL168C"
FT                   /orf_name="AGOS_ADL168C"
FT                   /product="ADL168Cp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS51752.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="HSSP:1KE8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00002529D0"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AT8"
FT                   /transl_table=1
FT                   /translation="MSQQDQFIADDVTSNQSNVTRQMLVKEYKRIGHGAFGTVVQAYLT
FT                   PDNEKWYGPFAIKKVPAQTEYKSRELAILRIADHPNVVKLEYFFTHVSPSDGKVYQHLA
FT                   MECLPETLQHEILRYTQNKLELPLKHIKMYTYQIARGMLYLHALGICHRDIKPSNILVD
FT                   PKSGVLKICDFGSAKKLEQNQPSISYICSRFYRAPELIVGCTQYTTQIDIWGLGCVIGE
FT                   MLIGKAVFQGQEPLLQLHEIAKLLGPPDKKFIFFSNPSYGGPLFSKPLFNGTPQQRFEK
FT                   YFGHAGPEGIDLLMKVLCYSPERRLSPRRVLCHAFLDELRNDRYFFPAGSSQPKQMPEL
FT                   FDFSEFELEIIGTLLPSIVGHE"
FT   CDS_pept        400300..400899
FT                   /codon_start=1
FT                   /gene_family="HOG000094284" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20623068"
FT                   /locus_tag="ADL167W"
FT                   /orf_name="AGOS_ADL167W"
FT                   /product="ADL167Wp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS51753.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG191219"
FT                   /db_xref="HOGENOM:HBG397603"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="UniParc:UPI00002529D1"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AT7"
FT                   /transl_table=1
FT                   /translation="MLGRGGMFSGLRALSTGAAAHNGATQYASLARSGMIVQPGADPRS
FT                   ANRKPDEQVVKYVLNCLFTKNNTHFTYSAVVEDRNFLANNAHLSYNDKFLYYLQLPQRV
FT                   RLHLSTGQLGFRKAARGEYEATFQTAAKLFQTLRERQLLDKGVEIIMKDFGKGREAFIA
FT                   ALNGKEGNQVRPAVTRVSDATPLKFGGVRAPRRRRL"
FT   CDS_pept        join(401022..401277,401502..401917)
FT                   /codon_start=1
FT                   /gene_family="HOG000231365" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15752334"
FT                   /locus_tag="ADL166W"
FT                   /orf_name="AGOS_ADL166W"
FT                   /product="ADL166Wp"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS51754.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG439330"
FT                   /db_xref="HOGENOM:HBG532383"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR005633"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniParc:UPI00002529D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AT6"
FT                   /transl_table=1
FT                   /translation="MGVCLLKFEFSAWRSVEPGGPSWARTPSSLPRETHPRAGTVGVGD
FT                   TATHYARAGTVKILNSVEARIQCIIASEEHIHSKTEMAPSAKATAAKKAVVKGTNGKKA
FT                   LKVRTSATFRLPKTLKLARSPKYSSKSVPHYNRLDAYKVIEKPINSETAMKKVEDGNTL
FT                   VFQVSLKANKHQIKKAVKELYEVDVLAVNTLVRPNGTKKAYVRLTADHDALDIANKIGY
FT                   I"
FT   CDS_pept        complement(402081..402854)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079829"
FT                   /locus_tag="AGOS_ADL165C"
FT                   /product="ADL165Cp"
FT                   /protein_id="AAS51755.2"
FT                   /db_xref="HOGENOM:HBG058603"
FT                   /db_xref="UniParc:UPI0001DB2A44"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AT5"
FT                   /transl_table=1
FT                   /translation="MSKSSKVHIGVRSFWGTLAMEARGWLRGNSAMEYTPPPSYNSIDL
FT                   ESQGKSGAIPAGLNPIILSCALWILTTTLAGLVLYYERAGTPAVLGSMIACLVAILCIV
FT                   FHINKLLKDNSRWLWTCLSYFPVLQLFICTLLFFSNRGLAYWVTVAAFSAVLMGTVLLY
FT                   CSYQSQEDWDQDTLWEQKNQIPLYAAPLMAIAALHITGLVQLQWIYRAYFIYLSVLLSL
FT                   TTKHVYLNTDVRSVLSSNGRINAIMLFMFLSLSVI"
FT   CDS_pept        complement(403018..404163)
FT                   /codon_start=1
FT                   /gene_family="HOG000213792" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752335"
FT                   /locus_tag="ADL164C"
FT                   /orf_name="AGOS_ADL164C"
FT                   /product="ADL164Cp"
FT                   /function="L-malate dehydrogenase activity"
FT                   /function="binding"
FT                   /biological_process="glycolysis"
FT                   /biological_process="malate metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS51756.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0006108"
FT                   /db_xref="GO:0030060"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG242477"
FT                   /db_xref="HOGENOM:HBG566126"
FT                   /db_xref="HSSP:1BDM"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="UniParc:UPI00002529D4"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AT4"
FT                   /transl_table=1
FT                   /translation="MQASTYYVISNMPHTTADSSTQRVRVAVLGAAGGIGQPLSLLLKT
FT                   QLAQVLGDANASLELALYDVAADALAGVAADLSHVNTPVEVSHHVPSSREDEEALREAL
FT                   TGASVVVIPAGVPRKPGMTRDDLININAGIIKTLAKGIAGACDLEKVFVLVISNPVNSL
FT                   VPVMVRQLIRHAEAKQAPHAGVERRVFGVTQLDMVRASAFVRSLGELGNEVPSVPVIGG
FT                   HSGETILPLFGPVQQRLQFSLEQRKKLTHRVQYGGDEIVAAKKGAGSATLSMAYAAYVV
FT                   AERFTNLVLGNVSEIQETLYVSLYDRENKPIAEGAAELLSNIGETPYFAVPVKISADAG
FT                   VVRVEHEVWQQLDDYDREHLLPACLEGLRKNIETGETLGSN"
FT   CDS_pept        404413..405741
FT                   /codon_start=1
FT                   /gene_family="HOG000000772" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18928577"
FT                   /gene_name="TRM13"
FT                   /locus_tag="ADL163W"
FT                   /product="tRNA guanosine-2'-O-methyltransferase TRM13 "
FT                   /EC_number="2.1.1.-"
FT                   /function="metal ion binding"
FT                   /function="methyltransferase activity"
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="AAS51757.2"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG058604"
FT                   /db_xref="HOGENOM:HBG398107"
FT                   /db_xref="InterPro:IPR007871"
FT                   /db_xref="InterPro:IPR021721"
FT                   /db_xref="InterPro:IPR022776"
FT                   /db_xref="UniParc:UPI0001DB2A45"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AT3"
FT                   /transl_table=1
FT                   /translation="MEASSLVAERPTGGEQDPGHARCAFYLPRKRRSCGMAPKAGARFC
FT                   AEHQPGDSGTAARVPCPLDPRHTVAKAQLRSHLARCNRTKQDQALRAEREHMPWYEAGV
FT                   NSAARPAAAAADEATLQAAVMRAIPVLAQIAEAEFRAPLRVAVLSNAQVEHVRFPQLPS
FT                   NRKHALQQSSLIQHLREAGLWVAPERPVAYVEFGCGRGELSRYINQAAVLEQLERGGPA
FT                   APPAFVLVDRACPRMKFDSKFAEDVAELHARFCPSVPPDERPAPAVTRKKIDIRDLRLA
FT                   ALLSPGLEHIAVSKHLCGVATDLTLRCLAAGPRASLCGALIAMCCRHACNPAEYANPAY
FT                   VEALLARHAPDMSYDLFFLALMKMASWAVSGRRPGVPDTEVGGHFSGLAIAERERLGHL
FT                   ARRLVDEGRRQYFADLGYDAELLVYCERDTSREDIALLVRRPA"
FT   CDS_pept        406043..407257
FT                   /codon_start=1
FT                   /gene_family="HOG000141968" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928578"
FT                   /locus_tag="AGOS_ADL162W"
FT                   /product="ADL162Wp"
FT                   /function="GTP binding"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="AAS51758.2"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="HOGENOM:HBG058605"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR015598"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI0001DB2A46"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AT2"
FT                   /transl_table=1
FT                   /translation="MSGKRKLYVRTSSEPTSPQQSHVGVFGETVPLEALRRRVITPSRQ
FT                   QSMVERHVPAVSRARDTGLEYTDGAHASSIKLLLIGNAGVGKTAMILSYSNELPTKSQL
FT                   WQQSPQLAAPNIDQRTKKRLKTVDARKRYSLNDYEELFARDARSIEDAGREDGDEVVIE
FT                   TKSTIGVDIKTSFVDIDRQLFKVIMWDTAGQERYRNAMVPSLYKGTQGIILSYDICSRE
FT                   TFRDCLEHWLPEALEHCQVEHTRFYLVGNKVDLYKQRQVTHADVLAFADEAKRRYGFEI
FT                   SGKFELSCKWQHVVERAFSLIIKDLVEHGCYEDNFLDTCTDNNDEDDDNYGATMRDNEE
FT                   HDDDEADTCVCDAATNLPGMQARKLTSAQGRRSPESNSRNTNIDITKPIHKDGSPGAAK
FT                   SSCCS"
FT   CDS_pept        complement(407254..408564)
FT                   /codon_start=1
FT                   /gene_family="HOG000191866" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752336"
FT                   /locus_tag="ADL161C"
FT                   /orf_name="AGOS_ADL161C"
FT                   /product="ADL161Cp"
FT                   /function="methyltransferase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="AAS51759.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG026232"
FT                   /db_xref="HOGENOM:HBG738188"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="InterPro:IPR016691"
FT                   /db_xref="UniParc:UPI00002529D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AT1"
FT                   /transl_table=1
FT                   /translation="MGKKYLLFMVQVHVNFRRAELESLAELHGVKVDFSSYREDSPFMV
FT                   VELEGDEQARQWIRRAILCRAIYEYWGEGADYAELHASVRGNADVAAYTAACRESTFKF
FT                   EFESYGGAGNGRFDRVAQIEQFAYLGLEGKIRLKAPQETFTVVERYENVTENIGGEKPV
FT                   HLYFGRLVQRSDRLQGALEKYDLKKRPYKGTTSFEAELSLVSANIAQVKPMHLMYDPFA
FT                   GTGSFLVAGSHYGALVVGSDIDGRMIRGKGSQTIGANFRHYGESHRFLDVLTMDFTHNA
FT                   LREGLPVDTILCDPPYGIRESIKVLGAREPERFRGKEDVEIDGVKAYLRPDYIPTKKPC
FT                   SLDAMLDQLLQFSAERLPIGGRLAFWMPTANDDNVETIVPLHPNLELLYNCVQEFNKWS
FT                   RRLLVYANRGPDFNGPTNSGAQRTKTKFRDRYFSGFN"
FT   CDS_pept        409129..410709
FT                   /codon_start=1
FT                   /gene_family="HOG000248803" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752337"
FT                   /locus_tag="AGOS_ADL160W"
FT                   /product="ADL160Wp"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAS51760.2"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG058606"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0001DB2A47"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AT0"
FT                   /transl_table=1
FT                   /translation="MSFSDEEDFDDIYGDDNKQNSETAVAAGKRKADGEAGAGPTSKEE
FT                   AARGADNSGASAAETTTTPASSLDQLAALQVLSSNLNQLQQSTNNNSNNNTNSSDSTSN
FT                   DSNKGNVPDQMLARGMPDLSQLQQLQQTMNQLQQQAAPLTQQQQQEAKQVKADLSRDIN
FT                   KMFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSFADASSVDEVVK
FT                   TQHILDGKVIDPKRAIPREEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGSIIDAQLMLD
FT                   KDTGRSRGFGFITYDSPDAVDRVCQNKFIEFKGKRIEIKRAEPRQVQKQRTTNASPTGQ
FT                   PFSLNTSQAPQPPQQQFQMMANPMMANPLFNPQAMADYYAKMQEYYQQSGIDYSQMYQQ
FT                   QMQQMQQMMSMMTGGNAPAGGMPAGANGAGGNGDDTNGVPTIGEDSSSTSSGKDNNDKE
FT                   SSNNRHDSYGNRDRERSPDARRGHRNYNDREEGGHGFRRENRDRGFRGRERRGGGYGRD
FT                   RRGYHPYSR"
FT   CDS_pept        complement(410944..412590)
FT                   /codon_start=1
FT                   /gene_family="HOG000152204" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752338"
FT                   /locus_tag="ADL159C"
FT                   /orf_name="AGOS_ADL159C"
FT                   /product="ADL159Cp"
FT                   /function="transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS51761.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG312498"
FT                   /db_xref="HOGENOM:HBG370455"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniParc:UPI00002529D9"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AS9"
FT                   /transl_table=1
FT                   /translation="MPAAHETESPPIQTLGQRKRQQNEKVDQKWKTLPEDMSAGSEIPM
FT                   GSKCHGAEPVPRKSIWQRAREIFLKYMKFVGPGLMISVAYMDPGNYATDVSAGASHKFA
FT                   LLCIVLYSGLIAIFLQSLCIKLGTVTGLDLSRACREYFPRWLNITLYVLSEAAIIATDI
FT                   AEVIGGAIALNILLKIPLPAGAVITCTDVLLVLLAYTPGTSSMRLVRVFELGVATLVLG
FT                   VTVCLCIDLAYIPSTTSVAKIFRGFIPSREIFQNNGMYAAVGILGATVMPHSLFLGSGI
FT                   VQPRLLEYDVQHGHYSMDIDSDDDSSLENKTSRQTKESRFLDYRPSIYAIRYAMKYSII
FT                   EVSVALLTFALFINCAILIVSGSALYDTPEAIDADLYTIHHLLSNTLAPAAGTIFMLAL
FT                   LFSGQSAGIVCTIAGQIVCEGHIRWTITPWKRRILTRAIALIPTLAVSTALGKNGLSQA
FT                   LNASQVALSVLLPFLTAPLIYFTCSKRIMSVKVSKPMPDGVPADEEEQTPEYVDMSNGW
FT                   ITSLAAIFIWIFISFLNIYAIVQLGLTSRQT"
FT   tRNA            complement(413167..413240)
FT                   /gene_name="tRNA-Ile"
FT   CDS_pept        join(complement(414450..414469),complement(413688..414105))
FT                   /codon_start=1
FT                   /gene_family="HOG000230649" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775578"
FT                   /locus_tag="ADL158C"
FT                   /orf_name="AGOS_ADL158C"
FT                   /product="ADL158Cp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS51762.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG210561"
FT                   /db_xref="HOGENOM:HBG594417"
FT                   /db_xref="InterPro:IPR001266"
FT                   /db_xref="InterPro:IPR018277"
FT                   /db_xref="UniParc:UPI00002529DA"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AS8"
FT                   /transl_table=1
FT                   /translation="MPGVSVRDVPAQEFINAYASFLQRQGKLEVPGYVDIVKTSAGNEM
FT                   PPQDSEGWFYKRAASVARHIYLRKQVGVGKLNKLYGGAKNRGVRPHKHVDASGSINRRV
FT                   LQALEKIGVVEISPKGGRRISENGQRDLDRIAAQTLEEDEE"
FT   CDS_pept        join(complement(416038..416149),complement(415331..415779))
FT                   /codon_start=1
FT                   /gene_family="HOG000213425" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079830"
FT                   /locus_tag="ADL157C"
FT                   /orf_name="AGOS_ADL157C"
FT                   /product="ADL157Cp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS51763.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG007660"
FT                   /db_xref="HOGENOM:HBG499813"
FT                   /db_xref="InterPro:IPR000039"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="UniParc:UPI00002529DB"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AS7"
FT                   /transl_table=1
FT                   /translation="MGIDHASKQHKRSGHRTAPKSDNVYLKLLVKLYSFLARRTDAPFN
FT                   KVILRSLFLSKTNRPPVSISAIARALKQEGSANKTIVVVGTVTADNRLFEFPKATVAAL
FT                   RFTAGARAAILKAGGEAITFDQLAVRAPKGQNTLIVRGPRASREAVRHFGMGPHKRKAP
FT                   RILSKGRKFERARGKRRSRGFKV"
FT   CDS_pept        complement(416499..417950)
FT                   /codon_start=1
FT                   /gene_family="HOG000162199" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928579"
FT                   /locus_tag="AGOS_ADL156C"
FT                   /product="ADL156Cp"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAS51764.2"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058607"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001DB2A48"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AS6"
FT                   /transl_table=1
FT                   /translation="MGRWSVLGNPDHEKAGGRLPLVTDDYMRDGQTRELRMKPPVADED
FT                   GAEEVLAADEKAATEATNELDVEEEYPDGGYRAWLTVLGSFVGIFPIWGTANALGAYEG
FT                   YISNHQLASSGAGEVSWIFALHMIACFVGCVFSGSYFDRNGGQKAIIVGSVLYVFGIFM
FT                   MSECTKLWHFILAFSLSSGVGAGILTTPLISCVATWFNRRRAVATSLATCGGSIGGIVI
FT                   PLILRRMYVTIGYKWALKVLALVFLVSLTFAAFLARERVTPRPKPFRSHRDTIRFYLST
FT                   SFNWRYFFDKRFLWCTLAFAFAENAICAIATYLSSYIITRGFPPSMPYNALTVVNAAGI
FT                   LGRYIPAYLADRYFGRFNVVIVMVLAAVIVNMAMLLPFGGNITVVWVFLCLYGFLTGSI
FT                   FSLTPVCIGQICRTADFGKYYSTAYLLNAVVTLPVLPVGGAIIGNGSIENYNKFIIFAS
FT                   AMMLLGAVCYIISRTYCVGLRWYKF"
FT   CDS_pept        complement(418828..420288)
FT                   /codon_start=1
FT                   /gene_family="HOG000162199" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752339"
FT                   /locus_tag="ADL155C"
FT                   /orf_name="AGOS_ADL155C"
FT                   /product="ADL155Cp"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAS51765.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058607"
FT                   /db_xref="HOGENOM:HBG396145"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI00002529DD"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AS5"
FT                   /transl_table=1
FT                   /translation="MVVIDKDSVQVRHGDEPVALDVSPSSDSGRATAVGDKELFGDGPT
FT                   TTCAQQTVPLSDEKVEEEERAYLDNSNEYPDGGLRAWLVVFGSFMGLFPVWGMYNTLGA
FT                   IEGYVSEHQLASNSTLEISWIFSLHLTIGCLCCVFSGSYFDRNGGQKAIIVGGALYVFG
FT                   IFMMSECTKVWQFVLSFSVSSGIGAGIVTTPLVSCVATWFNRRRAVATSLATCGSSIGG
FT                   IIMPLILRRMYVTIGFKWAIKVLALVFLVNMSLAVLLARERVTPKAEPFKSFKEGAMFY
FT                   TRTSLNWRYFLDARFLWCSIAFALGENSICVTATYISSYINKQGHPASMPYTALTVLNA
FT                   AALFGRYIPSYFADHHFGRFNVQIVMALLAGVLHLAMWLPFGGNVHVLWAWVCTYGFMS
FT                   GSVFSLSPVCISQICKTSDFGKYYSTAYLLNALVTLPIMPVAGAVIGNGSIRGYNNFII
FT                   FTSMLILCACIGYVISRAYCVGWRLCRF"
FT   CDS_pept        complement(420726..421319)
FT                   /codon_start=1
FT                   /gene_family="HOG000255884" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752340"
FT                   /locus_tag="ADL154C"
FT                   /orf_name="AGOS_ADL154C"
FT                   /product="ADL154Cp"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="AAS51766.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG491141"
FT                   /db_xref="HOGENOM:HBG493509"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI00002529DE"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AS4"
FT                   /transl_table=1
FT                   /translation="MYLIGPTRGVQSMFSSFRLASRHTTSVLRTFHTSKPIMLQAGDAI
FT                   PKSIPGLHENSPGNSVDIGAEVASGKHLIVGVPAAFSPACSSSHVPGYIQHLDELKSKG
FT                   FKQVLVTCVNDSFVTKAWAESLKCPSDVRVIADTQGAFASAGGFLFDGKQTFGNDRSVR
FT                   YALVVEDGKVVRDFVEPDKTGLKVSAAENVLKEL"
FT   CDS_pept        421478..423139
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15752341"
FT                   /gene_name="RRI2"
FT                   /gene_synonym="CSN10"
FT                   /locus_tag="ADL153W"
FT                   /product="COP9 signalosome complex subunit 10 "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="signalosome"
FT                   /protein_id="AAS51767.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008180"
FT                   /db_xref="HOGENOM:HBG058608"
FT                   /db_xref="UniParc:UPI00002529DF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AS3"
FT                   /transl_table=1
FT                   /translation="MSEGDAYEDFMMSEDEEMHYAEMEEDSDEMGVYEEETSQGAEEEV
FT                   PLDPSSSIVEGRYYRAKGLKENSKFREAIEALEGVATSSEPLWAFRALKQIAKCWNFKG
FT                   AQASEGYQDGVRTALVRLLEHGLRWRQKLGAAYVERSLISTLRMLVPANSQNFVFDEAH
FT                   EICLPTIEFHLRLLDAVAPLPGDFKDLCTLHMQLRLENLIWRERLRGADCTAILSEAPA
FT                   PQLTAETLLLLLQCHICRFLRLCQPPAQQFAELVSELQDRAERSLALAQQPHAMVLLAF
FT                   AQCMRGMQQQPQPHSALRTHFSACLQGLEEIGSNSSFFRDLNLCGFVLADALAYSAGRC
FT                   SHRVDPFALEQIRILRETPIVHNLQLLYESYVALDLPSFARALDLLAPFRSALAPLFAR
FT                   LCALARERKLWDAIAPLHSCIALADIQRLLCIGSSSLSRDSLLTLMMQGVMASSARVPF
FT                   RLDLTRDYVYFGDEPRVQLRAPAARPGLRHCAHDLGLTSACARPFQGSSALQLMDCLSE
FT                   HRNRAASAAADPADAVCRARQPLAAYRTLAALILDE"
FT   CDS_pept        423744..424982
FT                   /codon_start=1
FT                   /gene_family="HOG000142064" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20623069"
FT                   /locus_tag="ADL152W"
FT                   /orf_name="AGOS_ADL152W"
FT                   /product="ADL152Wp"
FT                   /protein_id="AAS51768.1"
FT                   /db_xref="HOGENOM:HBG058609"
FT                   /db_xref="HOGENOM:HBG202924"
FT                   /db_xref="InterPro:IPR022210"
FT                   /db_xref="UniParc:UPI00002529E0"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AS2"
FT                   /transl_table=1
FT                   /translation="MDIQANMELGGLERRVLDLERQISMYERLFQTFSAKLDHHFKKYD
FT                   LVINAQQQQINVLTDIVSTMLNDQYRYAGILRDKLRGSLDGIVTTSTSIRGMQPNGGMP
FT                   EQEPKPHDDDAVHAAHRANHHHAAADDGNRDLTNVDAILGEFIPPQVSPDENELHAAPA
FT                   APVPDAQTPAPKRNGGKKHPKGSVEHKFIISNGLKVPRRAVDPPAKRRREDPQKEYEFR
FT                   DAEFSALASDGHPLDAQSAPPAPQHHDYDHDDRALPLQRADRPLSTGASPDPSAPSSSR
FT                   LNSNIKEEQYYTHRGLKKKRKIYVGKFEFLNSPQTVLDIWKEYTEGFNGQPSLKDMETM
FT                   YQTSWRRDPAVNKRFHRRKVLCKAIERGLERGYDLQDVVRVLEDSRLIDASRNLKQPIG
FT                   WLCQGVNIPDLFK"
FT   CDS_pept        425213..426136
FT                   /codon_start=1
FT                   /gene_family="HOG000115506" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15752342"
FT                   /gene_name="PEX21"
FT                   /locus_tag="ADL151W"
FT                   /product="Peroxisomal membrane protein PEX21 "
FT                   /cellular_component="peroxisomal membrane"
FT                   /protein_id="AAS51769.1"
FT                   /db_xref="GO:0005778"
FT                   /db_xref="HOGENOM:HBG058611"
FT                   /db_xref="UniParc:UPI00002529E1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AS1"
FT                   /transl_table=1
FT                   /translation="MSLCQGSAMQKLIAKTEGPMAGVGRVGGFNRPSGGLGQSSAEQQL
FT                   QARAGERASQNRFMAVLEPQRELGGRMARGDGLQADWVRQFSSMQVEDPLAFSAEYQRA
FT                   YAGYEQRQAARPAARVLGYGGSMFMPTMPQQQLQQQVAPQQTAQAALQEAELERYLERE
FT                   FDVLEGELAPPEVPEALSAPLLDHEQLGFQESAKAIYATLSAPIHKDKFGASKFMGLMR
FT                   QVSTGDVTLSKSESGYTGLHMTAGGEAVGAEYRAVTDEVVQVPEVAAALPLAGEERSLA
FT                   SQMEDLLNKVDIAGLSSNEAAMRILS"
FT   CDS_pept        complement(426233..427327)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928580"
FT                   /locus_tag="AGOS_ADL150C"
FT                   /product="ADL150Cp"
FT                   /protein_id="AAS51770.2"
FT                   /db_xref="HOGENOM:HBG058612"
FT                   /db_xref="UniParc:UPI0001DB2A6D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AS0"
FT                   /transl_table=1
FT                   /translation="MEHNASDAVGTRDAGWQTDMCHRTSGTAEQGGSKNKGRGGRREQS
FT                   HIRAYSSASADGYRMHRNHTGGAESPGAEQGTPPRRNSVLKRRSLIQTIMSPEGGAASP
FT                   ERGRRSVSLYSPASAGSDEGDVGAMLQTLATRELALLEQRKTVEDLRRALRLEERVLVA
FT                   QARELEELKQRVARALDAGSPRAVLEPGAELPGAPGARESVWAKSMSFLNEFDQILQEG
FT                   LEKRLGFDELMPSPATDATTPEADDRRGIWGLVSEFKAGLLGLSDSTPPPDAPAAYLEK
FT                   QRNRSVGPEPRRTNTGDAVAEHSRDARYARKRDLHEQAYSPADAAAENGVVTGGRLGAT
FT                   PHSSGSIRKRCPPLSTSVEMQNYV"
FT   CDS_pept        427542..431177
FT                   /codon_start=1
FT                   /gene_family="HOG000000942" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775579"
FT                   /locus_tag="AGOS_ADL149W"
FT                   /product="ADL149Wp"
FT                   /protein_id="AAS51771.2"
FT                   /db_xref="HOGENOM:HBG189823"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI0001DB2A6E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AR9"
FT                   /transl_table=1
FT                   /translation="MAPFKFGKKNGKDKSVVGRATTGPEPVGAAGGPTGGSSRAAGRDA
FT                   RRPETPWDRVKLVQTPFPRYRHVASAYASDTNEVIVIGGLHDQSVYGDTWILRAQDNGK
FT                   QFSARTIEITETTPPPRVGHAATLCGNAFVIFGGDTHKTNNEGLMDDDVYLLNVNSHKW
FT                   TIPHPVGPRPLGRYGHKISIIATSQMKTKLYVFGGQFDDTYFNDLAVYDLSSFRRPDSH
FT                   WVFVKPASFVPPPLTNHTMVSYDYKLWVFGGDTPQGLINELFVYDPVVNDWSVVETTGA
FT                   KPPPLQEHAAVLYRDLMCVVGGKDDQDNYSQDVYFMNMKTFRWFKLPHFQDMVPSPRSG
FT                   HSVTLLANRKLLIMGGDKFDYARPGDADLMAADHDMRAGTILYTLDLTDLEEHCPGVFD
FT                   MAGVSPPRRTPSQSTSASSKNTAMTTPMMPRSSFTPATSPAQAKPNGVVNILSPHQESK
FT                   KRQPTDSHMYGDQQYKATPQQKTPPLKQSAKPPQQQHRSPHQTATQDLQKSTDSQGRKL
FT                   PQKKYAAQQNPKDYEEAADTTHSTEPLSTAESSQLPSDVTNASTEPADISTPQAHNRPG
FT                   LKPKSPVPHIIDNERSPRVASMQYTNPLEQGKNKRHSQIIEEYDGELGVAVVGNSPGKD
FT                   EVRRQSVDGSKPDGWAQPRTFGELAELPGSFTPQQLSDVERSPVLERSIPEAAVTSGRS
FT                   KEKSDNDDNSLAKEVSTGPVKKQNDQTDFGIPASAEVPVRAATRSPKELGRSATYEGVQ
FT                   RPQQNEGNSPDQVVRSSSVKDTPRSVEDDNLPHAKMKSDGRANNPFLQDTRFASPSKGS
FT                   SASEDDELEKPAGVTSRDLNDRSGSLRKNTESILSKRGTPDGHVSNEFVQQLFEELREL
FT                   KLQTERSAAEASNRIRLLEDENLKLRQPGHGPSHRGISGASEDVSYSKLQTEVDILKAD
FT                   KAVYADRVAELEEFLDSNILDAERLNRIIESQSKIIESFSDQESYKEKFEQIQKKLDAL
FT                   KKENEELRCKNISQMNKLQQDISNHSQAMRDMLKHWRAQGLSDSSEGGAEGVRNLQHHQ
FT                   SIINKLSAQLDAAEKEKSDLNHLHHELLRNYESLQQDYKALNDELVSKQNEVSYLEQNY
FT                   KSSLSSVNNASKALELSQRELGKLKNENTKLKEQLEDLTLSPSIDGRSKFANTLTDDPL
FT                   GSLNDAHYNLRIKDLKAELFIVRQERDSLKDELLQLKKRLFTMDD"
FT   CDS_pept        complement(431332..431937)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752343"
FT                   /locus_tag="AGOS_ADL148C"
FT                   /product="ADL148Cp"
FT                   /protein_id="AAS51772.2"
FT                   /db_xref="HOGENOM:HBG058613"
FT                   /db_xref="UniParc:UPI0001DB2A6F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AR8"
FT                   /transl_table=1
FT                   /translation="MIVSGCTPNRLPVSLSTGPRSRRPARVIGCPVLIAMRAEIVMANE
FT                   LIAQYQISGEVQQLFHIQNGVRTVGEETFEQIRRLARHKRVRASCLEYQLIQPTAKRAC
FT                   APEEWSVGSQATVSSLGYGAFGRGCSRMTSAGSILHSGSAGACKSGSHGSILQSEVMQQ
FT                   EESGVLESEATASQIIESEPAAVRSSPPPEMLGSSEFQ"
FT   CDS_pept        432064..434211
FT                   /codon_start=1
FT                   /gene_family="HOG000141832" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775580"
FT                   /locus_tag="AGOS_ADL147W"
FT                   /product="ADL147Wp"
FT                   /protein_id="AAS51773.2"
FT                   /db_xref="HOGENOM:HBG058614"
FT                   /db_xref="UniParc:UPI0001DB2A70"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AR7"
FT                   /transl_table=1
FT                   /translation="MLLRRSMLISNTPAISGYKSNVSFQDLTPALVDEQVTKIRKLRGT
FT                   PSLSSALVHIPPHLNPLYVDTSVDDDEDGEEREYGKGIRRPSLNMDLGYSAQSQQEVTE
FT                   AYKFIFDGTAGSAVSRRSTHLSPPGSRSASPQNSKSGPPGLRLPPPPRLSILKNKDVAQ
FT                   DAQDFDTSKIDIQQELVIEQLTKQNTESNSPATRGYSTGAFARLQELEDRLMSDGQGGS
FT                   SRGQENKSARKARRKSYADMSDSELAQLEDSMNPYSATSNIDKFDFSEQSKLYIGPTNP
FT                   SKNLPRIKTDNPPTSIYPSRPAVPYHAISCSNMHEEYSAYVSQTAAAANGAKPRTVACY
FT                   LSGRRHSWSAVDAYINMFARSGDHLVIWAYLPMYDREITNLSSKTSERPKSSLDMYQFA
FT                   TEKKTTKPETASDHERACMMVLELDNIAKAKCKSLLDFYTKRCSHLIMKVTVEFIKHES
FT                   MQGATANLISLYEPDMEFVSTISTTFNVKFRNGHVKLPTYLAKHASIPTVIVSHEFVDT
FT                   KRAVQTPSGEVTQEPGIQLKRLENIVLSTSVNPYDVQSLNSRGTDLADCSSDEGDDEGS
FT                   EASASVGAYFPSDQDMRRKRDQFNTLGYIPPKPVYVDTRQLLSIGSSRSSRRSSRHTFT
FT                   SSEIYQVKSMISDDIPYSTNPIRTVKSAQSASSGTTNSTPLPRPVRRIEPMTPSTPASS
FT                   NPPTKKKGKLFSKFKQKIGLK"
FT   CDS_pept        435119..435364
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059071"
FT                   /locus_tag="AGOS_ADL147WA"
FT                   /product="ADL147W-Ap"
FT                   /protein_id="ADJ41762.1"
FT                   /db_xref="UniParc:UPI0001DB2A71"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGB9"
FT                   /transl_table=1
FT                   /translation="MIFRLWAPRTDRSENDAEFQRPDRSVPAPAPPSDTHVNFGDLGQA
FT                   VPIATWHIGGRNRFANDEQYRKMVDERSALLFSSIM"
FT   CDS_pept        435644..436312
FT                   /codon_start=1
FT                   /gene_family="HOG000000941" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752344"
FT                   /locus_tag="ADL146W"
FT                   /orf_name="AGOS_ADL146W"
FT                   /product="ADL146Wp"
FT                   /protein_id="AAS51774.1"
FT                   /db_xref="HOGENOM:HBG058615"
FT                   /db_xref="HOGENOM:HBG204434"
FT                   /db_xref="InterPro:IPR019166"
FT                   /db_xref="UniParc:UPI00002529E6"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AR6"
FT                   /transl_table=1
FT                   /translation="MARVDFYRECDIVAEGVVPPQTGAIVSSDAYEASAKNVAEVLGQN
FT                   QLLEGISVRTPGWLVNFFQKSRTVVTAGAERAAHQIETVSRRYYEKERRITSTVAALHS
FT                   NPREELLPGFGAVAVAYFSGSVLTRKRGIVLRVCAPLALGLGAFSYFLPTTFRNTKSLC
FT                   YDLEKRAFPQFVAQQDRLAAGTKRAVCGTVHTTVSAYNATHRACRKVTKVFRDWTGLNL
FT                   "
FT   CDS_pept        complement(436426..439053)
FT                   /codon_start=1
FT                   /gene_family="HOG000141831" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079831"
FT                   /locus_tag="ADL145C"
FT                   /orf_name="AGOS_ADL145C"
FT                   /product="ADL145Cp"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS51775.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG058616"
FT                   /db_xref="HOGENOM:HBG104171"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="UniParc:UPI00002529E7"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AR5"
FT                   /transl_table=1
FT                   /translation="MTASLKIFKGLHILLIQSPQFAESEITSVVEQLVGHGAAKTTVWG
FT                   GTDDEKASTKEWIRDNFRANIHCIIAADIDFPFYRSAAFDLMVPVVTPNWCSACVKNGR
FT                   LMRTTGFSPDPEHFLKECYIYISKHALSTAEYELFSAMISFMGGCCMDFLSTKVTHIIT
FT                   TDPRDPATLALERFGKLSVHSVTPTWIAECFACKQIVSTTPYILDKAMEESSVRSCMVD
FT                   NWFIDDKDWSWTSSIFLGHTFYLSMELPLKTSCYKFLIQLISAMGGQIARYVDFEDISP
FT                   DRADSFIDLDLSKDCVYARGKGLHCGNMAWLFYMLSMQQFIAPTAKLVLSPRYPKLFTE
FT                   KELVLAFTNYLGQQRYYIQRLVDLLGGSSTTELSRKNTHLISLFPHGKKHETALKWNSC
FT                   IVVNHLWLEQCYKLRKKLDPNAPEFTRIPVPDELSNAIGQMALETTARNMVSPRKAVSP
FT                   DIVMHNSQTDVALVVSTTDIDLKDNNESTNDTSVVHEPGKVMNSDDLTAVHSTKTRQED
FT                   ANEMFSALDEAVSKGKKSCLPKKHIAASVAASTSNEISASAKSNKDSSDVQATKQLPAT
FT                   PTSNPRQTKPKSTSGTQNDTASSQKNTRRKNADDSPSSESSKTKKRKTTVVDAKQLVSP
FT                   YLEEYSDTTGGRLPYDIKAVFTNCHENITDLDKEILRQLGIILQEEIEEDTNCIIGPKK
FT                   ARTAKFLTSFSFHPLKYALLPKFITEILSLVHSGRNEPISLPLEQYYIPDIDADVIAKT
FT                   ELPTKLFERSGLQAVNLSEDIPGGVEVISSILKAHGMVQINGLPKKFKAKDIAKNTVDN
FT                   GSPDFVLVATKASAAKKFSKLCEEVDRNAKVLIVEWNWCVKAIFSLEVDYNDPEFVISK
FT                   TGFA"
FT   CDS_pept        complement(439411..439827)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20623070"
FT                   /gene_name="CWC25"
FT                   /locus_tag="ADL144C"
FT                   /product="Pre-mRNA-splicing factor CWC25 "
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="AAS51776.1"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG058617"
FT                   /db_xref="InterPro:IPR019339"
FT                   /db_xref="UniParc:UPI00002529E8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AR4"
FT                   /transl_table=1
FT                   /translation="MDLNLLKSWNPQLQKNRKKVYEAQQELLKSARKPADDGTSGGGLD
FT                   WMYEGQPAPQRKVRKRRTRTRKPKQVPKDAQGKLQESLQTARSDAPEGTCSPDETAAAR
FT                   GGQQGAPVEVSAKSPAKAVAEARGGPGSSGVHGE"
FT   tRNA            440031..440103
FT                   /gene_name="tRNA-Ala"
FT   CDS_pept        440706..444014
FT                   /codon_start=1
FT                   /gene_family="HOG000187674" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079832"
FT                   /locus_tag="AGOS_ADL143W"
FT                   /product="ADL143Wp"
FT                   /protein_id="AAS51777.2"
FT                   /db_xref="HOGENOM:HBG058618"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001DB2A72"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AR3"
FT                   /transl_table=1
FT                   /translation="MKFGKYLAGRQLELPEYNGYFIDYKALKKLIKQLSVPAASVPGGS
FT                   ELPDALMLDTEDRSESYQRLQENKASFFFRLERELEKVNDYYLEKEAGLKVVVDIIQSR
FT                   YRDYLKRGKLISKKTSSYRHIRDAVKKVERDLTHLEHYVELNRTGFSKVLKKWDKRSHS
FT                   HTRDFYLATVVSVQPVFTHNKISKWNDAVLTMLFELDEISNEDSVYYQEPVQNKNAYAV
FT                   DMDSSAKLSGVQSISEWNPAEAVPSSVNGLFDIELEIEGWYMEALHISKLTDPQRKLDL
FT                   LGSFAQSKVQAFVDERLPQGTIDKQKVVKDCLTNIFLPLVSSDIDDISLKHFLINAVDM
FT                   IDLTYCDEEDLVFSRRNVFHEAACCTSDSRVFVLEEALNQCNQFKIDQATMCRLLNARD
FT                   THGRTPLHYACDLGKTDFVRLLIKSSLLDTVNIPDTDSKTPLVLAIIKAHAEITRLLLV
FT                   DAQVNPDPQIDESGKPQFSPLSVACANKNLTAARMILEIGNINLNDVCDSQGLQPLHIV
FT                   AKNGGDVELIELLVSHGANPNAVDGFNKWTPIFYAVQEGYGSTVQNLLSNGAKLDVVDG
FT                   DNLSPLFYALWEGHLSVLNILLNCAASRNQQLMINRSPQLLPSNIIAEDQISAIDSLSD
FT                   IPDFELPPPIIPLRKYGHNFLERKIFVKLLFSPGRDSIMLNKEDEMVLSSPGRITLTPN
FT                   VSNVIPRNIPLPIQDDEEHVAFQVGNLDNLSIDFELFPSFGTRLIAKTNAMSSVFREVS
FT                   KQCTNDRRIKLPLFDSRLKNVGELELAFEVIFPYSGKPLEITKYDTYWKSTTGSESGPN
FT                   GNHLVTSSSLAGKYTTVLVTVLSDGKVISAPDKVVSVSNGAKLLLSDITSRQLELICGQ
FT                   SLDDCPKIETTEQLNTILNERHISLDRLLSCTSPDIQLDLEVFFPTALEINTIPVKVSP
FT                   TVNINQFIDDVLLTTFNHVRYLNHNRLQPRSIVFTSCNPRVCSILNWKQPNYPVIYQMN
FT                   GLRKQNGQFTKATPHHLEYLAQNPDSVSFADPCSRCIREAVNFSCNNNLLGIVIPLDLL
FT                   SIYSQLEQHIRNRGLLLIGSHNPAARFQAVVPAGLEINAVKTATELQFQGAINM"
FT   CDS_pept        complement(444066..444755)
FT                   /codon_start=1
FT                   /gene_family="HOG000158359" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752345"
FT                   /locus_tag="AGOS_ADL142C"
FT                   /product="ADL142Cp"
FT                   /protein_id="AAS51778.2"
FT                   /db_xref="HOGENOM:HBG037955"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001DB2A73"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AR2"
FT                   /transl_table=1
FT                   /translation="MGDNSLHEACMNGDYARAVALLSDNPGLVRSKDADSRYPLHWAVS
FT                   YQHVKIVELLLSYMLQVDLDTLVDDALWSPVHVAAAVGNRELFGKLLAHAVQPSLDAAT
FT                   SQGTTALHLACSKQHYAVVEDLITHGASVRKKDKKQQLPLHRACAIGSARLVKLLCDAR
FT                   SPVNAKDANGWPPLFHALSEGHADIALLLVNDYGAEWENVESAAGETALQVAVDDNVRD
FT                   YFVKNIN"
FT   CDS_pept        445035..445958
FT                   /codon_start=1
FT                   /gene_family="HOG000205692" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928581"
FT                   /locus_tag="ADL141W"
FT                   /orf_name="AGOS_ADL141W"
FT                   /product="ADL141Wp"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS51779.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG291502"
FT                   /db_xref="HOGENOM:HBG680510"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="UniParc:UPI00002529EB"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AR1"
FT                   /transl_table=1
FT                   /translation="MNRYPGDFQRFARVVQQQMNRAGYGPNQRRGGRGPGGLLPGAGLL
FT                   LLGGGALFLNASLFNVDGGHRAIVYSRLSGVQQSVYGEGTHFVIPWLETPVLYDVRSKP
FT                   RTVSSLTGTNDLQMVNITCRVLSRPDVQHLPLIYRTLGTDYDERVLPSIVNEVLKAVVA
FT                   QFNASQLITQRESVSRLIRDNLVRRASRFNIMLDDVSITYMTFSPEFTSAVEAKQVAQQ
FT                   DAQRASFYVEKAKQEKQSMIVKAQGEAKSAELIGEAIKKSKDYVELKRLDTAREIAGIL
FT                   AASPNRVILDNEALLLNTITDSRDKK"
FT   CDS_pept        complement(446026..446553)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20623071"
FT                   /locus_tag="AGOS_ADL140C"
FT                   /product="ADL140Cp"
FT                   /protein_id="AAS51780.2"
FT                   /db_xref="HOGENOM:HBG058619"
FT                   /db_xref="InterPro:IPR007727"
FT                   /db_xref="UniParc:UPI0001DB2A74"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AR0"
FT                   /transl_table=1
FT                   /translation="MASRRSSDAGVKAMEVESEGHERVESSTAQQRESEREQSPQAAKV
FT                   RKVAAAVEREVTAVAPRQASRPARGVPTAARAAQPGEKFQPLHQKPASALNVHAKGVGS
FT                   VHKSLHKAMFKKALPSQQLKDKFASPTDSMLSPCTQKLNQHKSRLFKAAVKPTRLNFAQ
FT                   AKADSDEELEDV"
FT   CDS_pept        447128..449101
FT                   /codon_start=1
FT                   /gene_family="HOG000154350" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15752346"
FT                   /locus_tag="ADL139W"
FT                   /product="KNR4/SMI1 homolog"
FT                   /biological_process="cell wall biogenesis"
FT                   /protein_id="AAS51781.2"
FT                   /db_xref="GO:0042546"
FT                   /db_xref="HOGENOM:HBG190154"
FT                   /db_xref="InterPro:IPR009203"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="UniParc:UPI0001DB2A75"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AQ9"
FT                   /transl_table=1
FT                   /translation="MESLKRAWNQLVYTFSTEDRYAEYTPQGSTNVVGGEPFDTSNASR
FT                   IQLNEFVDGAEVGGNDGVSECLLAWRHIDSWCSEHNPDLYATLSSPCTNNDIMWAEKDL
FT                   AITFPAAVRASLRTHDGQEDVESMQGASGLIYGLKLMGLEEVVIMTRTWRNVAANLQRQ
FT                   MARMEQQQRAKSSSELPQTVTPQAVKQKGYGKVDNQDYHANPHLQKDISQNYNKQFKLD
FT                   KLPKQGSIPPLAIQPVYAHPGWIPLVTDHAGNHIGVDLAPGPKGKYAQVILFGREFDTK
FT                   FVVADNWGDFLLGFVNDLEKGNWLLVDNTDDYLNGEGDLVFVDHATRGPILNYLAVLKK
FT                   RSWEKWQSTKPTQPLTSASVASFSTSSSVVNRPTPADAAGQARKTQGYSPMVPGASSNE
FT                   SVSFIPDSDVIMEESNLTQTDASSKGTTKPATPNPMTAPTVIRVSTPGSPSAAAEAPEP
FT                   PKKATPPKAAKETKTPTVTKESTPASDANVDTELDSKNTETNEDTRATNTAHSMAPTVS
FT                   SAITDLTAIDEPVATAGKPKDTEKTDDAKDVHEANKQDLTKANEAEAEENAVEPKDNEV
FT                   SADSKVKARAESKSDHDSKTNNIPEKKVPQVTAKALPESDRGQASDAASTKSDKKAKPA
FT                   EDPKEHDLKIEKLNEDFETVAL"
FT   CDS_pept        complement(449426..450955)
FT                   /codon_start=1
FT                   /gene_family="HOG000240902" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15752347"
FT                   /gene_name="ALG10"
FT                   /locus_tag="ADL138C"
FT                   /product="Alpha-1,2 glucosyltransferase ALG10 "
FT                   /EC_number="2.4.1.-"
FT                   /function="transferase activity, transferring hexosyl
FT                   groups"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS51782.2"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016758"
FT                   /db_xref="HOGENOM:HBG355771"
FT                   /db_xref="HOGENOM:HBG714502"
FT                   /db_xref="InterPro:IPR007006"
FT                   /db_xref="InterPro:IPR016900"
FT                   /db_xref="UniParc:UPI0001DB2A76"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AQ8"
FT                   /transl_table=1
FT                   /translation="MGGEATASEKELQEREDQLSQQIQDEIVMGCVVNLALWPVLLGAA
FT                   AYVAYKYNCSWVPYPFIDEKFHVGQTVRYLAGRWREWDSKITTPPGLYVIGWAVQRTVG
FT                   LLVGWNTLSLLRLSNVIGGLVVWPWFVLRPLYFFNALAFWPATLSVFPLLTSYYFLYYT
FT                   DVWSTILIVGSLTLAVTVPFGERASIWASAICGLLSCLFRQTNIVWNAFVLVVVLERRT
FT                   MIHKGFNSLRINNYLKLIIHGIENWNSLVLPYAVNFALFLIFLLYNGSVTLGDKSSHVA
FT                   GFHLVQMFYCLLFITFFSVPVWFCRSFLLNYVSRTVVYPIWTIFEILGIMMIIRFFTVV
FT                   HPYLLADNRHIAFYLFKKLIGRNRFLKYFVMAPIYHFSTFVYLEAVRPTVFFFHPILPI
FT                   EVKSPVDLPLQFTHISWSALIICTLLTVVPSPLFEPRYYILPYIFWRIFLLVSPEPFFA
FT                   VPTEMTYRFGNTRRLAVEFLWFILINAITIVIFATNAFAWETEASLQRIIW"
FT   CDS_pept        451219..452571
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928582"
FT                   /locus_tag="AGOS_ADL137W"
FT                   /product="ADL137Wp"
FT                   /function="binding"
FT                   /protein_id="AAS51783.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG125025"
FT                   /db_xref="InterPro:IPR016186"
FT                   /db_xref="InterPro:IPR018378"
FT                   /db_xref="UniParc:UPI0001DB2A77"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AQ7"
FT                   /transl_table=1
FT                   /translation="MGSFLLCLLLVQLQWCLCSNVLDDLLQQTNIAFLSQQDVIGVIPV
FT                   NQIPLVGVELCSMFETVGDGQDTLAAMLQTGVQTLVMDIGYDEDAGGWQMCGRTSLSEG
FT                   ISTVSRQIERLFPTLYANLVVLVLRGGAAEAHYEALRDAIGRVGRWTYSAEKVKATSPH
FT                   LNSLLDDQEKRVLVVALDDSLCEALGTVAFGPEDVAYVEGNDTIDCSEHTDSWSFIERE
FT                   FHWTDVREYVRLGCSPVITGKSVANISELEALVKVAQVWSWGAGEPALTDANSEMQRCA
FT                   SLGYDSATERATWKSTSCRQNLPVLCQAVNDRYSWLVGTRNLRFDQLNMDSCPSGYKPS
FT                   VPRTPLEQREVERYLSEHHPSDGQYWIYLNSISVEKCWVVGGPETPCPYVALVSTRNFA
FT                   AMIVTSSILVLLLLVLIILLDLVRVPIQDNRRSWKRALGSYSKAETEGVPM"
FT   CDS_pept        complement(452713..454380)
FT                   /codon_start=1
FT                   /gene_family="HOG000115507" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775581"
FT                   /locus_tag="ADL136C"
FT                   /orf_name="AGOS_ADL136C"
FT                   /product="ADL136Cp"
FT                   /protein_id="AAS51784.1"
FT                   /db_xref="HOGENOM:HBG058620"
FT                   /db_xref="HOGENOM:HBG104174"
FT                   /db_xref="InterPro:IPR010482"
FT                   /db_xref="UniParc:UPI00002529F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AQ6"
FT                   /transl_table=1
FT                   /translation="MTWGGGPMKEDDRAKALESVAIGSKKRRSLLGEFLARKYERIMEA
FT                   EERVADDEKARPCVTNRELVTNIACSLFDATWERLRTGKDQQRKTIDDDFDEFALRHEL
FT                   ESSADSFWQEETSDNGAGMSDEEDTEEQRAAKLRAVSQVQEQEHFIDILLDKMISAVLP
FT                   EDLPEREQFTQRVQEPGRRRSHPISLIIMSRNLKIMTTKLGLIFEFQDSLVRLATWRNP
FT                   SGTALSLILFSFACFNPMLVIILPMLYVLFGLMIPGYLHRHPLRRNFYLTKHSYGKSLL
FT                   ATVATGGKPASWQSHDDVQEFDYNNLHTDTEEWERALHIKQTMEFIVNLRDLQNLMTAS
FT                   VKGIECAEKFVYGDAGFKNEHHSTVLFLSGLLVVMGLWIIAPYINWSLTSAAGAWAALI
FT                   LIHPRVLPMVTAYINDDQLEKGKVVIENVERYDILLDEKPEERYLELFEIYKQRLTSDE
FT                   WDFYLLSSYAFDPTDKYRKSQRPPPGVTNIDEVVPPSMWSFDRNSKWEVDYDVKGWAQE
FT                   RGLSLEINGEFLVDDSFKRRRLTRKVVRYANPARKPTV"
FT   CDS_pept        join(complement(455260..456526),complement(454604..455202))
FT                   /codon_start=1
FT                   /gene_family="HOG000033911" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752348"
FT                   /locus_tag="AGOS_ADL135C"
FT                   /product="ADL135Cp"
FT                   /protein_id="AAS51785.2"
FT                   /db_xref="HOGENOM:HBG058621"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0001DB2A78"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AQ5"
FT                   /transl_table=1
FT                   /translation="MDRQAGPMARSYKRTLSSGSGRAVTVKRTKLQGDGGAGRGVGGCG
FT                   PRTMPDRFIPNETSIKAYRASPNLRHFDLTINELVDPESQRRLPSPEFFTSQDLQLAQL
FT                   ILTPDASPLAAKEVKTRLNEEFKRHREYIADALGFQSPKRVYRFDRLPKTLEVSPNHSV
FT                   VDPLLSTLPPRDAAQYIHKQEFPNFEQSKRFVPCDLRPTRRTRSHIPYRVLDAPALRND
FT                   FYSNLVDWSPATNNVVVGLNCSVYLWSDTLGPINVLHHGYLQKKGDIVTCVSFAPKDDY
FT                   LVVATKLGRLLVFDQSYKPKVMVDGSRQPLVETRINNNRGICCVKWFENAKNEFLLGND
FT                   IGEVHRFRLEHKKFEHFEIITMGEAERRLRVGKDLNGHVSGVERVKQKSYNIKETLVKY
FT                   VYETLELCLENVYTFQSQTQQVCGLDICEDTGFVAVGGNDNSCSLWDISQASGPPKLLF
FT                   QLPHFAAVKAVSFCPWSRSLLATGGGSKDRTIRFWHAPSGTLLKEIKTPGQITSLIWST
FT                   RRKQIVATFGFSDLESPTLFISYSYPSMEPIMKITTPSALRVLSAVSSPDFSSICIATN
FT                   DETVRFYEMWDSNESTIIEAQATGLYGSKIIEHEEGIEPDTDPIR"
FT   CDS_pept        457078..458283
FT                   /codon_start=1
FT                   /gene_family="HOG000217543" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15752349"
FT                   /gene_name="HSV2"
FT                   /locus_tag="ADL134W"
FT                   /product="SVP1-like protein 2 "
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasmic vesicle membrane "
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="AAS51786.1"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0030659"
FT                   /db_xref="HOGENOM:HBG058622"
FT                   /db_xref="HOGENOM:HBG443829"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00002529F2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AQ4"
FT                   /transl_table=1
FT                   /translation="MKTRNPIVVQRKNGPPRFLHVNFNQDQECFSCATEKGFEIYNTDP
FT                   IQCSVKRRFSHNGMSGIGYTRMLYRTNYIGLVGGGASPRFSTNKIAIWDDIQQRDSVSI
FT                   RFNSPVHELFLSRQYIVVVLAQSIDVYTFSGSPSRVCPVISNIHNGIADFVTCSKMRRA
FT                   SGPQDVEHALSQKHVIAGILAYPSGIRPGQIHIADLSNIQTPSVADASATHLPTSIIKA
FT                   HKNPIHLVKLSPQGTMVATCSVEGTLIRVFSIASGSLIHEFRRGLDRALIYDMQWNGKG
FT                   DKLAVVSDKFTLHIFQINEDLDKRHLLKGWFPKVKYLQGVWSMCSTKLDRSLLTHDEDT
FT                   CKVGWIGDEALSLLWQKSGMWEKYVIMEKLREYKVDETLHSGAPDGRRQLYDLVRESWR
FT                   QL"
FT   CDS_pept        complement(458278..459027)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079833"
FT                   /locus_tag="AGOS_ADL133C"
FT                   /product="ADL133Cp"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAS51787.2"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="HOGENOM:HBG058623"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0001DB2A79"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AQ3"
FT                   /transl_table=1
FT                   /translation="MSAGRAKVLVEEVLRRLKTGEIAGARQGGTGKREPAVAVYRSLNP
FT                   ALGKRDIVGALPAVQLSEEPREHEALAFQVMKLRDPRFFMFRDEYLLRFPTETGLAAFR
FT                   RLARDAWVDDVRLQLETTVAPQTLETGALYAKLVQRAYESEAGYRSALAEGPGRAVAPL
FT                   RTLNWAKVREVEARSALVWDLPEWCDGKRLAQEFWWYSIKNGFQLYCGQGRRLTYVAFA
FT                   DPADAMRFKRNLHGSHWCGKQVLVEKL"
FT   ncRNA           459232..459287
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR7"
FT                   /product="AgSNR7"
FT   CDS_pept        459595..461586
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752350"
FT                   /locus_tag="AGOS_ADL132W"
FT                   /product="ADL132Wp"
FT                   /protein_id="AAS51788.2"
FT                   /db_xref="HOGENOM:HBG058624"
FT                   /db_xref="UniParc:UPI0001DB2A7A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AQ2"
FT                   /transl_table=1
FT                   /translation="MAVTTDGLQRRSDSEDCSGSSCEKPVDSMSGNSLLIGVVVPVVVI
FT                   LIGMAIVMFKVWKKGKKEALEDDDPRFYGESEFLPDFHETSDVYPMQDKPPVMPASGNG
FT                   LESLKPPGYAMQRTVSSQGSSYASSPVDPFQLPEVDDRDSLRTYARNLQTEPAGYALAS
FT                   APKAPLLTSSPPPPTVRPYLESNGSFVTSTSRFDVDTALTQPHMDAMSVLQYSKQLAND
FT                   PTVNYSQYNPTAPPPARSAIPDVAKSRTPVQQTRETSPVLTAPLVRQETSLISAQVPSE
FT                   DSFEFEERRSIENLGTDIKVKGSARGPVEAPETASKPGAPGLNKMASDRPTNLRVQTDA
FT                   LPNGGQKAVSPQASKTLKFKMADDDETYATQMSPDDSNSIDRIKSIYQVYLDRNGTARR
FT                   APDASEADGQEFYAGFAHDAQAVTQAGVGAKEELSKDTSPNAHTSAAQHKRAVSSIYSD
FT                   GQRQRDFMNEQDNLSVVPPLPQEFAHPQEKENVEVLPSPSNLPEAMTALSLTSFKKPTQ
FT                   ARSPNMTSLQQHSFNRPFNPVDHPEAFQHEDTESQGLLAGENNPPSRILPHHLRQSVVM
FT                   THPMMLGQKPVFKPAGSFRQVSNDRSNSLSSQGKANASNWQANSRVSGLLELSDTMQPA
FT                   SVGIVLPSARSQNDLRKELEKSHNYSVI"
FT   CDS_pept        complement(461761..462312)
FT                   /codon_start=1
FT                   /gene_family="HOG000213883" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752351"
FT                   /locus_tag="ADL131C"
FT                   /orf_name="AGOS_ADL131C"
FT                   /product="ADL131Cp"
FT                   /function="rRNA binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS51789.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="HOGENOM:HBG332242"
FT                   /db_xref="HOGENOM:HBG516568"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="UniParc:UPI00002529F5"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AQ1"
FT                   /transl_table=1
FT                   /translation="MVRKLKHHEQKLLKKVDFHEWKQDQGHRDTQVMRTYYIQNREDYH
FT                   KYNRLCGDVRRLAHKLSLLAATDPFRIKHEQLLLEKLYHMGILATKSKISSLENKVTVS
FT                   AICRRRLPVIMHRLKMAETLQDAVKFIEQGHVRVGPNLITDPAYLVTRNMEDYVTWTDS
FT                   SKIKKTVLRYRNQLDDFNDA"
FT   CDS_pept        462675..463319
FT                   /codon_start=1
FT                   /gene_family="HOG000039904" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18928583"
FT                   /locus_tag="AGOS_ADL130W"
FT                   /product="ADL130Wp"
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS51790.2"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="HOGENOM:HBG297151"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="UniParc:UPI0001DB2A7B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AQ0"
FT                   /transl_table=1
FT                   /translation="MSLVFRRLLSASAAVRSHIGAAPLYLLPENKLSVAAVETPRVIRK
FT                   GKRVMRLTQKVTVEGPLGSASMELPDFVSLDHDAASGQVAVTVHDAANKSQRAMWGTVR
FT                   STLGSHVQGVNEGHMAFLKFVGTGYRAALEDDGKFVSVKVGASIRQGLPVPPGVTVKSP
FT                   APTLLIIEGCVKQQVNLFAASLRMFHPPEPYKGKGIYMNNETIKLKDKKIK"
FT   CDS_pept        463559..464362
FT                   /codon_start=1
FT                   /gene_family="HOG000100368" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15752352"
FT                   /locus_tag="AGOS_ADL129W"
FT                   /product="ADL129Wp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS51791.2"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG154396"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniParc:UPI0001DB2A7C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AP9"
FT                   /transl_table=1
FT                   /translation="MLETLIRVQLRFASSRAALVAPSVAQTVHKVAPAVNHSPEKALER
FT                   RWLPLRCGVLTRKVGMMPYFDVATGARMAATVLEMNNVEVVLQKTVAANGYWACQVGYG
FT                   NKHPSKVTRQLLGHFASKEVNPKEKVTEFRVKNEEGLLPVGTLLKPSFFSPGQYVDLRS
FT                   VSKGKGFQGVMKRYNFKGQKASHGNSLSHRKGGSYGQNQTPGRILPGKKMPGHMGVQRV
FT                   TIQNVQVLEVQDSKGVIIVKGSVAGPKGAFVKVQDAIKKPPTADI"
FT   CDS_pept        complement(464577..467825)
FT                   /codon_start=1
FT                   /gene_family="HOG000209012" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752353"
FT                   /locus_tag="AGOS_ADL128C"
FT                   /product="ADL128Cp"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="AAS51792.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG028487"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013598"
FT                   /db_xref="InterPro:IPR014877"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001DB2A7D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AP8"
FT                   /transl_table=1
FT                   /translation="MEAILDFSKDLDIQLLDQIVDTFYKGSGTQQRQAQDVLTKFQDHP
FT                   ESWQRADKILQFSANPQTKFIGLSILDRLITTKWKMLPQDHRVGIRNFIVGMIISLCQD
FT                   DAVFQSQKNLINKSDLTLVQILKQEWPQNWPDFIPELVSSSQSSINVCENNMVILKLLS
FT                   EEVFDFSTEQMTQAKALHLKNSMSQEFEQIFKLCYQVLDSGSSTSLVVAALQSLLRYLH
FT                   WIPYRYIYDTNLLTLLSTKFLVSPDTRAVTLKCLTEVSQLAIPENDNNIKQQTVMFFQN
FT                   ALQQIAINVVPVTADLKSTYATANGKDQSFLQDFAMFLTTYLARHRPILESDESLRELL
FT                   LTAHQYLIQLSKIEERELFKTTLDYWNNLMSSLYQEIQTVPFNEMNPLLQLSLDVNPSS
FT                   GGAPNPQFLKKYPLKKHMYDNICSQLRWVIIESMVRPEEVLIVENDEGEIVREFVKESD
FT                   TIQLYKSEREVLVYLTHLDVVDTEEIMLDKLGRQIDGSEWSWHNINTLCWAIGSISGTM
FT                   DEETEKRFVVTVIKDLLALTEQKRGKDNKAVVASNIMYVVGQYPRFLKAHWKFLKTVVL
FT                   KLFEFMHETHEGVQDMACDTFIKIVQKCKRHFVIQQPTEKEPFIQAIIRDIQKTTEDLQ
FT                   PQQVHTFYRACGLIISDEKNTAEKEKLLRELMQLPNMAWDTIVAQSAANPDLLLDPETV
FT                   KIIANIIKTNVSVCSSTEADFYSQLGHIYYNMLQLYRAVSSMISAQVAKEGLIATKTPK
FT                   VRGLRTIKKEVLKLVEIYIAHAKNLDEVVKSLIQPLLNAVLEDYMNNVPDARDAEVLNC
FT                   MTTVVNKVGHMIPEGVILILQSVFECTLDMINKDFTEYPEHRVEFYKLLKEINAKSFNA
FT                   LLQLPPAAFKLFVDAICWAFKHNNRDVEVNGLQIALDLIDNVDKASPSPFSNAFYENFY
FT                   FTFTSEAFYVLTDSDHKSGFSKQSLLLMRLISLVQDNRIPVLLYKSGEAPAGTTNQVYL
FT                   ANYMVNMLGNAFPHLTQEQVTSFINALIKQYQDPKKFSGTLRDFLVQIKEYGGDPTDYL
FT                   FAEDKELALAEQNKLEQERASKIGGLLKPSELDD"
FT   CDS_pept        join(complement(469832..469835),complement(468881..469641))
FT                   /codon_start=1
FT                   /gene_family="HOG000232983" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775582"
FT                   /gene_name="RPL2"
FT                   /locus_tag="ADL127C"
FT                   /product="60S ribosomal protein L2 "
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS51793.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="HOGENOM:HBG155458"
FT                   /db_xref="HOGENOM:HBG748739"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniParc:UPI00002529F9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AP7"
FT                   /transl_table=1
FT                   /translation="MGRVIRNQRKGAGSIFTSHTRLRQGAAKLRTLDYAERHGYIRGVV
FT                   KQIVHDAGRGAPLAKVVFRDPYKYKLREETFIANEGVHTGQFIYAGKNASLNVGNILPL
FT                   GSVPEGTIVSNVEERPGDRGALARTSGNYVIVIGHNPDENKTRIRLPSGAKKIVSSDAR
FT                   GVIGVIAGGGRVDKPLLKAGRAFHKYKVKRNSWPKTRGVAMNPVDHPHGGGNHQHIGKA
FT                   STISRGAVSGQKAGLIAARRTGLLRGSQKTQD"
FT   CDS_pept        complement(470424..471824)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079834"
FT                   /gene_name="RRT5"
FT                   /locus_tag="ADL126C"
FT                   /product="Regulator of rDNA transcription protein 5 "
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /protein_id="AAS51794.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG058625"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00002529FA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AP6"
FT                   /transl_table=1
FT                   /translation="MSDQPAQSDLPDQGALPPQEAAQPQAVREDPQPQQCAQQVLFEQQ
FT                   GAQHRVYISNLSQDATEEALTEFLKDFHPVSVLIPSQSVRGFQKTSVRPLGIAYVEFKD
FT                   ADTAAKVILELNGVTFMDRELRLRYHIPFKSEKEKLARGPNKFRQIQRRLSELRRRNSD
FT                   AGATVTTDNGPQVDAAAVPREMSKVTIYVGRLPGRTTDKDLRTYFHEYLPQEIIVFKHR
FT                   QFRGWRIRRHVTAAVITFPDHERQESALESLSNLPFNGRTVRMAPAFEDKLAEIRAEVQ
FT                   RMAVEQQLPQPASNLGIYIGNNLIAMQPLQTRKADQQSLQSQHSPQNAAEDQTITAPPP
FT                   SQQQLPQLQPIAPPLSLQPLNPVENTQPVQGLDLSIPREHEEVVRGQPLLRLQKLQMIQ
FT                   RLQRLHRQKQRQQIQQEPAAQPAAQPAAQPATEAAVAPQLVPEQEAHQAAAQAEPQQVL
FT                   ERPIAAGA"
FT   CDS_pept        complement(472217..472405)
FT                   /codon_start=1
FT                   /gene_family="HOG000212220" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752354"
FT                   /locus_tag="ADL125C"
FT                   /orf_name="AGOS_ADL125C"
FT                   /product="ADL125Cp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS51795.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG242797"
FT                   /db_xref="HOGENOM:HBG627477"
FT                   /db_xref="InterPro:IPR002673"
FT                   /db_xref="UniParc:UPI00002529FB"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AP5"
FT                   /transl_table=1
FT                   /translation="MAKSKNHTAHNQTKKAHRNGIKKPRTNKYPSLKGVDAKFKRNHKY
FT                   ALHGTAKALAAKRAAKN"
FT   CDS_pept        complement(473167..473547)
FT                   /codon_start=1
FT                   /gene_family="HOG000001146" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079835"
FT                   /locus_tag="ADL124C"
FT                   /orf_name="AGOS_ADL124C"
FT                   /product="ADL124Cp"
FT                   /function="binding"
FT                   /function="ubiquinol-cytochrome-c reductase activity "
FT                   /biological_process="mitochondrial electron transport,
FT                   ubiquinol to cytochrome c"
FT                   /protein_id="AAS51796.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006122"
FT                   /db_xref="GO:0008121"
FT                   /db_xref="HOGENOM:HBG058626"
FT                   /db_xref="HOGENOM:HBG103951"
FT                   /db_xref="InterPro:IPR003422"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR023184"
FT                   /db_xref="UniParc:UPI00002529FC"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AP4"
FT                   /transl_table=1
FT                   /translation="MISSITEYLEELKEAFVPTVAKAEDDVEDVEEEEEEEDEDEDEDE
FT                   DEDEEEEAGDQLDELREECRNAADAKPLVHHYMECVERVQHAQQQPGYADLDYQEDCVE
FT                   EFFHLQHHLDSCAAPKLFDKLK"
FT   CDS_pept        complement(473852..475042)
FT                   /codon_start=1
FT                   /gene_family="HOG000184666" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752355"
FT                   /locus_tag="AGOS_ADL123C"
FT                   /product="ADL123Cp"
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51797.3"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG058627"
FT                   /db_xref="InterPro:IPR001092"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniParc:UPI0001DB2A95"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AP3"
FT                   /transl_table=1
FT                   /translation="MRTTGWNDTAGGEGRTILEQVGEYLSEQGRRPGGSTAGEWDEAEQ
FT                   TEHERERRDKGDQMAGPGSHFLDFSLLDEGNEVGDKERLRQRAAVFSPVMSPMLHIYGS
FT                   VSNTPLLTADKAHASQNTPHLQGAGAGSALQGQGMSPLSSPALGAGAATAPAAFSLPEA
FT                   AAGIVSRKCAAGSARPAKKTPHSTPYLGATPGKVVKQSPLVDAKKSNGSTVSSGSSSKY
FT                   KNHTWDDMFCLPTSSMGIGGHSSLGSTPDDSLRAPLDGSDDLHDARKPAPGLPRFILPS
FT                   NNPQRQLPPPPSDSVIHASQSPVIKPNYAGKPPGFVSARSVRTLSGGDANTGDEFIKKE
FT                   VHKVAEQGRRNRLNNALAELNDLLPPELKESAQVPSKATTVELACKYIRQLTGQQN"
FT   CDS_pept        complement(475462..476406)
FT                   /codon_start=1
FT                   /gene_family="HOG000066124" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752356"
FT                   /locus_tag="ADL122C"
FT                   /orf_name="AGOS_ADL122C"
FT                   /product="ADL122Cp"
FT                   /protein_id="AAS51798.1"
FT                   /db_xref="HOGENOM:HBG058628"
FT                   /db_xref="HOGENOM:HBG396938"
FT                   /db_xref="UniParc:UPI00002529FE"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AP2"
FT                   /transl_table=1
FT                   /translation="MSDNEEYMQQLEAQRRAFEAQFGSLEDMGYVDKTRAAQSNDTSTS
FT                   ASESDSDPESEGDARSGQSESDEQSEMDGASASSDDEAAHTPRVISFRAPSDAYSGPSP
FT                   RELRRIRSGKAPGLETEPAPKSAAADRDEKQLLEQDIELQRFLQESHIFAALNSQPSGA
FT                   DLTLRTIDNPAYAGGEVIGKARARTLEMRLNALSATNGAARTLETVPMNIRKGMVSKHR
FT                   SRIREHEQLARDSGTVLAKVRRGEFRKIDATYKKDIERRIGTTIKAADRARKKHRDRAP
FT                   RIHAVGKSTRNGLVISPKEIAAVAASEPKRRKR"
FT   CDS_pept        476581..477372
FT                   /codon_start=1
FT                   /gene_family="HOG000172261" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775583"
FT                   /gene_name="HIS6"
FT                   /locus_tag="ADL121W"
FT                   /product="1-(5-phosphoribosyl)-5-[(5-
FT                   phosphoribosylamino)methylideneamino] imidazole-4-
FT                   carboxamide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /function="1-(5-phosphoribosyl)-5-[(5-
FT                   phosphoribosylamino)methylideneamino]imidazole-4-
FT                   carboxamide isomerase activity"
FT                   /biological_process="histidine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS51799.1"
FT                   /db_xref="GO:0000105"
FT                   /db_xref="GO:0003949"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG110009"
FT                   /db_xref="HOGENOM:HBG302148"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011858"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI00002529FF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AP1"
FT                   /transl_table=1
FT                   /translation="MTRFVGCIDLHDGKVKQIVGGTLSSKPDGEAPVTNFVSDKSPSHY
FT                   AHLYASNDVQGSHVIRLGQSNDEAALMALQAAPGFLQLGGGVTKDNCQYWLQWASKVIV
FT                   TSALFDSDGSFQLQRLREISGLCGRARLVVDLSCRRASDGASWTVMMNKWQTPTTLALN
FT                   EETLALLSEYCSEFLIHAADVEGLCRGIDEELVAQLGLWAAQLRGDVRVVYAGGANSVA
FT                   DLGLVKRLSGGRVDLTYGSALDIFGGSLVRFQDCCAWNRQQ"
FT   CDS_pept        complement(477467..478402)
FT                   /codon_start=1
FT                   /gene_family="HOG000230844" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928584"
FT                   /locus_tag="ADL120C"
FT                   /orf_name="AGOS_ADL120C"
FT                   /product="ADL120Cp"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="protein dimerization activity"
FT                   /protein_id="AAS51800.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG285589"
FT                   /db_xref="HOGENOM:HBG539019"
FT                   /db_xref="InterPro:IPR001514"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR011261"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="UniParc:UPI0000252A00"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B05"
FT                   /transl_table=1
FT                   /translation="MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLA
FT                   IDSVEIESNTSVLADEFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAV
FT                   GESESTTNVYAKDLQIVSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGI
FT                   AKEHAKWSPAAAIEFEYDPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYS
FT                   AKPNTFYMNVESVGSIPSDQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPTGDAAP
FT                   MEVDQDPYSATSGRFNEYNDNAHAAYDDAW"
FT   CDS_pept        478499..479056
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752357"
FT                   /locus_tag="AGOS_ADL119W"
FT                   /product="ADL119Wp"
FT                   /protein_id="AAS51801.2"
FT                   /db_xref="HOGENOM:HBG058629"
FT                   /db_xref="UniParc:UPI0001DB2A96"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B04"
FT                   /transl_table=1
FT                   /translation="MTTARSGRSWQRHSACRRLCSTRPAAAAGGCVVRGSLRCGLAQWP
FT                   SWHAHRGCVFVKAKASAGMLPLSHEQAIAMERKAITIPDVRFEQTFRAALAKESARQRQ
FT                   LRAQKEGEAAADGEAGISALVVAKVVVRDVLLMPLVQGALWTGLLITMKPWLRLCMLGG
FT                   RRAGQAFYRALVGDVRPRMRAA"
FT   CDS_pept        complement(479109..480365)
FT                   /codon_start=1
FT                   /gene_family="HOG000208172" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752358"
FT                   /locus_tag="ADL118C"
FT                   /orf_name="AGOS_ADL118C"
FT                   /product="ADL118Cp"
FT                   /function="P-P-bond-hydrolysis-driven protein transmembrane
FT                   transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="mitochondrial inner membrane
FT                   presequence translocase complex"
FT                   /protein_id="AAS51802.1"
FT                   /db_xref="GO:0005744"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0015450"
FT                   /db_xref="HOGENOM:HBG051844"
FT                   /db_xref="HOGENOM:HBG396560"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR017303"
FT                   /db_xref="UniParc:UPI0000252A02"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AP0"
FT                   /transl_table=1
FT                   /translation="MHRYSAVKQAQKSQPQRVLAARGFSATRWAGNGPKSPLQVFRETF
FT                   KEEWKKSQELQDNIKALQDAGGRLGESDAYKKAREAYLKAQKGSTIVGKTLKRTGETLE
FT                   HITVQAWESEIGKTTRKTVSKTAQKLDESFEPVRQTKVYKDMSEIIDDGESSRYGGFME
FT                   KERRREKRERDLATGKRATPVRSNEEAGSALVATDKEASESLGKKIQDFKEKTVVGRKL
FT                   HEIKVRLWDENENPLIGLLRTISNKVGGLFAETESARVFAQFKLLDPTFNTEEFTKHLR
FT                   EYIIPEVLEAYVKGDEQVLKQWFSEAPYNVYSAQQKQIRQQELFADGRILDIRGVEIIS
FT                   AKLLPPQDVPAIVVGCRAQEIHLFRKATTGEIAAGHESNIMLSSYAMVLTRDPEKVDDK
FT                   ETEGWKILEFVRGGSRSFT"
FT   CDS_pept        480891..481412
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752359"
FT                   /locus_tag="ADL117W"
FT                   /orf_name="AGOS_ADL117W"
FT                   /product="ADL117Wp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS51803.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG058630"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="UniParc:UPI0000252A03"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AN9"
FT                   /transl_table=1
FT                   /translation="MQTGCCGCILKKEAMLSSVRSGLLLSSSRAFSKCSRTLVAQQDLG
FT                   LLGSAPKNDQVKKVPPEMMKKFATGSLYDPFDFSMARLHLEKKHRKNARKVDIFEELNL
FT                   DPLDLYTSPAILSRFVGNTGKILHRDVTGLSVRSQKRMSRAVRRCQAIGLMSKTHKDVS
FT                   LLSHSVMSER"
FT   CDS_pept        complement(481477..482784)
FT                   /codon_start=1
FT                   /gene_family="HOG000115481" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20623072"
FT                   /locus_tag="ADL116C"
FT                   /orf_name="AGOS_ADL116C"
FT                   /product="ADL116Cp"
FT                   /function="ATP binding"
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /protein_id="AAS51804.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="HOGENOM:HBG058631"
FT                   /db_xref="HOGENOM:HBG447614"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR018955"
FT                   /db_xref="UniParc:UPI0000252A04"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AN8"
FT                   /transl_table=1
FT                   /translation="MNRLPVSVPLARAGRAMFTGRWAAKVEACAKVMGSQMLNRSCRLV
FT                   RDTSCSRCLSTMPARSAGGSLSQLSFEQLYQLRSNLEMLIQDYAKREIPRITYEFLTEY
FT                   VPPLSDNERFMLSIKVLNMLLTYTCRRLLALQRLPYIAVINPNIEESNRLYLKTLESLL
FT                   AIELPYGLHDHAAMREKLITFLDDHGDTLVTLSKGFEEIMDFYPQQKVFDFLNIHLRDR
FT                   LSMKLLVTHYLRLVEQSSGADCIGVLDKRLNIAELVKRTEEFVGDLTFVKYDRIVPVNI
FT                   LEGHDVTFACIPQDLEYVLQEILKNSARAHIENHTPSNYSAEKPIEVTIVRSYEDLEIR
FT                   IRDFGGGIPPDVEDRMFDYSYTTSEKDAKDTGMSAYIIPGQDVSNVSGMGFGLPLCKAY
FT                   VEMFNGELDIVSLWGWGTDVYIRLKGPKESLLDRVK"
FT   CDS_pept        483598..484599
FT                   /codon_start=1
FT                   /gene_family="HOG000164027" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752360"
FT                   /locus_tag="ADL115W"
FT                   /orf_name="AGOS_ADL115W"
FT                   /product="ADL115Wp"
FT                   /protein_id="AAS51805.1"
FT                   /db_xref="HOGENOM:HBG176048"
FT                   /db_xref="HOGENOM:HBG396944"
FT                   /db_xref="InterPro:IPR018859"
FT                   /db_xref="UniParc:UPI0000252A05"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AN7"
FT                   /transl_table=1
FT                   /translation="MSFNAFADSFSKRFQEISSTVQQKAQEAQLDKKLKDLSLSVSQRT
FT                   QDLTSNLPSLAQTTQRRVQERLGQVTDISQMPEEYVELEQRVDRTKLIYDNFLKVSQIY
FT                   ESESYDYPQHISDSVNDFSKTVTGKVQELTKATTTEEAQSILISPGPARNPKTLNYALS
FT                   KVALTSSEYLSKSGSDDVVTADILLKYSDVQAKIAQARLQQDTLIQTRFNRRLREKLNT
FT                   QFAEAMQSRKQVDQKRLQYDIARANFTAARPEKQASLRVQMETLEDQFAQSTEDAVALM
FT                   QAVIDDTEFLKEFQELVTAQLGFHKAAAELLSGFATVFAADSAVHISSADYK"
FT   CDS_pept        complement(484742..486586)
FT                   /codon_start=1
FT                   /gene_family="HOG000165892" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928585"
FT                   /locus_tag="AGOS_ADL114C"
FT                   /product="ADL114Cp"
FT                   /function="L-ascorbic acid binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular
FT                   oxygen, 2-oxoglutarate as one donor, and incorporation of
FT                   one atom each of oxygen into both donors"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS51806.2"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016706"
FT                   /db_xref="GO:0031418"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG052213"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="InterPro:IPR019601"
FT                   /db_xref="UniParc:UPI0001DB2A97"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AN6"
FT                   /transl_table=1
FT                   /translation="MKRRAPSQPVFESKQPFLEIEKVKASFNSKIWDDSYREQLREEVA
FT                   SNKPYNWGTIHDLVDPDLLRSVRREIEKEIHFTNKETDIYKVNQSGDLANLSGLDWKDL
FT                   SRLPSLCRLRQILYSDVYRDFIGYVAGAGKLSGTKMDMSINTYTKGCHLLTHDDVIGSR
FT                   RVSFILYLPDPDKTWKEHYGGALRLFPSIIPNVPTSDFSAKLVPQFNQLAFFHVQPGYS
FT                   FHDVEEVKVDKHRLSIQGWYHIPQEGEEGFVPGEEEQYVNTNISTLAQLESNLLQDYEF
FT                   PKSERSILPLQQLKQLEKFLGSESEDTASYLNADELAYLSMYISEEHLSLEGIKSLQSK
FT                   FTENSYLQIDSFLNEQKSALLKKLIKIEELEKECPYKAAEVEKPWKTAIPPYKWRFMYI
FT                   DGKSHEHFCSEDDIKRRLVHEELPNFTLLKQGLSDHLSVEPALLELVEFFKSFAFKKYL
FT                   ALLTLLCPLTEQLLIRRFRPGHDFTLATKIYPSQLLQHVEGFVDAVLEGVLCLTPTDGW
FT                   ESGELGGYELYMGDQDDEDMNKDVEDAAVYRSDDSGSSVLINKPASWNSFNLVLRDESV
FT                   LQFVKYVSWAAKSSRWDISMNWDVKSFENDPNSNEEKD"
FT   CDS_pept        complement(486929..487255)
FT                   /codon_start=1
FT                   /gene_family="HOG000038164" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752361"
FT                   /locus_tag="ADL113C"
FT                   /orf_name="AGOS_ADL113C"
FT                   /product="ADL113Cp"
FT                   /protein_id="AAS51807.1"
FT                   /db_xref="HOGENOM:HBG435467"
FT                   /db_xref="HOGENOM:HBG587877"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="UniParc:UPI0000252A07"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AN5"
FT                   /transl_table=1
FT                   /translation="MQVSINRSRAQRSLLLSATTTMAGPTRAGVLHLYREFVRSARQFN
FT                   NYNFREYFMRHSRDTFRKHREASGEELQQLWERAQQEVGVLKRQSVISQMYTFDKLVVE
FT                   QLRK"
FT   tRNA            complement(487276..487347)
FT                   /gene_name="tRNA-Gln"
FT   CDS_pept        487380..487916
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079836"
FT                   /locus_tag="ADL112W"
FT                   /orf_name="AGOS_ADL112W"
FT                   /product="ADL112Wp"
FT                   /protein_id="AAS51808.1"
FT                   /db_xref="HOGENOM:HBG058632"
FT                   /db_xref="UniParc:UPI0000252A08"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AN4"
FT                   /transl_table=1
FT                   /translation="MCACCARVPCPAQEPARTKLCQHIASPPRHGPGPRATATAAGAPQ
FT                   RRARTHLRAARRCSRAGARPPVPGCRVLAHPPPAHRRRRPRSSRAARCAAPHGPARARP
FT                   ARARCLQPRLGHARPPRPARDCRLRSRPRLGPRRHSPLRAARLRRPRRRGRPGLRGRTP
FT                   LPRRPAPPPPYIADL"
FT   CDS_pept        488383..490119
FT                   /codon_start=1
FT                   /gene_family="HOG000186929" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752362"
FT                   /locus_tag="AGOS_ADL111W"
FT                   /product="ADL111Wp"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="AAS51809.2"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG336641"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI0001DB2A98"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AN3"
FT                   /transl_table=1
FT                   /translation="MVKDTTYYDILGVTPSASAEQIKKAYRKKAIQTHPDKNPNDPDAQ
FT                   AKFQEVSKAYKVLSDPDLKNRYNEFGLSDERGEMVMEEDPFEMLMAVFGGDSFQQWIGE
FT                   YSFLRNLMKQTELFECEDEDDEHGESQDNKSAGGTPAGSACGRAESTHLSTYQRTASAG
FT                   VSGGARSGGARSGGASSGGASSGGSGARTEQTSASSADTGTSGSSDQARKDRRHRQRER
FT                   FLELERERREEKKRQIEELARILDKKITDYQIAALAGRVSEFQESLQSEIDKSLKTESF
FT                   GIELLQLISKVYRSKANNFLMSQKTYGISRIFTGMHEKTKSVKSTFSMLNSAMNAMSAQ
FT                   KELEKLDLENMNPYERAQIEFLIQGKSMGMMWSLNKFELQSKLKGICDRLLDDKTVPSR
FT                   QRVGKAKALLFIAEMFGNARRAPGDVDPAILEFEEMVLQSKNVRIKTRKQPGRVTDQNI
FT                   FFAKLNSADQENVPPTANGPPPTQGRERLHTSRSQHASQKPAPSRPHTSRSPPQRPSPT
FT                   RSTSQREPPQRPSTAHPSPTRSSNLPSTAHGGSVRGSGSYATARVSPMHDTPPRAAAHP
FT                   LC"
FT   CDS_pept        490455..491876
FT                   /codon_start=1
FT                   /gene_family="HOG000093805" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752363"
FT                   /locus_tag="ADL110W"
FT                   /orf_name="AGOS_ADL110W"
FT                   /product="ADL110Wp"
FT                   /function="hydrolase activity"
FT                   /protein_id="AAS51810.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG058634"
FT                   /db_xref="HOGENOM:HBG396668"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI0000252A0A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AN2"
FT                   /transl_table=1
FT                   /translation="MSQQNLKKLTILALVLALASNLYIYTYPSLFPCRCSFEQQNALQG
FT                   LDDNSTLAQRVWCRSQYYFSDVTKQLGSTHTRAATPEQGAVPEVRLLAIGDPQINGIWP
FT                   TTPYLRRLEIFINDYFLGHVIQRMLRRLAPTHVAVMGDLFSSQWIGDSEYYNRTMRYTR
FT                   RLLGRSDKLLQAQRDESHDAAGEYNRDWQQYGRDYEAVRQGDLTMFSWHRENAWRWAPE
FT                   DDYLLINITGNHDVGYSGDTTYQHMARYKHLFGEDNYWIEYDRDTDHAWRVVVLNDLLL
FT                   EGPALQPEFIDTTWRFLEHLAARDFPGTTVLLTHVPFHKPAGLCHDNPETRYYPPGYER
FT                   EPYKVGLLRSQNLLSPDVSDRVLNLVFANGKPGIILTGHDHEGCDTAYTRAPDGSWAAQ
FT                   PPSAQPAHVRELTVRSVMAQYGGNVGLLRGSFDPATASWRWTYSVCPFAHQAVWYCAKL
FT                   MPVVLILLLSTLYVW"
FT   CDS_pept        492306..494522
FT                   /codon_start=1
FT                   /gene_family="HOG000216613" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079837"
FT                   /locus_tag="AGOS_ADL109W"
FT                   /product="ADL109Wp"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="AAS51811.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG191165"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI0001DB2A99"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AN1"
FT                   /transl_table=1
FT                   /translation="MDGGSNAIGLLSRLSRRMKKPQQPLTDLTQLYSDVANETITNLGL
FT                   EERGEIKRAYQGWKALQTHVLYELGRIERSYPQVHLYNSEEMGLQSGVQELYTKLQVHM
FT                   ERVGRLYETEGDRGRQTRSGTTQSGSSGSKAGSIGGTTLLRTLRRPPPAEEASARPGAT
FT                   EPAAAPAREADQFFGFDEDVNLIDLSDEGESPRGGSKNPFITGSPEEEGDGSDYEFNVD
FT                   DYFNHYLEGDEDETPLGAKLERLSLESSEPPPVLATKARAEPSQSRAPANRGHYRAGPR
FT                   AASSTASLGNLGRPCSAPTVDGANLSTQAARNAVQPVAAAAASSGNIPAARRARPERRR
FT                   VKTQVRRPGGGSGHAVTSRYIVYRKSATQKATPVGTPGGTPPLGVKGEPVPNSWHATPC
FT                   GSPAASLTKDINEEAYSEDLKEEMEAGIIDSLRGVDKTAAKQIFSEIVVRGDEVHWDDI
FT                   AGLDSAKNSLKEAVVYPFLRPDLFRGLREPVRGMLLFGPPGTGKTMLARAVATESHSTF
FT                   FSISASTLTSKYLGESEKLVRALFAVARKLSPSIIFVDEIDSILGSRNNNSEHEASRRI
FT                   KTEFLVQWSALSNAAAANEANEEDERVLVLAATNLPWCIDEAARRRFVKRQYIPLPEGE
FT                   TRRLQIERLLSKQKHTLTEEGFAELIRLTEGYSGSDITSLAKDAAMGPLRELGDNLLMT
FT                   PRENIRPIALEDFINSLNYIKPSVSPEGLLQYENWADKFGSSGV"
FT   CDS_pept        complement(495247..497592)
FT                   /codon_start=1
FT                   /gene_family="HOG000113831" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752364"
FT                   /locus_tag="AGOS_ADL108C"
FT                   /product="ADL108Cp"
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51812.2"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG181557"
FT                   /db_xref="InterPro:IPR007207"
FT                   /db_xref="InterPro:IPR007282"
FT                   /db_xref="InterPro:IPR012270"
FT                   /db_xref="UniParc:UPI0001DB2A9A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AN0"
FT                   /transl_table=1
FT                   /translation="MAHRKLQQEIERVFKKINEGLEIFNTYYERHENCTNNPSQKDKLE
FT                   GDLKREVKKLQRLREQIKTWQSAPEVKDKDALLDYRRSVEVAMEKYKAVEKASKEKAYS
FT                   NTSLKRSEVLDPEERERREVSDYLSEKIDELERQYEQLQVDMDRLIGGRKRRGTAQEER
FT                   KLELRQLQVRYRWHQQQMELALRLLANEELDPQAVRDIQDDITYFIESNQEPDFVEDET
FT                   IYDSLNLDANEAIAHEVAASFAAQANEESDDEQRDMSCLSKKEQRRLEREAKRAAKLAA
FT                   KGSLDSISSTPVTSAPSSALDHEPTDEVQDLASSSVVPKEDDPPTPASSQSPSPTSTPS
FT                   SSIPSTANTIATHTQSSKPQTPLAKPRQLTHISPEHQGHTHIHQTLNGVTTSTLKPATV
FT                   PAKPAGELKWAVAAAQALEKEKREKSASLMAMKTQGASSPRATMDMSSTSQLTDAHSSS
FT                   NRSDTVYSTHAEDRGHLSGDNKDIPKVGNSAIKSTHLDALKKQEMPGLELVADNYESDS
FT                   TDDELPEEPMPIQLDVEEYERRGSVSNQLFTELCQNFDLLKLPCGIQDMIMGSLITSHD
FT                   LHPPDGKLGGFRNFPDICRVTRLFELPRGVNPPQPLDATRCTEQWDSVRIGLVDEKTVE
FT                   DQEDQDLRISTYSKFRVLETFTLFYVYYYAYTPLEHDIAATILAEREWRVSKDGATWFL
FT                   REGQPKFTNELCEVADFKIFKLDDWTAINKMNFTLDYSILKDSQKPTAAGSGTAGSTPS
FT                   RHGSLSHGQTLLQQLRRGSSAMKVEPSH"
FT   CDS_pept        complement(497926..499530)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752365"
FT                   /locus_tag="AGOS_ADL106C"
FT                   /product="ADL106Cp"
FT                   /protein_id="AAS51814.2"
FT                   /db_xref="HOGENOM:HBG058636"
FT                   /db_xref="UniParc:UPI0000EA261E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AM8"
FT                   /transl_table=1
FT                   /translation="MSDQQFVHPLGLKSRLLGCLFSPLVVVPAVVYLFTIWTVHTIAAP
FT                   HGTAVPPAALPGAPLLPAAGPAAPAGGTLWPPAAPTFDVRALDDALRRYLDESLTTSAQ
FT                   TLDRYIRENYNHTVDASLRAWNETLSSSIKLLHELLLQQQRQSVSISGELQSQGQRIRG
FT                   AVKRLTETGLSVGSDLGPRVSDMHLDDSFLAPLYKDVNSTIKQLPSLIPAAFPAFKWAP
FT                   LNLSSVRREADQVRREALHLYANRYSGDLRRRSTPPALGLAARHTAVVAALTAAALVLR
FT                   CAGEWFAFHLQNHAIVRAALEAHEPPCTGVALTAWRHAAIRALAAAHEHPFVYCALRPM
FT                   RDLAPRAWRRASTWALWCGAHGGALLWFLLFVALTDWQLAVATLPHAQRLHHRAQPADA
FT                   ADVVANLHAALETRLRPALRDAHAAALGAAADHLHRKLAPLLARIDSSRPSVLPLPALI
FT                   VPQPVWPAWPPAADLAPVIRAAIPRAHPLRLASRSIPAPQFVAVSLSTVFRPAVIVIAV
FT                   LIIIHHLVGLLLVLRTR"
FT   CDS_pept        complement(499734..500795)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752366"
FT                   /locus_tag="AGOS_ADL105C"
FT                   /product="ADL105Cp"
FT                   /protein_id="AAS51815.2"
FT                   /db_xref="HOGENOM:HBG058637"
FT                   /db_xref="UniParc:UPI0001DB2A9B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B06"
FT                   /transl_table=1
FT                   /translation="MSSAGSRAQAERAKGRSACELQGVSEHIIVENQRGITLFGYPFFS
FT                   NKLLIPKVDPPQFHTEKEQQPISTTTSNYYGNTNNKLLLPLHFRYTGTLGAEGTGRLRG
FT                   RPASGGSDDEFAWFVSMDYRGQYDIDDQGWCYSWSFRSKYWKGKSGFVRKRFWVRLPTR
FT                   SEHLGQTSGPGARAGSRGARSAMHRTGSAGRAGWAAARHTEPQSPIAEEDDEKRDEDRA
FT                   DTACMLGSYTRQEFSALYEGGNGRFAEELAQLVRKIDKLPLDRQKFEALEEFVQGMTPT
FT                   QHRDMCRIVRDPNSGFTGKILSSFQFDVSRRKFLERWIHGLLMDTGQTESQTTTQKMGR
FT                   TPANQRQRGSTQQ"
FT   CDS_pept        501579..502526
FT                   /codon_start=1
FT                   /gene_family="HOG000184669" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15752367"
FT                   /locus_tag="AGOS_ADL104W"
FT                   /product="ADL104Wp"
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="AAS51816.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG058638"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="UniParc:UPI0001DB2A9C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AM7"
FT                   /transl_table=1
FT                   /translation="MRAAGGVHAVHAAAQGHYGVPPATYMSDPVIQESLSPFFQPVGID
FT                   VTRLPLTNPPIFQSSLASYNGPPQRRRISISNGQIGQLGHMGQLDDEDVMESIYDLQPP
FT                   PLPQRRNGAKPFSKPVVSHEQFLARQHPPSYQAAYVDVAPGKPAEGHGAAYAGSVSSAP
FT                   LHPHPEQPLTRPAHVLDAMASGPDFPRAASSSSLPTLYDAPPGTAAWKRARLLERNRIA
FT                   ASKCRQRKKIAQLQLQKDVDILTKENKEIRRELEYYQKLVSKFKRFIELHMETCNGSNG
FT                   GVQIIEEMLKIDHSIVGQENDSGDKRDTSEEAPI"
FT   CDS_pept        503169..503939
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752368"
FT                   /locus_tag="AGOS_ADL103W"
FT                   /product="ADL103Wp"
FT                   /protein_id="AAS51817.2"
FT                   /db_xref="HOGENOM:HBG058639"
FT                   /db_xref="UniParc:UPI0001DB2A9D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AM6"
FT                   /transl_table=1
FT                   /translation="MAWVLSSYRRARWLWLLPDLGADTKRMARGLQTFIVSHYAFHAGA
FT                   EAMVKYVTHTLYYKFMLELWDTSHEQLQSGKYYGHEFSRYGPEALNRSALCKEQRRMAL
FT                   VILKIRSQRNRGKGPAVRCVMFMLQILESLARSYVKLSRRKAPHAGMETVGLQKAYLQI
FT                   YERRTKTFNDKYMVEICNILRRHENSVKALELMIKETLKFLQSLDWKSLHLNQKDCDEL
FT                   ASYRKFIQCSLLLTDNTSLIAGCRLVISKWPTKP"
FT   CDS_pept        complement(504097..505215)
FT                   /codon_start=1
FT                   /gene_family="HOG000233021" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079838"
FT                   /locus_tag="ADL102C"
FT                   /orf_name="AGOS_ADL102C"
FT                   /product="ADL102Cp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS51818.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="HSSP:1JWH"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000252A12"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AM5"
FT                   /transl_table=1
FT                   /translation="MKSRVCSEARVYTRVLAPLGEEYWDYENTTIDWRANNSQYEIETK
FT                   VGHGKYSEVFQGVQLSSRSKVVVKMLKPVKKKKIKREIKVLMNLASEQRAAAGFDKETY
FT                   YSNRSAEVRVYNRYDQVYTMPHNGHENIIHLLDVIKDPISRTPALVFEYVDNVDFRILY
FT                   PTFSDMDIRYYMFELLKALDYCHSMGIMHRDVKPHNVMIDHKQRKLRLIDWGLAELYHP
FT                   KEEYNARVASRFFKGPELLVDYRMYDYSLDLWSLGTMLASMVFMKEPFFHGRSNTDQLV
FT                   KIVRVLGSEDFEKYLVKYQITLPREFMDMDQYIRRPWKRFINDANRHLCDNEEIIDLID
FT                   NILKYDHHERLTAREAMQHPWFAPIRNGEYKL"
FT   CDS_pept        complement(505432..506256)
FT                   /codon_start=1
FT                   /gene_family="HOG000041208" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752369"
FT                   /locus_tag="ADL101C"
FT                   /orf_name="AGOS_ADL101C"
FT                   /product="ADL101Cp"
FT                   /function="actin binding"
FT                   /biological_process="actin cytoskeleton organization "
FT                   /cellular_component="F-actin capping protein complex "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS51819.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008290"
FT                   /db_xref="GO:0030036"
FT                   /db_xref="HOGENOM:HBG016210"
FT                   /db_xref="HOGENOM:HBG445391"
FT                   /db_xref="InterPro:IPR001698"
FT                   /db_xref="InterPro:IPR019771"
FT                   /db_xref="UniParc:UPI0000252A13"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AM4"
FT                   /transl_table=1
FT                   /translation="MSEEKYDAAMDLLRRLDLENLESNLQALIELEPALAADLLSSVDT
FT                   PLTVKADPSCSGREFLCCDYNRDIDSHRSPWSNEYFPRLSAEELAESPFPSDALRRLEV
FT                   LANDSMDIYRDLYYEGGVSSVYMWSVDDAADDFAGVVLFKKGAQSTSHWDSIHVFEVLH
FT                   EGSHEVVYRITTTIILRLKDANAVALSGNLTRQTEKTASLPSGSEERTHITHVTNLGSA
FT                   IEEVEGQMRNLLEVVYFDKTKDVYHELRNDAAESLQVNRDKHQDLIKGLQGL"
FT   CDS_pept        506692..507135
FT                   /codon_start=1
FT                   /gene_family="HOG000164093" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752370"
FT                   /locus_tag="ADL100W"
FT                   /orf_name="AGOS_ADL100W"
FT                   /product="ADL100Wp"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS51820.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG198322"
FT                   /db_xref="HOGENOM:HBG444695"
FT                   /db_xref="InterPro:IPR005352"
FT                   /db_xref="UniParc:UPI0000252A14"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AM3"
FT                   /transl_table=1
FT                   /translation="MWSFNYLLTQSRGILGSLPPGKLPSWLLFISVVSVFNSVQTYINK
FT                   ELTRRVYENKPSETTDLSARTFGTWTLLSSVIRLYGAFYLYDERIFQLTFITYSIALLH
FT                   FGSEWLIFRTCKLGKGFMGPLLVATTSLVWMYNTKEYYTGRGW"
FT   CDS_pept        complement(507279..508655)
FT                   /codon_start=1
FT                   /gene_family="HOG000196669" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15752371"
FT                   /gene_name="PKAR"
FT                   /locus_tag="ADL099C"
FT                   /product="cAMP-dependent protein kinase regulatory subunit "
FT                   /function="cAMP binding"
FT                   /function="cAMP-dependent protein kinase regulator activity"
FT                   /biological_process="regulation of protein phosphorylation "
FT                   /biological_process="signal transduction"
FT                   /cellular_component="cAMP-dependent protein kinase complex "
FT                   /protein_id="AAS51821.1"
FT                   /db_xref="GO:0001932"
FT                   /db_xref="GO:0005952"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0008603"
FT                   /db_xref="GO:0030552"
FT                   /db_xref="HOGENOM:HBG338945"
FT                   /db_xref="HOGENOM:HBG736470"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR002373"
FT                   /db_xref="InterPro:IPR003117"
FT                   /db_xref="InterPro:IPR012198"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniParc:UPI0000252A15"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AM2"
FT                   /transl_table=1
FT                   /translation="MVLSQEHRDLLDAFQKEVEQRRPGDLLQFAANYFNKKLEEERLFV
FT                   RSQESLALSKGVVLFPGSEGCGANRAAGSPDARKTGEDEDVMFKLPFVEHDPHSRHIYD
FT                   DNKHGHDSCDPHTSFSREPGAGLFQGGYNMGQEAQKEAQTDFDPKASEVSSILKQRNVP
FT                   RKSGVNSKPLPMNFNAERRTSVSGETLKPDHFSDWTPENYTEKTREQLKGLESAVGKNF
FT                   LFNKLDSDSKTLVINSLEEKLVSKGQEIIRQGDEGDYFYIVEKGTVDFFLDDRKVNTYG
FT                   PGSCFGELALMYNSPRAVTAVAATDCVLWALDRLTFRRILLSGSFKKRLLYDDFLKSMP
FT                   LLKSLSNYDRAKLADALETEYYEAGQQVISEGDVGENFYLIEYGEADVSKRGVGVVQHL
FT                   KKGDYFGEVALLNDLPRQATVTATTKLKVATLGKSGFQRLLGPVVEVLRLNDPTRADKR
FT                   "
FT   CDS_pept        complement(508875..511289)
FT                   /codon_start=1
FT                   /gene_family="HOG000172362" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079839"
FT                   /locus_tag="ADL098C"
FT                   /orf_name="AGOS_ADL098C"
FT                   /product="ADL098Cp"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="AAS51822.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG522470"
FT                   /db_xref="HOGENOM:HBG717285"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0000252A16"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AM1"
FT                   /transl_table=1
FT                   /translation="MTRLRTRAAKSGVRVDYREQDQNFLYEVEASSSDEVDIIKDATAT
FT                   WLEDEKVELDITLDSDAEGDAELDAELDMNRRRAEKSAAAASEDAQDTEKDLDAYAVQE
FT                   RVDRLQEFVRQSKVYSGIIADTLLHRAQERQSEQASSAAAPGPARKKPKTVVEFFKRSK
FT                   QQPADEKQPEPSIQQPTLVRNCTLKPYQVEGVNWLITLYENGLNGILADEMGLGKTIQS
FT                   IALLAFIYEMDTRGPFLVTAPLSVVDNWITEFEKFAPSIPVLKYYSADGPGKRHAILKE
FT                   FFRKNSGEGVVVTSYEIVMRDMNVILSHQWKFLIVDEGHRLKNINCKLIRELKRINTFN
FT                   RLLLTGTPLQNNLAELWSLLNFILPDVFADFEIFSKWFDFSDLDLKTSSQRWDKIIGEE
FT                   LEKNLVTNLHTILKPFLLRRLKRVVLADALPPKREYIINCPLTPLQTRFYKMALAGKLK
FT                   RTVFTQAIKEFFTLNREHIGSVSNKTIREFIDYKTSDEEIQASKVITDMEKLYEQHIHK
FT                   ELRNKRLQNLMMQLRQIVDSTFLFYFPYLKAEDLQLPVLLQTSGKLQILQQLLPRLLAA
FT                   KHKVLIFSQFVSMLDLIEDWCELNNYSACRIDGSMDNETRREQINSFSEKGSPHSLFLL
FT                   STRAGGLGINLTAADSVILFDNDWNPQVDLQAMDRSHRIGQQHPVIVYRLYCDKTVESV
FT                   ILARATNKRKLEQLVIQMGKFSTLKKLALNEHSFLTLGTQTASNNNARELVQELSKLLL
FT                   DSESTFSFSSAGPLTDEELEVLTDRSIQAYKITDTEYPHIKLFETSSGFDN"
FT   CDS_pept        511899..513623
FT                   /codon_start=1
FT                   /gene_family="HOG000246692" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20623073"
FT                   /locus_tag="AGOS_ADL097W"
FT                   /product="ADL097Wp"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51823.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG434010"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR007526"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="UniParc:UPI0001DB2A9E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AM0"
FT                   /transl_table=1
FT                   /translation="MSEPMDVQDGNIDNAGDGTLSSGNTGSVNPSVPVLPHLQQQQQQQ
FT                   EQPKIDYEQEAQKLEDKAARFLAKQAHPVIVPSFASWFQFNEIHELERRALPDFFNDSV
FT                   RFKTAKAYKDVRNFMINTYRLSPYEYLTVTAVRRNIAMDVASIVKIHKFLEEWGLINYQ
FT                   IDPRSKPSLLGPAFTGHFQVVLDTPQGLKPFVPPEVVELPSDATASAPASGSAAASAAP
FT                   ATAETNSTDEEPVPGSNTNTFSSAPKVKMEFKQPKPFPVNLSLRKNVYDSVHDFNALRS
FT                   QQQQSKQIHKTYVCFTCGNDAVGVRYHNLRSGDTSLCSRCFQEGHFGANFHASDFIKLE
FT                   NMIHGNKSWSDQELLLLLEGIEMYEDNWEKIVDHIGGSKTLEECVEKFLTLPIEDKYIN
FT                   EVTPQSVKRTKGPQVLDTKDAVTATIQALLNGLNDKVLDEDIPESAMQISSKYLDEAHI
FT                   LTHDLVQLTLEKLDLKFKQLDAVEVALKAERDKFSRETEKLRNDRLSLSKQVSDINKDL
FT                   AQLNISKKLVLPSEQADSGVALVEKESGTNEEFKKLAQQDLESVSKAQPQLYKPWSL"
FT   CDS_pept        514142..515320
FT                   /codon_start=1
FT                   /gene_family="HOG000185308" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928586"
FT                   /locus_tag="ADL096W"
FT                   /orf_name="AGOS_ADL096W"
FT                   /product="ADL096Wp"
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS51824.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="HOGENOM:HBG048450"
FT                   /db_xref="HOGENOM:HBG715717"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniParc:UPI0000252A18"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AL9"
FT                   /transl_table=1
FT                   /translation="MRHVFPFSARYNALLATVYLSLIPCALAYLIPGLRASGRNRSSLF
FT                   LPLMVSFAFGGLMGDVFLCLLPEVFHSHELDGVERIMEMMRRPDERVASGLIRMAHEHT
FT                   PNMALGMAVFAGFFLFLAVDKTLRIVGGDDASLHSHSHAHAHSHNDVSSHAQHGIGAAC
FT                   TPSNVFLEEAEQTLKKRNKSDILLESESSAEQTSAPGMPASAATGAPVSQSLRTSIYLN
FT                   LASGFIHNLTDGVAIATAFYTSKSVGVTTTIAVLMHEIPHELGDLALSLSSGMSFSYAM
FT                   KSQLLTSFGALLGTAAGCLLNEFAHQEPKSFIPEIGLLTNTYSRNTWGLSIPPQDLILP
FT                   LTAGGFLYIGTVGVVPELLHTTYPDNPSKELMKTMLQVVAIFAGFSLMSVMA"
FT   CDS_pept        515632..517119
FT                   /codon_start=1
FT                   /gene_family="HOG000162199" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20623074"
FT                   /locus_tag="AGOS_ADL095W"
FT                   /product="ADL095Wp"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAS51825.2"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058607"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001DB2892"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AL8"
FT                   /transl_table=1
FT                   /translation="MTGVGDHVVAPDFPMKAMSEQVHEITTEFGSPDQPVYGQAEGAGG
FT                   TSTGKLDEADKDGFVYPEGGTKAWLVTFGAMLGILPTWGIFFVAGTIENYIAHHQLAHE
FT                   STSTISWIFSVYNCLVLSSGIISGLYFDVAGAQQPLALGTAIFVCGLIATANCHHVWSF
FT                   VLAFGVLTGIGSGIVTSPMLGSVCHYFYRRRGLATAVAINGGSVGGAVFPMMLEAMFRR
FT                   VGFEWTMRAMALIALVCLALAFVLVRADPSKLMVKPRTQKPRAGPLRRVARTVRDCFDY
FT                   KALANPEYFWCTLATSTAELSAGAVLTYLSSYCAKAGYAEADSFIVITILNSLTILGGI
FT                   LFSVVSDHWLGHFNVMILMNVSMALFSLAIWFPFGTRGRGIMYAFAALYGFFYGSMLNL
FT                   CPVCCSKISRTDEFGRRYSTMYVFVGLFFFAGIPIAGAIIGPGSLVRYRAFILFTAVMI
FT                   AFSAGCFVVSKTYALHRSRDARSSLLAAARHHLFTIY"
FT   CDS_pept        517460..518239
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079840"
FT                   /locus_tag="ADL094W"
FT                   /orf_name="AGOS_ADL094W"
FT                   /product="ADL094Wp"
FT                   /protein_id="AAS51826.1"
FT                   /db_xref="HOGENOM:HBG058641"
FT                   /db_xref="UniParc:UPI0000252A1A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AL7"
FT                   /transl_table=1
FT                   /translation="MAGLELVIAASQVDFERGDHVTVTGAFDGWQHEKHILQYDEGARA
FT                   FRVELPYSGEEELVFKFVLNGSQWLTVGCFEAITDPEGHVNNRILCRDWLRPEEPLRES
FT                   VATMDDVTIGTPEAEVQSLQLDASTELASSGSSEFHSGVSCVHSSDSDSDTEAAMRSML
FT                   TSASSAGGGTYSGLLAGEDSAQLPAADSGGRPPLSFPGDYIHVASRGECSSSEEVELSS
FT                   SVTGDDDMRYSHGSADPRPRLQGLLSVIRVFKTYWKG"
FT   CDS_pept        518820..522182
FT                   /codon_start=1
FT                   /gene_family="HOG000141696" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928587"
FT                   /locus_tag="AGOS_ADL093W"
FT                   /product="ADL093Wp"
FT                   /function="binding"
FT                   /protein_id="AAS51827.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG058642"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013721"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR020839"
FT                   /db_xref="UniParc:UPI0001DB2893"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AL6"
FT                   /transl_table=1
FT                   /translation="MSEVRRSRRIREKSSREDDHEEGPLEADHSTAVVQADEQTYVEGD
FT                   EASEEESSGEEDGHSDEDYEEARAKKRRPRSGGGSRPGSGGAKRARTGTGGTRSRMAGV
FT                   GAGTKKEQDEYLALQEDFEPCRLFRIFSTAEDVSVEDIASDWLEEYNASRTGALKEFIN
FT                   FLLNCCGSLVQVAEHDVLNNDSSNETVDEVQMLFQDQKIHEFHLYISKTQKKRSKYKPL
FT                   YDNFAEFMTKLIELASDKDMIYIEKTDEGDGEPQTVIETGPLMLDLFTWLSSFSVCKIR
FT                   CLRYVATLAMYLFQDQLTHLVVEMDTQSLLKLRKQLAMEQKKKRPSVKAVHKLESTIAD
FT                   IQGTRTVLESNIENIIKLCFVHRFKDVDETIRSESVLHLAKWLENYPEHFFKATYLKYF
FT                   GWLLSDTSSVVRLQVLKTLSDLVKFINKQFRNMTDDSSLRQFFERFKHRVLELALKDID
FT                   LQVRLAAVQVLVEINKFRYLEDSEILSITSLIFSEHEVKVSSSAKNAKFLSAVSKFFSH
FT                   VERAQVPEFMEGKDPKKKIGDVKLGTVAEVGILMRFLIKSLSLYLNEQDPLEQTTERKV
FT                   HLLFQAAEFLQPYFGHLIKPICQLLTFQGEFGDISELQSTEEDSDAEEQGEYSMELNKL
FT                   LLPENENTVIQYITVLSGLCHGAVAIKQHNSKAETAETAMGYLLELFGHLNLDSPVIFD
FT                   QLLKIFQLFRYEDWITYGREGAFQQLFEIVVKKFKDMAIYTDPDDIRRQAFTDILQYTQ
FT                   TLSSKKIEELWKNQLAEIKIALNKYLHEMDLSDPNKADQQLQTLQLMYLNKLVLFGKYY
FT                   RVDFDTELLEMLFTKYMNPLALLSSELSDTTLGIVDFKILTQVTTWNLQTWYQIFEDTN
FT                   TPTPISKPMLELNKFIIDQLSITLITLQREHSGELSRKLAIEHPVCVTLLDTVTAIKLF
FT                   ALNLPDKEAEWRHALTRDYPIYIDCPEAIMEVLLYLEALYANSIGVNLERGDEEAVDFN
FT                   DLAPREDKADPIKLEKELCVFALKLRSLFKLGLLNHPHIEERLGLNREALGSLFQSIVD
FT                   DSIFSEPEEQRVRKSSPPASSSTAPRTDRPHTQEELEPIEEFSLEETTRRPLPLQEDPI
FT                   EEEDEDLGEDDNQ"
FT   CDS_pept        522354..522767
FT                   /codon_start=1
FT                   /gene_family="HOG000248321" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752372"
FT                   /locus_tag="ADL092W"
FT                   /orf_name="AGOS_ADL092W"
FT                   /product="ADL092Wp"
FT                   /protein_id="AAS51828.1"
FT                   /db_xref="HOGENOM:HBG058643"
FT                   /db_xref="HOGENOM:HBG202990"
FT                   /db_xref="InterPro:IPR018937"
FT                   /db_xref="UniParc:UPI0000252A1C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B02"
FT                   /transl_table=1
FT                   /translation="MSYISKILLAISVLQLVHSGFSSFEFHRLKRHLTLADGIPQGFRL
FT                   PSDIKAEVVCALVLFTLGIFLSFEKLQHLPLTGSRTPLTQDLYLHEIRMSEATKTDNLI
FT                   GSETYGDFTFMPSFIDVHARRKEIRTYMQHKNQ"
FT   CDS_pept        complement(522804..523160)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752373"
FT                   /locus_tag="ADL091C"
FT                   /orf_name="AGOS_ADL091C"
FT                   /product="ADL091Cp"
FT                   /protein_id="AAS51829.1"
FT                   /db_xref="HOGENOM:HBG058644"
FT                   /db_xref="UniParc:UPI0000252A1D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B01"
FT                   /transl_table=1
FT                   /translation="MLRREPTTIQLTSDDLAELQDNLEEFKLLQQIKSQHMDLVRSSTR
FT                   VGPPPAAAAADEPRPLSCSFQISPLNKQMQQQQQHRRAAGAGGLGEQLATQGIVTNTPV
FT                   LDERDTSNPFIQRG"
FT   tRNA            523483..523555
FT                   /gene_name="tRNA-Lys"
FT   CDS_pept        523710..527525
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20623075"
FT                   /locus_tag="ADL090W"
FT                   /orf_name="AGOS_ADL090W"
FT                   /product="ADL090Wp"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS51830.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058645"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI0000252A1E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B00"
FT                   /transl_table=1
FT                   /translation="MAADGDDQVPPCCRICRMEATEDNKLYHPCRCKGTIKYVHEPCLF
FT                   EWMESKRVEISRPGTTARCDICGVELRMRTIYEDRMGWDTLRQVSLRTLKRSYKVAHDL
FT                   TSAGAILLFFAVWLPVAWGGWCALYSAALDGAPVLQTEYPEFVAAWLRAVGVVPWRRGA
FT                   GVMWDKLAIGYGMASLSMVGTAALTLAFYTFTDMIVQSESFPKMLLLRIGPKYSNVDLL
FT                   RDRLRQRFPDLPEDVTKKFAVLADLAIRNDIPEFLQNIGGTDNENWELPLNLNRRYLQA
FT                   LLYGEELADRRNIHVGQDDNGEHGASHDELDDEENEASFNLNQDDTVIDMQTEYAIETP
FT                   LDPSEHNIERNAALHDFVELLDAHDVDIHDRNQEMVQMPQFNQPENDWNAGDQDEVRGF
FT                   QLDIKINLFSAPLYSFVITIVFGIFLMATYVLPVVIGRYLLSAYSGLLLVFWNIFSHAV
FT                   KKVAELFPKYVLLLLLESDIGSYAMDYLLKMEIALSSLFYMKYFGTSSLIYYPKALPLV
FT                   TFYASLMVLVIIATDYLGRGYSVVNRMRNEKLRKLYTFAFAATCTIKVFILIYAEIFGF
FT                   PYLSGLMVKYSVIKALVPLASWQFLSHIPLSRTCTSIIQYALDMMVGLHCMYMFASFIG
FT                   TVRRHIIRPGVLFFIRSPDAPNMNILQDNLLYSMKIHFSRLTMSLFMYMTIIIGGIGFH
FT                   TKLLLPFLFKNGLYPLEKSPDIHAVSQSLVVFYAFAFVGRSQALKDLGKNYWTMVFNIC
FT                   CRRLRLSSFILNKDIPMERGYVIYRNYFYKYLASKRARWSNSTLYSSPKTHEEAQQLFR
FT                   ADPSVHAYFVPDGCLMRVPASDLVSRNYVQMLFVPVTKDDKLLVPLDLEGIKRRGSENA
FT                   GEFSHLAKQSTDFDTYTVVYVPPSFKLRYSLLLLLIWAFTSLLFISVGVGAHVVGQTIL
FT                   WLLTWTMPTRLIAYIDFVTNDQSFKQLNLYAICLGLVVSTLSIQGNVFGHMATFYHNTI
FT                   GRRLSNETQDNSEHPNAPTRNEQGIDGAGLALDEFTVSAVLHKVKGLFTRLDLAAADSA
FT                   FSPFYFCMCLTLTCNFIHLANEFRAEMLDPVFYQNYWDKVFKYLRWITPFGTASTEKDN
FT                   GILPLMLDVIINKYPEFLQRSTMFERFVCSCLYISAYTRRERNTPLFIPLLKRCCGGHI
FT                   FVIGFTLLFQMLAVELDYQFNASTYGTRAAIYQSWANFMLLHEESGMKFSVFQHIFYLA
FT                   CPLISIFHSLYEISLITLRCCAYISQKMIDELYGKGRTLIDMEDDI"
FT   CDS_pept        complement(527767..530691)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20623076"
FT                   /locus_tag="AGOS_ADL089C"
FT                   /product="ADL089Cp"
FT                   /function="cysteine-type peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="AAS51831.2"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008234"
FT                   /db_xref="HOGENOM:HBG058646"
FT                   /db_xref="InterPro:IPR003653"
FT                   /db_xref="UniParc:UPI0001DB2894"
FT                   /db_xref="UniProtKB/TrEMBL:Q75B03"
FT                   /transl_table=1
FT                   /translation="MSRHRRLGLSPMDTLSGTSRAGKPTRHSGERYQAGRQRSGGVVAM
FT                   LEGEVPVQKRHKGSTSEGEGNGLLRAAGEGDEGGLLEGYLELVEKEGMRRIEGVQLAVR
FT                   GAAGTLMCELQSAAGHDLCLLDLQRDARAFYFDMHTTCVGLHLNQKVLLLGERMEATAQ
FT                   LLIWSTRGDRSDTRLVDIERTLKEAGLPVSDAASKSGIEAALRRQLSSVAEEGTKRLGM
FT                   LDKPLSSLNNTKTFKRKYGKSGQVISFPHTVECGSSDEERCDSPRSEISPKSFYGSDRS
FT                   SPSKPDLADHTYSSGLRKSSRLLDINNKKQFVVEDEDDYEKPEVFKPTLHYQFSDDTKY
FT                   TVTNQDFKCLYNHDWVNDTILDFFLKYYVECTISDSDLSLSDVHIFSSFFYTKLVSNPE
FT                   QYYANVKKWVASSNLLEKKYIVMPINVNFHWFGCIITNLSKLLRFFREGFHERWLEQSN
FT                   SDSNVNEKERLLFPVVTILVYDSLRQTHSREVEPIKVFLIDYVKDKYGFDLPKAQIRMK
FT                   LCTVPRQPNMSDCGIHVILNTKKFFENPQKAIMLWYQKPSHLLTKEINLYFEKTKRKTA
FT                   RQDLRNVLWGLQNEQVLRDGSLCQSDHELAEADNHSDLEIIEDTEGTKCQPPKENDAIS
FT                   KLSESKVYVTSTPEETRNNALMKRIIDHGEPNAYIKDASGGTSGNPFPEAAVDDTHTGK
FT                   QQEIKGKPPSVCIIRSSSRDVSPRVRRHLSSSPVGDTLVNETGTKSIFFVSSSCKESDL
FT                   VPSAQKSEEGYNKVTAATSLLASEEGQHLKTTEDEAGQAGFQDHLTEGETSDKNSPEHS
FT                   KHAGSDHRPFTHGYLKKRWVLDQSVNVDTGDTVVSRDAEVNLLGETVHSAANLDLGTYK
FT                   SEMKRTSMKHKSIKSTSSLSGTITVTDEEEMEPQRNREYVQLQDEIIIPHTGSQTPKTA
FT                   QIYVSDSQDVEEAQKNSNVQVLEVHELVPEGRSLGGAPVVQRKK"
FT   CDS_pept        530971..532431
FT                   /codon_start=1
FT                   /gene_family="HOG000246712" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079841"
FT                   /gene_name="JHD1"
FT                   /locus_tag="ADL088W"
FT                   /product="JmjC domain-containing histone demethylation
FT                   protein 1"
FT                   /EC_number="1.14.11.27"
FT                   /function="histone demethylase activity (H3-K36 specific) "
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51832.2"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="GO:0051864"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG189890"
FT                   /db_xref="HOGENOM:HBG398146"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0001DB2895"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AL5"
FT                   /transl_table=1
FT                   /translation="MLQQVTSTTVTGADIQLRAKLLLFSMTDDQCVYCKGKMEHRMWVQ
FT                   CEACPQWVHVQCIPEECLSGGEYPSRSSDIAAFECSAHGTARARLALKGKRRRVEAKEE
FT                   PERAGTRRYRLRKRGPLDYIALNEGQDVRLRHEHPHRAAFQGCFTKWSGLGRTVTSAEL
FT                   QQSFAELREPVLVADPEHSGMQTPAMDEQVLADVLGADYSLDVMDVQSQQNERWTMGQW
FT                   KEYMHTARGVRDRIRNVISLEVSHVPEFGQRIRRPRAVEDNDLVDLVWPVQPAPEIGAK
FT                   PKVQKYVLMSAANAYTDFHLDFAGTSVYYSLLRGAKQFLLFPPTPANLGAYKAWCADDN
FT                   QGLIFLGDRLQDGVSFSLRPGDLFMIPSGFIHAVYTPEDSFVVGGNYLCLRDLSTHIRI
FT                   VRIEQETQVPKKFTFPKFERVMGLTAEWLLEGLPERLQLITHEHAVALLDYLRDTRLKY
FT                   KPAHYHTKSTMLASLEKALEGCEPASGP"
FT   CDS_pept        532618..533481
FT                   /codon_start=1
FT                   /gene_family="HOG000175005" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15752374"
FT                   /gene_name="CBR1"
FT                   /locus_tag="ADL087W"
FT                   /product="NADH-cytochrome b5 reductase 1 "
FT                   /EC_number="1.6.2.2"
FT                   /function="cytochrome-b5 reductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="AAS51833.1"
FT                   /db_xref="GO:0004128"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG477179"
FT                   /db_xref="HOGENOM:HBG591994"
FT                   /db_xref="HSSP:1QX4"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI0000252A21"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AL4"
FT                   /transl_table=1
FT                   /translation="MDYKFEALVTALVLAVSFIFIYGKFSGAKQSQPAVKTTLNKDWQE
FT                   FSLLTKTVLTHNTAIYRFGLPEADAVLGLPIGQHISISGVIDGKEMLRSYTPTSLDSDA
FT                   TGYFELLVKSYEKGNISKMLAELAIGDRIKVRGPKGFYHYEPNMYKEIGMIAGGTGISP
FT                   MYQIIRAIFSNPRDKTRVCLVYGNQTKDDILLKPELDAMVAAKPDQFKILYMLDKVAEG
FT                   EQWEGKLGYITEAIMREHLPAPSSSAQLLLCGPPPMVSSAKRIAVSLGFEKAKPISKKG
FT                   DQVFAF"
FT   CDS_pept        complement(533604..535262)
FT                   /codon_start=1
FT                   /gene_family="HOG000293094" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15752375"
FT                   /locus_tag="ADL086C"
FT                   /orf_name="AGOS_ADL086C"
FT                   /product="ADL086Cp"
FT                   /function="amino acid binding"
FT                   /function="aspartate kinase activity"
FT                   /biological_process="cellular amino acid biosynthetic
FT                   process"
FT                   /protein_id="AAS51834.1"
FT                   /db_xref="GO:0004072"
FT                   /db_xref="GO:0008652"
FT                   /db_xref="GO:0016597"
FT                   /db_xref="HOGENOM:HBG236672"
FT                   /db_xref="HOGENOM:HBG724395"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="UniParc:UPI0000252A22"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AL3"
FT                   /transl_table=1
FT                   /translation="MNKQNRRGLQLQLFPYSRSIAQRDTMRSIADQKTNWVVQKFGGTS
FT                   IGKFPTNIVNDIVKVFSHDYGKNVAVVCSARSSYTKSEGTTSRLLMACDAAASYDETFQ
FT                   DIVRVIREDHVENASHHIKDAEIRVRLVEQTNDELDQVERYLQASQILGEVSNRTMDLV
FT                   MSVGEKLSCLFLTALCEDCGVTAEYVDFSSIVPTDFRCAEGSLDNSFYALLVVAFKERL
FT                   AQIVQANKEGKRIVPVITGFFGLLPMGLLNGVGRGYTDLCAALVAVALNADELQVWKEV
FT                   DGIFTADPRKVPQARLLETVTPEEAAELTYYGSEVIHPFTMEQVIRAKIPIRIKNVQNP
FT                   TGDGTVIYADNIAKKGESTPPHPPISVSSSFFEQRKRGATAITTKNDIVVLNIHSNKKT
FT                   LSHGFLAQIFTILDNYKLIVDLISTSEVHVSMALPVPDSDSQRSLRNAVEELKKLGTVD
FT                   LIKKMAIVSLVGKQMKHFIGIAGAMFTTLSEQNINIEMISQGANEINISCVIDEKNSVR
FT                   ALQSIHAKLLEPLAPTSSGAVLNGRLEQLKSLDLS"
FT   CDS_pept        complement(535719..536540)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20623077"
FT                   /locus_tag="ADL085C"
FT                   /orf_name="AGOS_ADL085C"
FT                   /product="ADL085Cp"
FT                   /function="heme binding"
FT                   /protein_id="AAS51835.1"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG058647"
FT                   /db_xref="HSSP:1B5M"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="UniParc:UPI0000252A23"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AL2"
FT                   /transl_table=1
FT                   /translation="MQRYSRDLQTSLPAWVTCWVRVSWIVTWSRLGIIAEETNQLALLL
FT                   SLPLGKARQECSSGHTSKRTDAIGIVNGSLLNSKAGGYNRGMGLLRKISIEEVSQHTSR
FT                   DDCWFIIHGRVYDITGLLENHPGGTKILLKYAGRDATLPFDDVGHSMESLIYDMAPGSY
FT                   LGEVDGGENVNSCSSVVSWRSLRWLRSWGKGASDDATVRSLGSQSEKLESDLQNWLQKT
FT                   LLLLVICVCCVLLLVIRYHNRTRRAGRIHSTQAPLPPDTSGMPSWWDLVPT"
FT   CDS_pept        536666..537367
FT                   /codon_start=1
FT                   /gene_family="HOG000248205" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752376"
FT                   /locus_tag="ADL084W"
FT                   /orf_name="AGOS_ADL084W"
FT                   /product="ADL084Wp"
FT                   /function="ARF GTPase activator activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of ARF GTPase activity "
FT                   /protein_id="AAS51836.1"
FT                   /db_xref="GO:0008060"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0032312"
FT                   /db_xref="HOGENOM:HBG058648"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="UniParc:UPI0000252A24"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AL1"
FT                   /transl_table=1
FT                   /translation="MTSVEVRRVLEQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCIR
FT                   CAGFHRSLGTHVSKVKSVDLDTWKEEHLQQVVRFGNNQQANKVFEGRLGGGSYVPDQSK
FT                   MGQFIKTKYEVRKWYLEEGACEPALPEAAPAAASPLPVSVPMSPAGVGREASASPALAV
FT                   SPAPASPPVYSANARPDLKKSILSLYAKPRQQSPGVASSASSLNSAAASAGVSYSAASL
FT                   EDNELFKNVWT"
FT   CDS_pept        complement(537844..538908)
FT                   /codon_start=1
FT                   /gene_family="HOG000112724" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775584"
FT                   /locus_tag="AGOS_ADL083C"
FT                   /product="ADL083Cp"
FT                   /protein_id="AAS51837.2"
FT                   /db_xref="HOGENOM:HBG058649"
FT                   /db_xref="InterPro:IPR005036"
FT                   /db_xref="UniParc:UPI0001DB2896"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AL0"
FT                   /transl_table=1
FT                   /translation="MNGGLGLQKSNIYIKPRSSQEGKYSSLALLRKPQRISSRTEREEQ
FT                   ENILKRNTDYNRKRGGGTWAADENIDPLDGDESPRRAGSPVVLTDYFSQSHAGYDNVGH
FT                   QRSKSLPGTPTSALKRPGGVRRSKSVHFDNRDVVSVKYFNSDESTLLVAHAQSFEDQLR
FT                   LRQDARELAPNGLTLVAPAGGMAGGAKSPRKPLRKSKCFRQYQLRPQLRTLRNVNFPIL
FT                   ANKDPAVLTLNIFLNIAYNRKVFLQDLSLDSMLVMTGRVLVKNIHYDKSVIVRYTWDNW
FT                   AHTSDTASVWISSGNAVLPGKDMDLFEFAIDVPAPVSGTPRLEFCIRYQVRDNSDFQTH
FT                   WDNNHGNNYVVEYD"
FT   CDS_pept        complement(539371..541077)
FT                   /codon_start=1
FT                   /gene_family="HOG000166480" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775585"
FT                   /locus_tag="AGOS_ADL082C"
FT                   /product="ADL082Cp"
FT                   /protein_id="AAS51838.2"
FT                   /db_xref="HOGENOM:HBG052155"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI0001DB2897"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AK9"
FT                   /transl_table=1
FT                   /translation="MSNSTAGHLQQDGGHMSNKREAAEVDAEMQPATKQLRAPQYNFVR
FT                   YCYRHNPDIQAAPTQVRCVRQEQQRREEWQARVGELSSEGERQVVQEAVRLFDSSNDKL
FT                   RKLMLEGMLLKSCFPQLSFISTQLQKLIKIDFISALPEEVALKILGYLDCQSLCSAAAV
FT                   CRRWQELADDDTVWYHMCEQHIDRKCPKCGWGLPLLHMKRARYIKSDKASASKGEGEDA
FT                   PQSRMRPWKVVYRERFKVESNWRKGIYRIQEFKGHMDGVLSLQLTNKLLLTGSYDSTVA
FT                   IWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDS
FT                   VLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDM
FT                   TIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEDPKDAVVPPDATAPAHDPSVQA
FT                   ANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFRIVSGSHD
FT                   RSCKVWDLQTGKCMHTFVGIHAPVACVGIGDSEFVSGDELGCVKLYNFDTT"
FT   CDS_pept        complement(541363..542256)
FT                   /codon_start=1
FT                   /gene_family="HOG000223250" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775586"
FT                   /gene_name="HIS1"
FT                   /locus_tag="ADL081C"
FT                   /product="ATP phosphoribosyltransferase "
FT                   /EC_number="2.4.2.17"
FT                   /function="ATP binding"
FT                   /function="ATP phosphoribosyltransferase activity "
FT                   /function="magnesium ion binding"
FT                   /biological_process="histidine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS51839.1"
FT                   /db_xref="GO:0000105"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0003879"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG009227"
FT                   /db_xref="HOGENOM:HBG391868"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniParc:UPI0000252A27"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AK8"
FT                   /transl_table=1
FT                   /translation="MDLVRQLNDRLLFAVPKKGRLYEKSVALLNGADILFHRSHRLDIA
FT                   LSTSTPVALIFLPAADIPTFVGEGRCDLGITGVDQVRESGVNVELLQDLDFGRCQLQVQ
FT                   VPAGGPYSQPEQLIGKTIVTSFTRLAREYFARLEGVDEAAMTTRVKYVGGSVEAACALG
FT                   VADAIVDLVESGETMRAAGLTPIGTVLSTSAHLICSPNPKSSLALLDTVRARIEGVLAA
FT                   QHYVYCTYNAHADALPALLRITPGRRAPTISKLDDDNWYAVSSMIIRREKGRILDDLKA
FT                   SGAEDIMVFEISNCRV"
FT   CDS_pept        542543..545134
FT                   /codon_start=1
FT                   /gene_family="HOG000141697" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752377"
FT                   /locus_tag="AGOS_ADL080W"
FT                   /product="ADL080Wp"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS51840.2"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG058650"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR004342"
FT                   /db_xref="UniParc:UPI0001DB2898"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AK7"
FT                   /transl_table=1
FT                   /translation="MKFAERLRESSIPEWRDKYLDYKLGKKKLKSYKEKLKASRALSVR
FT                   PTQRSRARDEPYTMQQEDAVYEFVMGWVIGTELAKCDEFYQWQLDQCERKYQLLKQQIE
FT                   MYCLQKDENGAGLSYGATYEGQEETGLAAQLSAGRSPSPSRAGRLDRAQEGVKRWLQER
FT                   DLMPSLPARWSREQGPARVKKYSANTETFMHICPSKRQAQLQLGHALLEYYLTLQLLKN
FT                   YRDLNVTGFRKIVKKFDKTCDTEELSKFMSYANEHSPLFEHMGQNLRLYANSFKASNSL
FT                   CQPAARMNSSPEKDPVTYWEDQVFQWYTEALTESTQARKHHVQKLRSLSLQYSMNEQIV
FT                   HRNNTCVVQMFTAGSLLGVAVVLVIIALMLGIRADISSYRHLILFPVWGGWYLVLLMSL
FT                   LFCLDCYIWFRGKVNYQFIMFGEIHSRKGNTVFNNDFSTTKISGHLYMVSLAFITVGAV
FT                   SLCSMVRATLAPWLWLCALLFALGFSMSSFILPYWRELRKTRQWLIVTAIRLVFSGAYP
FT                   VQFGDFFLGDIVCSLTYSMADVASVFCVFSGKKYNMCGSSNLISMGVLSCIPSYWRLMQ
FT                   CLRRYLDSNDRFPHLLNGAKYAVAILYNACLCAYRINKLHHSYRSWFIAAGIINSVFSS
FT                   IWDLVMDWSLFQFQSTNFLLRDDLYLAGKRNWQTGQYSKRRKAMYYVSMISDVAIRFQW
FT                   IVYAIAPRVIQQSAVTSFILGILEVVRRFIWIIFRVENEHVANVHLFKITGETPLPYPI
FT                   SPSRALSTSTVHDKHALPSTKNSHEDLVLYASVRHPEVLHMRHRAPSILSNIPWAHAKD
FT                   FQRPSTSSLPRTSSGIDFDDDDEDEDDEDDFDDEQDRVIDGQQKKPNSDLN"
FT   CDS_pept        complement(545273..548773)
FT                   /codon_start=1
FT                   /gene_family="HOG000201571" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752378"
FT                   /locus_tag="ADL079C"
FT                   /orf_name="AGOS_ADL079C"
FT                   /product="ADL079Cp"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of ions, phosphorylative mechanism"
FT                   /function="magnesium ion binding"
FT                   /function="phospholipid-translocating ATPase activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS51841.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004012"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0015662"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG176466"
FT                   /db_xref="HOGENOM:HBG720821"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0000252A29"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AK6"
FT                   /transl_table=1
FT                   /translation="MSFTPPPETSSAYNYHPGKPFGSDRGQQGVGSSRRARQERRGSLD
FT                   SFELEFDDSLDAALESLQIKRSASHERHSGIRGAEDFELKSMGRVDDGGHSPSGVLTNQ
FT                   DTQPLISQDSWDYGQVKRLRSGWLGPQSSWQRLKSWVLPGAKAGAPLLGVTATYSSTHS
FT                   IELTDQHVDREIHLDTTPIYDKRKYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLL
FT                   VSLSQSIPALRIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNNELYEVLNNSQ
FT                   LVPSKNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLT
FT                   QNLTQDEMLTKVHITASAPEKSIHMFTGKLTYKGSSAPLSVDNTLWANTVLASSGTCVA
FT                   CVIYTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGLDDDKWY
FT                   VDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIPEDLGRIEYL
FT                   LSDKTGTLTQNDMQLRKIHLGTVSYTMETMDMVTDYIQTLTSPANMGAAGVAVTGSRKE
FT                   VSQRVRDLVVTLATCHNVTPNFEDNELAYQAASPDEIAIVKFTERVGLSLFKRDRHSLT
FT                   LFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGADTVMSKIVQSNDW
FT                   LEEEVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEH
FT                   NLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQYV
FT                   HTITKLTRRDGALSRLEYLKANRNSCLLIDGDSLAIYMSHYRAEFFEIVICLPVVIACR
FT                   CTPQQKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSI
FT                   TQFCHLTKLLLWHGRNSYKRSAKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQGWLM
FT                   VGYATCYTMAPVFSLTLDHDIDESLTKTYPELYKELTEGRSLSYKTFFVWVILSLFQGA
FT                   VIQGFSQLFIGVGSEVFKKMVALSFTALVINELIMVALEIYTWNKTMAISEIVTFAIYV
FT                   LSIPLLGEYFDLTSMLALPFFIQLTIILTVSIFPVWAAKTIHRRLKPPSHAKVQQFSAV
FT                   "
FT   CDS_pept        join(complement(549628..549664),complement(549116..549459))
FT                   /codon_start=1
FT                   /gene_family="HOG000216922" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775587"
FT                   /locus_tag="AGOS_ADL078C"
FT                   /product="ADL078Cp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS51842.2"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG247280"
FT                   /db_xref="InterPro:IPR008195"
FT                   /db_xref="InterPro:IPR018065"
FT                   /db_xref="UniParc:UPI0001DB2899"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AK5"
FT                   /transl_table=1
FT                   /translation="MAQRVTFRRRNPYNTKSNKIKVVKTPGGVLRAQHVKKLATRPKCG
FT                   DCGIALAGISSLRPRQYASVSKTHKTVSRPYGGSRCANCVKQRIVRAFLIEEQKIVKKV
FT                   VKEQAEAAKKAEKKQSKKGKKN"
FT   CDS_pept        complement(549945..550373)
FT                   /codon_start=1
FT                   /gene_family="HOG000267215" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775588"
FT                   /locus_tag="ADL077C"
FT                   /orf_name="AGOS_ADL077C"
FT                   /product="ADL077Cp"
FT                   /protein_id="AAS51843.1"
FT                   /db_xref="HOGENOM:HBG407921"
FT                   /db_xref="HOGENOM:HBG695954"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="UniParc:UPI0000252A2B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AK4"
FT                   /transl_table=1
FT                   /translation="MRRLTQTATVLARSMSSLTPVRTTAAPPPAASYSQAMRANGMVFV
FT                   SGQIPYTPDNKPVEGSVADKTEQVIANVRNVLEASNSGLDRVAKVNVFLADMAYFAEFN
FT                   SVYAKYFGEHKPARSCVAVRALPLNVDLEMEVIALERD"
FT   CDS_pept        550477..550818
FT                   /codon_start=1
FT                   /gene_family="HOG000246549" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752379"
FT                   /locus_tag="ADL076W"
FT                   /orf_name="AGOS_ADL076W"
FT                   /product="ADL076Wp"
FT                   /protein_id="AAS51844.1"
FT                   /db_xref="HOGENOM:HBG058651"
FT                   /db_xref="HOGENOM:HBG395891"
FT                   /db_xref="UniParc:UPI0000252A2C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AK3"
FT                   /transl_table=1
FT                   /translation="MLSQTVRAKHTTPMSRASKITLALCTAASAATVVTVHLVQEMERD
FT                   ALKQGPIKDALRTAEKRAERDADPEAARKKMLNASEHELQLELRRKYAAMQPLSGEVVT
FT                   QDGDVVERR"
FT   CDS_pept        551364..551987
FT                   /codon_start=1
FT                   /gene_family="HOG000074708" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20623078"
FT                   /locus_tag="ADL075W"
FT                   /orf_name="AGOS_ADL075W"
FT                   /product="ADL075Wp"
FT                   /protein_id="AAS51845.1"
FT                   /db_xref="HOGENOM:HBG203666"
FT                   /db_xref="HOGENOM:HBG429397"
FT                   /db_xref="InterPro:IPR012389"
FT                   /db_xref="InterPro:IPR013922"
FT                   /db_xref="UniParc:UPI0000252A2D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AK2"
FT                   /transl_table=1
FT                   /translation="MHCSQPEGVDQRIGHMDIAQFPTDKLLEMLTGLLYKIIKSNDRLK
FT                   PFDQEKHDINNKYVAHVLSFRGKHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIA
FT                   KRCNALDPQLFVMDSYNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLEL
FT                   QFSILCDFELIVSIQELQRYADLLYKFWHREHLAKASTNAAVPH"
FT   CDS_pept        552401..553975
FT                   /codon_start=1
FT                   /gene_family="HOG000162981" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752380"
FT                   /locus_tag="ADL074W"
FT                   /orf_name="AGOS_ADL074W"
FT                   /product="ADL074Wp"
FT                   /function="nucleobase transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS51846.1"
FT                   /db_xref="GO:0015205"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG123924"
FT                   /db_xref="HOGENOM:HBG396658"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="UniParc:UPI0000252A2E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AK1"
FT                   /transl_table=1
FT                   /translation="MGSSAEQYGTRSSMSLTKDDGSYGDLEKKKGFLSDAEEPVTPQVD
FT                   ETEYTTLSWVNRWAARLNAETKGVSPVTEDECHDSSLLNAASMWFSANLVIAAFAVGVL
FT                   STAVFRLNMLEAVLATVVFSFMGVLAVAFFSVFGAEFGLRQMILSRYLMGNTTARIFCL
FT                   INVIACVGWSSVNTIASTTLLHMINPTGARCPPWAASLIIVLSTVFITFFGYRVIHAYE
FT                   KWSWVPNLVVFLIIIARLAIAGNFTAGSSLGGKATAGSFLSYGSVVFGFASGWTTYAAD
FT                   YTVYMPKNSNKYRIFFFMIAGLATPLLFTLILGAAAGRCVHTNPTWGEYYKKHSVGGLC
FT                   FAILAENALGGFGQFCCVVLAMSTVANNIPNMYSIALSTQALWSRFARVPRVFWTLVGN
FT                   ACSLVIAIVAYYKFETFMTSFMDSIGYYLSIYIVICVTEHFVFRKGFRGYDVSHWDRPD
FT                   LLPAGYAGCAALCVGAVGVAMGMSHEYYTGPIAKLAGGDIGFLLAAGFSFIVYICCRPL
FT                   ELKYTGR"
FT   CDS_pept        554128..554961
FT                   /codon_start=1
FT                   /gene_family="HOG000248191" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928588"
FT                   /locus_tag="ADL073W"
FT                   /orf_name="AGOS_ADL073W"
FT                   /product="ADL073Wp"
FT                   /function="oxidoreductase activity, acting on the CH-CH
FT                   group of donors"
FT                   /biological_process="lipid metabolic process"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS51847.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016627"
FT                   /db_xref="HOGENOM:HBG058652"
FT                   /db_xref="HOGENOM:HBG396420"
FT                   /db_xref="InterPro:IPR001104"
FT                   /db_xref="UniParc:UPI0000252A2F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AK0"
FT                   /transl_table=1
FT                   /translation="MQRNPRYNSQHMNQMLPPIAAGGAEVYVWHLIHFSYGIGLFSLWL
FT                   AKYRLPKLLQYGKTRQKKLVGVIEPWYTSIAVPRRYFSHFYVLSFVLATANLYWFPEDV
FT                   ITSCIFFHSLRRLVESARVTKWGSESRMHAAHYLVGLWFYSVLNLSVYLQLNSRQRTRS
FT                   PSTVNKVFGAVGAVGFLLASWDQARNHIHLAHMIKYTLPRRGLFKIVACAHYFDEIVIY
FT                   ASLAAMEATTRWSLTVAVIWVCANLGVSAVETKRYYDAKFKGQAVAPYALIPYIM"
FT   CDS_pept        complement(555025..556326)
FT                   /codon_start=1
FT                   /gene_family="HOG000060166" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775589"
FT                   /locus_tag="ADL072C"
FT                   /orf_name="AGOS_ADL072C"
FT                   /product="ADL072Cp"
FT                   /function="catalytic activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="AAS51848.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="HOGENOM:HBG407714"
FT                   /db_xref="HOGENOM:HBG757733"
FT                   /db_xref="HSSP:1KAS"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniParc:UPI0000252A30"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AJ9"
FT                   /transl_table=1
FT                   /translation="MHPRVVVTGIGCYTPLGPSLAQSWKELLRGTSGLVRLQDLAEYEG
FT                   DYKPLSRLISGDLRVGKVGFEARDQELLSSQEQRRTSRAAQLAMVTAEEALRHAGLLSG
FT                   SHLVASVDRNRAGCIIGAGLPSMEDISQATASLSSARRPSVSPFFIPKMLNNMAAGNVA
FT                   IKFQLRGASNCPSTACASGNNAIGDAYNFIRLGYSDVIVAGASELSVHPLALAGFVKAK
FT                   SISASGISRPFDARRDGFVLGEGCGLLVLESLEHARHRGAEIIAEVVGYGVCSDAHHIT
FT                   SPSEGGDGARRAMHMALQDAGIWDTRDQVGYVNAHATSTPLGDRAEARAIQAVFGATGT
FT                   GSTLVSSNKGHMGHLLGAAGAVEAVFTVQSLREGIVPHTLNLQTVGEGLADKKDGFGGI
FT                   TFVQDNPVPAPLTYAMNNSFGFGGINSSLLFKKW"
FT   CDS_pept        complement(556556..557317)
FT                   /codon_start=1
FT                   /gene_family="HOG000248341" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20623079"
FT                   /locus_tag="ADL071C"
FT                   /orf_name="AGOS_ADL071C"
FT                   /product="ADL071Cp"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS51849.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG467264"
FT                   /db_xref="HOGENOM:HBG742904"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0000252A31"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AJ8"
FT                   /transl_table=1
FT                   /translation="MTSTADHKQPISLKVNGALFDVDGTIIISQPALAAFWREFGKDKP
FT                   YFDAEHVISATHGWRTYDAIATFAPDYLSEEYVTRLEGEIPDKYGKFSVEVPGAVTLCN
FT                   ALNELPKEKWAVGTSGTFEMAHKWFDVLGIKRPSTFITANDVKQGKPHPEPYIKGRNAL
FT                   GFPINEQNPKGSKVIVFEDAPAGIAAGKAAGCKIVGVATTFDVEYLKERGCDIIVKDHR
FT                   SIRVGGYNPETDEVEFVFDDYLYAKDDLLDW"
FT   CDS_pept        complement(557841..558482)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752381"
FT                   /locus_tag="ADL070C"
FT                   /orf_name="AGOS_ADL070C"
FT                   /product="ADL070Cp"
FT                   /protein_id="AAS51850.1"
FT                   /db_xref="HOGENOM:HBG058654"
FT                   /db_xref="UniParc:UPI0000252A32"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AJ7"
FT                   /transl_table=1
FT                   /translation="MRLQEMAVLLTLWRQSILKATTSFLLAALQSTDHGRQRHRGGPQL
FT                   PQKSWLTLRRIGSFLNFDHVPLPVLPYTVTRVRVPVQGLSRLAGACSYGLRHVTRRHFC
FT                   LVPRLAPPQTWAQFLAPRFASRPGLQFPDPARDSQAPSAPAILLVGICWYHFAGPGPAY
FT                   PSVGSACAPCLETSSIPAAHTGRSYRSPSFSSRNTTNHVMLQHVTVLNVP"
FT   CDS_pept        558719..559336
FT                   /codon_start=1
FT                   /gene_family="HOG000000840" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752382"
FT                   /locus_tag="ADL069W"
FT                   /orf_name="AGOS_ADL069W"
FT                   /product="ADL069Wp"
FT                   /function="nucleic acid binding"
FT                   /protein_id="AAS51851.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG058655"
FT                   /db_xref="HOGENOM:HBG396424"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="UniParc:UPI0000252A33"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AJ6"
FT                   /transl_table=1
FT                   /translation="MDIDHVASAARKAGATDATGWPWLANRQSHDEMTDYASMTVAQLK
FT                   DVLKERELPTQGLKAALVERLQQADATAAEPTDATTRPAAEEHTPEAAEPAATPAEAEA
FT                   PVAEQRAAAEPRTLSPEEMKQAAVAHLSKKLHRARKFGEDDAAVGALQKQLARLEKFGL
FT                   DLTTQLAQELGFGRGPAAAVGKHAFHRRRGYHQGKKFKAQRR"
FT   CDS_pept        559716..560915
FT                   /codon_start=1
FT                   /gene_family="HOG000144411" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928589"
FT                   /locus_tag="ADL068W"
FT                   /orf_name="AGOS_ADL068W"
FT                   /product="ADL068Wp"
FT                   /protein_id="AAS51852.1"
FT                   /db_xref="HOGENOM:HBG058656"
FT                   /db_xref="UniParc:UPI0000252A34"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AJ5"
FT                   /transl_table=1
FT                   /translation="MEWNKLGMAYPSHQMVQEVVASHPIRIRIDNLPPTKGWRQIKGFL
FT                   SQFVPYEQVLNVKVLPLIPSMTPPFIPLQSCIVLLRQDTDWPGLLMHLNGIQWDYYTMM
FT                   AWVLPNFIPQDGAPLLSVSPPDSGGSLHKNNGHHYDQAERQKHAARLPLHAFTGPAMPA
FT                   LPGGEQSVQHPSKRLTQIFNEGAFRRQMSQRNMHQLQISNFPPCLHWDEVVKTTQIKLD
FT                   SGGDIQRGDGGAAIPSHHVIQPHVLQDEKNEIVPDLTIMTAHPEKYGKLKWTILKDFIK
FT                   LKCPKLLEIDHKSQGAALSNTREFYVGVYENSESHVEIILLPSDKPDRIIEGPVSEEEA
FT                   QAAGGPDLQRFKVRATLFQAVLGFHSKELCDLCLDAINGEEYMLGYKLQVQRLAKLSST
FT                   "
FT   CDS_pept        complement(561155..563074)
FT                   /codon_start=1
FT                   /gene_family="HOG000000971" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752383"
FT                   /locus_tag="AGOS_ADL067C"
FT                   /product="ADL067Cp"
FT                   /protein_id="AAS51853.2"
FT                   /db_xref="HOGENOM:HBG124159"
FT                   /db_xref="InterPro:IPR007147"
FT                   /db_xref="UniParc:UPI0001DB28B9"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AJ4"
FT                   /transl_table=1
FT                   /translation="MMNKVHKPTGNGTTHKIREQLNFKDNKKWKQFSSRRLELIDKFGL
FT                   SERKASEQDDNIRQIATILRTEFGYPVSSSGEFEKLVTAAVQSVRRNRKRCTKTRNANT
FT                   MRKGGATSSGSATSTSDAEEGISKVSSPVMHGSTASLSSSAGCIPPIQSAPSLPVLQPR
FT                   PVRVVATRSLKLDHYGNGNPIYGSNVSAASAINCNEILRSVIMDLVYNHIPLAEQCRHD
FT                   TSPSLTDLAIFSQHRNLLSLALASSKHESKEAEDREQSDQHNRAASNENIPFFLREKIL
FT                   LHIQRSKTCMEIATEELRLENCVNLCMLGDTCIKAAVSFVMERFFSSLPVTSTEYITQK
FT                   VTSLEQSALICMKFFAPGTKSNMQILSVENKVTLFQLIIGAIVKDFGFDPCLYPLGEVF
FT                   HDLILRQYPLVCSSSPSQKTAVLTTLSMKPQLANRDVNRKVLLKFQDKEQRFTFPLLSN
FT                   GPPTMNDVLENLRQLFQIPNTYSNLALFHNNTIIKDDMELASILNQFSAGETIIEIKEP
FT                   SSASGQSVSAVESSFNGLTILSNVSTTAAPSISMPSSKPSSVIGRSSSPLISNYTHSNT
FT                   ASVAALDSIISRISSPVAVKAQSANGEVIAPPTIRTKSPQPSGAQTKGSFEKGLPQPVF
FT                   QPLL"
FT   CDS_pept        complement(564208..565890)
FT                   /codon_start=1
FT                   /gene_family="HOG000238475" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775590"
FT                   /gene_name="ICL1"
FT                   /locus_tag="ADL066C"
FT                   /product="Isocitrate lyase"
FT                   /EC_number="4.1.3.1"
FT                   /function="isocitrate lyase activity"
FT                   /biological_process="glyoxylate cycle"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /cellular_component="peroxisome"
FT                   /protein_id="AAS51854.1"
FT                   /db_xref="EMBL:CAB37065.1"
FT                   /db_xref="GO:0004451"
FT                   /db_xref="GO:0005777"
FT                   /db_xref="GO:0006097"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="HOGENOM:HBG056305"
FT                   /db_xref="HOGENOM:HBG308645"
FT                   /db_xref="InterPro:IPR000918"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="UniParc:UPI000002E32A"
FT                   /db_xref="UniProtKB/Swiss-Prot:O94198"
FT                   /transl_table=1
FT                   /translation="MSPSVRDARNDLASLQQQAAAEAEDIRRWWSQPRWAGTKRVYTAE
FT                   DIVKRRGTFPVVEYPSSVMADKLVETLARHSRNGTVSQTFGVLDPVQMTQMVKYLDTIY
FT                   VSGWQCSATASTSNEPGPDLADYPMDTVPNKVEHLFMAQLFHDRKQREARLSCTTQREL
FT                   DQLGPEIDYLRPIVADADTGHGGLTAVFKLTKMFIERGAAGIHMEDQSSSNKKCGHMAG
FT                   RCVIPVQEHISRLVTVRMCADVMHSNLVLVARTDSEAATLLSSNIDARDHYYIVGASNP
FT                   EVTVPLIEVLDAAQQAGASGDRLAQLEEDWCKKAKLRLFHEAFADQVNASPSIKDKAGV
FT                   IAKFNSQIGPQTGASIREMRKLGRELLGQDVYFDWDLPRAREGLYRYKGGTQCAIMRAR
FT                   AFAPYADLVWFESNFPDFQQAKEFAQGVREKFPNKWMAYNLSPSFNWPKAMPPKEQENY
FT                   IQRLGEIGYVWQFITLAGLHTNALAIDNFSREFSRFGMRAYAQGIQQREMDEGVDVLKH
FT                   QKWAGAEYVDSILKLAQGGVSSTASMGKGVTEEQFGSSNGAKL"
FT   tRNA            complement(566288..566368)
FT                   /gene_name="tRNA-Ser"
FT   CDS_pept        567148..567657
FT                   /codon_start=1
FT                   /gene_family="HOG000000841" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20623080"
FT                   /gene_name="RGI1"
FT                   /locus_tag="ADL065W"
FT                   /product="Respiratory growth induced protein 1 "
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="AAS51855.2"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="HOGENOM:HBG058657"
FT                   /db_xref="InterPro:IPR022554"
FT                   /db_xref="UniParc:UPI0001DB28BA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AJ2"
FT                   /transl_table=1
FT                   /translation="MTKKDKKQKVKVKTVETKEGEKIRVFEDLDSFETYLRGETEDEEF
FT                   DHVHCQVRYYPPFVLHESHQDPEKIKESANSHNKKFVRHLHQHVEKHLLKDIKDSLGVP
FT                   ELKFKDKSKEENFNHVVWRYHAPTAVRDREFLVHVTVECHNDTAMVDVDYLTEPMQPAV
FT                   QSEQVA"
FT   CDS_pept        568110..570050
FT                   /codon_start=1
FT                   /gene_family="HOG000248860" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752384"
FT                   /locus_tag="ADL064W"
FT                   /orf_name="AGOS_ADL064W"
FT                   /product="ADL064Wp"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS51856.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058658"
FT                   /db_xref="HOGENOM:HBG203669"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0000151AB3"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AJ1"
FT                   /transl_table=1
FT                   /translation="MENPHVHDNLQHIQAVLSNYDTSFLSDDEEDYCPLCMEPLDITDK
FT                   NFKPCPCGYQICQFCYNNIRQNPELNGRCPACRRKYDDESVEYIVLSPEELKLERAKQA
FT                   RKERERKQREKERKENEYANRKHLAGMRVIQKNLVYVIGLNPPVPYEEVGALLRSDKYF
FT                   GQYGKINKIVVNRKTGHNDHQTGYGIYVTFSRKEDAARCIQAVDGTFMDGRQVKAAYGT
FT                   TKYCSSYLRGQSCPNPNCMFLHEPGEEADSFNKRELSGKQQPHQQPGQQLHQHGSQHLP
FT                   SQLQSSVHQPAQVHVHQLNAQPHIHHPSPFKGPHNSGAAASNNSNGASAVPSPAQAKAQ
FT                   LHMDDSSSSSTPAAHTPILTPAPLPTGANPWGITQSSTPVSALSKVSSSTAFPTLGEAI
FT                   NTPAPTFNGVQAAASSYNQNGSSKNKKNNDTKNYEDPYDPLCSAVKFIDDTIAFLSDYK
FT                   CVSYNLRSGLIDDATYASYPSLFSFSNIDVSAESEGILGRKLIDMLAVKPWDQVAATFP
FT                   AVNEMSPQLQRQVLRQQQMATTPKQQQLVQMQRNNPDPNSQVSPTSQLQQQQLQHSHSQ
FT                   SQQEPPQEPPFSQQQQHRTVVHTPPPGMFVQNGQMSQTQSVPHMVAQTRSNNSTDLLNQ
FT                   LINGKKVTAGT"
FT   CDS_pept        join(570275..570277,570335..571294)
FT                   /codon_start=1
FT                   /gene_family="HOG000000970" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079842"
FT                   /locus_tag="ADL063W"
FT                   /orf_name="AGOS_ADL063W"
FT                   /product="ADL063Wp"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAS51857.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG058659"
FT                   /db_xref="HOGENOM:HBG202975"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR022023"
FT                   /db_xref="UniParc:UPI0000252A37"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AJ0"
FT                   /transl_table=1
FT                   /translation="MSYSISKFPDRVSSLFKPRPPLQYRKPVDYAPEERKTATITPVSS
FT                   VLGTDALMRYMQEFPTGSENLLIQRYEELKTINSRKEQELEEELAKWAPENDTNIQGTD
FT                   PFRTIFVGRLHYDVDELELQKHFIKFGEIERVRIVRDKITNKPRGYAFVLFRDPECSKK
FT                   AYREIGVHRGLMIRGRSAIVDIERGRTVKFFRPRRLGGGLGGRGYMQRENMNQLPPAAD
FT                   ASAKRSLEPGRRSRFNSNASYGRFQGYSSGFRPGSYSHGPRYIREGSSYVPGASAGQPP
FT                   EGPAAAAVSQQPPQSSYRSRRDRTSTPDSSGATSRWTAS"
FT   CDS_pept        571556..574123
FT                   /codon_start=1
FT                   /gene_family="HOG000201928" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752385"
FT                   /locus_tag="AGOS_ADL062W"
FT                   /product="ADL062Wp"
FT                   /function="N-acetyl-gamma-glutamyl-phosphate reductase
FT                   activity"
FT                   /function="NAD+ or NADH binding"
FT                   /function="acetylglutamate kinase activity"
FT                   /biological_process="arginine biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="AAS51858.2"
FT                   /db_xref="GO:0003942"
FT                   /db_xref="GO:0003991"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006526"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG056300"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR006855"
FT                   /db_xref="InterPro:IPR011241"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="UniParc:UPI0001DB28BB"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AI9"
FT                   /transl_table=1
FT                   /translation="MLASTLYCFSRASLVAGSKTGRHGLVRAAYKRELFSTAAIKKLNY
FT                   ARTGNNEGVGSLQTRSTVIQLLNSIGSKREVEQYLKYFTSVSEQQFAVIKVGGAIISDN
FT                   LPELASCLAFLYHVGLYPIVLHGTGPQVNNKLEAQGIEPSYIEGIRVTDPVTMTVVREC
FT                   FLEQNLKLVTALEQMGVRARPITSGVFTADYLDKEKYQLVGNITSVCKDPIEASIKAGA
FT                   LPILTSFAETTAGQTLNVNADVAASSLARAFEPLKVVYLNEKGGIINGETGEKVSVINL
FT                   DEEYEDLMRQSWVKYGTKLKLQEIKELLDYLPRTSSVAIINVQDLQKELFTDSGAGTMI
FT                   RRGYKLLKGSSMQQFGAERLRTALERDPEIRSGRLSVASYLKSIEETNITTYADEPMEV
FT                   LAIIDNDGTIPRVDKFLCSQAGWLNNVADNVFKTLKRDFGALAWEVEERDPAISWHFSN
FT                   SEGSFLRNGKVLFWYGINDLETVVSIVDSFLRRVSPTSARNSMNNAFSAKQSKRYYSIA
FT                   SRRAPPKLQGENTSISRVALIGARGHTGTNLISLIENHPYLELACVSSRQNAGKPLEGY
FT                   TKAQIVYDNLSPDDAKKLELEGAVDVWVMALPNNVCKPFVDAIESVQRESKIVDLSADY
FT                   RFVPPAVAAYGLPELNDRNEIASARKIANPGCYATCAQLSLAPLLPYMTAAPVVFGVSG
FT                   YSGAGTTPSPKNDPAVLHDNLIPYSLTDHIHEREISTRLGTTVAFHPHVAQWFQGITQT
FT                   ISVPVKKGALTQDRVSSLYKEFYRGERLVTIADDVPLVRAIAGSHGVVIGGFKVNRSQD
FT                   RVVVVGTIDNLLKGAATQCLQNINLALGYSEYEGIPTAPSNAS"
FT   CDS_pept        574292..574753
FT                   /codon_start=1
FT                   /gene_family="HOG000197215" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775591"
FT                   /locus_tag="ADL061W"
FT                   /orf_name="AGOS_ADL061W"
FT                   /product="ADL061Wp"
FT                   /biological_process="regulation of actin filament
FT                   polymerization"
FT                   /cellular_component="cytoskeleton"
FT                   /protein_id="AAS51859.1"
FT                   /db_xref="GO:0005856"
FT                   /db_xref="GO:0030833"
FT                   /db_xref="HOGENOM:HBG131435"
FT                   /db_xref="HOGENOM:HBG377673"
FT                   /db_xref="InterPro:IPR006789"
FT                   /db_xref="UniParc:UPI0000252A39"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AI8"
FT                   /transl_table=1
FT                   /translation="MTDWRRIDIDAFDPDSGRLTAQDLVPPAASQPSPQELQARIAQLR
FT                   SAGASGDFARGVQIAVSDPPYGADEQTKSQYLLAVLDLLTQVRQADIAGILQQLNRPQQ
FT                   DVLLKYLYRGMAVPEGQKQGGMLLAWFEKLTQQTGINPIVRFLSDRRTV"
FT   CDS_pept        574994..576013
FT                   /codon_start=1
FT                   /gene_family="HOG000141982" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775592"
FT                   /locus_tag="AGOS_ADL060W"
FT                   /product="ADL060Wp"
FT                   /biological_process="intracellular transport"
FT                   /protein_id="AAS51860.2"
FT                   /db_xref="GO:0046907"
FT                   /db_xref="HOGENOM:HBG058661"
FT                   /db_xref="InterPro:IPR000156"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI0001DB28BC"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AI7"
FT                   /transl_table=1
FT                   /translation="MPEQPIVEKADSNGHAEPEAAKRTRSEGSGEAEEQVEPHKKLRKA
FT                   TEEPESASETVCEDKAEHGDDSGGEQQTTRNGELSAAAEAQPQKQAAGDAPRTAFGERP
FT                   PFVAAKPFGAAGFSVKKDGAAASGSASPPGAGAPSAGDPKPFSFGSGLAFGSGFKVLKP
FT                   DAKPGSTIFDKKDGTTSPLPESTAASVASEASDAADSDAREASICLQKQVTQTGEEAED
FT                   SLYQANVKLYQLVSISEGWKERGVGPVHVNKDRSTGRARLVMRSRGLLKVILNLPLVKG
FT                   FSIQKGFPGSLQSEKFIRILAADSSKGPVQYALKTAAPPVAEQLYKTIADLIPDKPSV"
FT   CDS_pept        complement(576034..576717)
FT                   /codon_start=1
FT                   /gene_family="HOG000184298" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752386"
FT                   /locus_tag="AGOS_ADL059C"
FT                   /product="ADL059Cp"
FT                   /function="methyltransferase activity"
FT                   /protein_id="AAS51861.2"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG326187"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI0001DB28BD"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AI6"
FT                   /transl_table=1
FT                   /translation="MDTTQLNQSKLGTREYWDEFYAVEQRNFEADAQDTGECWFDEDRA
FT                   AERMVEFLEEHVGEWRIAPDAAVLDVGCGNGHLLFALADAGFHGRLEGVDYSERSVQLA
FT                   RAIGATHDADVGFHAADVFSAAWQPGVFDVVLDKGTLDAIALSGMQPAGAASVPAAYAA
FT                   VVERVLAPGGVLLITSCNFTEDELVRLVEAGSGLRKCGRIAYPEFGFGGKKGSTICSVA
FT                   FTKAM"
FT   CDS_pept        576807..577274
FT                   /codon_start=1
FT                   /gene_family="HOG000165386" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15752387"
FT                   /gene_name="FIS1"
FT                   /locus_tag="ADL058W"
FT                   /product="Mitochondria fission 1 protein "
FT                   /function="binding"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="AAS51862.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG192050"
FT                   /db_xref="HOGENOM:HBG397677"
FT                   /db_xref="HSSP:1Y8M"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016543"
FT                   /db_xref="UniParc:UPI0000252A3C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AI5"
FT                   /transl_table=1
FT                   /translation="MSNINFLPTIEDAYGALSAEQLDILRQQVLSEGGDIASIQSRFNY
FT                   AWGLVKSHDAEDQRLGVKLLTDIYKESPMRRRESLYYLAIGCYKLGEYAMAKRYADALV
FT                   AHEPDNAQARTLKAMVEQKIQTEGLKGAALVGAGLAAVAAAAGFLLRQRRP"
FT   CDS_pept        577553..580225
FT                   /codon_start=1
FT                   /gene_family="HOG000057035" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15752388"
FT                   /locus_tag="AGOS_ADL057W"
FT                   /product="ADL057Wp"
FT                   /function="ATP binding"
FT                   /function="ribonucleoside-diphosphate reductase activity "
FT                   /biological_process="DNA replication"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="ribonucleoside-diphosphate reductase
FT                   complex"
FT                   /protein_id="AAS51863.2"
FT                   /db_xref="GO:0004748"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005971"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG006382"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="UniParc:UPI0001DB28BE"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AI4"
FT                   /transl_table=1
FT                   /translation="MYVYKRDGRKEPVKFDKITARISRLCYGLDPKHVDAVKITQRIIS
FT                   GVYEGVTTVELDNLAAETCAYMTTVHPDYATLAARIAISNLHKQTTKQFSQVVSDLYHY
FT                   TNPKNGLHSPMISDEVYEIVMAHKDELNSAIVYDRDFQYNYFGFKTLERSYLLRIDGKV
FT                   AERPQHMVMRVAVGIHGKDIKKAIETYNLMSMRYFTHASPTLFNAGTPHPQMSSCFLVA
FT                   MKDDSIEGIYDTLKECAMISKTAGGIGLHIHNIRSTGSYIAGTNGTSNGIIPMVRVYNN
FT                   TARYVDQGGNKRPGAFAIYLEPWHSDVFDFIDIRKNHGKEEIRARDLFPALWVPDLFMR
FT                   RVQENGDWTLFSPSEAPGLSDVWGEEFEELYERYVREGRGRKTIKAQKLWYAILEAQTE
FT                   TGTPFILYKDACNRKSNQKNLGTIKSSNLCCEIVEYSSPEETAVCNLASIALPAFIAEA
FT                   ADGKTQWYDFDKLHEIAKVVTRNLNRVIDRNYYPVETAKRSNMRHRPIALGVQGLADAF
FT                   MILRIPFDSPQAKELNSQIFETLYHAACEASMELAIEEGPYESFKGSPASQGILQFDMW
FT                   NHKPSGMWDWDALKAKIIEHGMRNSLLLAPMPTASTSQILGYNECFEPYTSNMYSRRVL
FT                   SGEFQIVNPYLLRDLVDLGIWDDSMKSHIISDNGSIQGLPNIPQELKDLYKTVWELSQK
FT                   TIIDMAADRGAFVDQSQSLNIHIRAPTMGRLTSMHFYGWKKGLKTGMYYLRTQAASAAI
FT                   QFTVDKAVAEQAANNVADLSRLHRPRYVPHAVGVSAAPVSDSPRAAAPSSAGDISSISA
FT                   SMASLEVQAAPPASSATAMSSEQASEGKPAASAESTVTAGSTVTAESTLTAESDYDIYN
FT                   SKVIACAIDNPGACEMCSG"
FT   CDS_pept        580854..583277
FT                   /codon_start=1
FT                   /gene_family="HOG000113640" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752389"
FT                   /locus_tag="AGOS_ADL056W"
FT                   /product="ADL056Wp"
FT                   /function="RNA binding"
FT                   /protein_id="AAS51864.2"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG058662"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001DB28BF"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AI3"
FT                   /transl_table=1
FT                   /translation="MPYTHQPQLSINSIQSLVEPVTPPLGQMNNKQNHQRTNSLDLSGF
FT                   NQFMASNSPINLPTLSPMSGGMLSSVAKPRISSLPLITEFDTASVESSATLIAGETPYG
FT                   AALPALRSVSGSTVASNAGAASAGAAATARSSSSVSSATSASTGAQGCNPDLGSLPIEE
FT                   LDYLQLATDQYGCRFLQRKLENPAESNQVRDLMYSQIKPYLLDLILDPFGNYLIQKLCE
FT                   YLTLDQKTSMIQDIYTHVFEISINQYGTRSLQKIIDTTETEQHIDMIVSGFSQQFTSIN
FT                   QVVTLINDLNGNHVIQKCIFKFQPTKFDFIIDAIVEKDNIIKISTHKHGCCVLQKLLSV
FT                   CTLQQIFKISVKIIQYLPGLINDQFGNYIIQFLFDIKELDFYLLGEIFSKLSHELCQLS
FT                   CLKFSSNVVEKFIKKLFQIVHDSLTNPSASASPPIKVVSNGSHSYQHQADDVVNVAMGI
FT                   LLTITDIFTANLNVLIRDNFGNYALQTLLDVKNYTHLLEIPGNNYIHSSPRLTKFSHEF
FT                   TLKVGNLIVLTKELLPSIKTTSYAKKIKLKVKAYAELTGVSFTDLSPKKGQQNAPNGIA
FT                   SGSSAANGGCSHRKQHARHYSLPANSFRHQRSNSTISLSGGYHGQQGHPQQQVNMMRLP
FT                   QKLNFNMSQLSQQQHLSQQAVFNQLQTQQQHVQLVSPSHQAMNMPSTYQQQPQMPPQPE
FT                   YLSMNFTNATPAYASGETQTTSFADPFTYEQQQKQQWHQHRQQQLQQQHSSVSHMRHNL
FT                   SDAGLFSHQAASSSASNLMAMNSGAASPTPQQPMYLTNAAAMEYDMHLGNGFYR"
FT   CDS_pept        complement(584449..586902)
FT                   /codon_start=1
FT                   /gene_family="HOG000208451" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775593"
FT                   /locus_tag="ADL055C"
FT                   /orf_name="AGOS_ADL055C"
FT                   /product="ADL055Cp"
FT                   /function="acid-amino acid ligase activity"
FT                   /biological_process="protein modification process "
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS51865.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016881"
FT                   /db_xref="HOGENOM:HBG067128"
FT                   /db_xref="HOGENOM:HBG607874"
FT                   /db_xref="HSSP:1BCI"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR018029"
FT                   /db_xref="UniParc:UPI0000252A3F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AI2"
FT                   /transl_table=1
FT                   /translation="MSITVKLVAAESLYKRDVFRSPDPFAVLTIDGSQTKSTAAKKKTL
FT                   NPYWNETFTFSGVTENSILTIQVFDQKKFKKKDQGFLGVINVRVGDVLGHLDEDTASGS
FT                   RRREETITRDLKRSNDGMNVSGRLIVVLSNVGEEGPSASAGGGLHPDMANGPSGALAAS
FT                   SSRGSASPMQWGHEEVVAGASQGTLQHNGLPASAALAPGSSINSSSHHNIANGSGVAAD
FT                   GSRTNRQYSSFEDQYGRLPPGWERRTDNFGRTYYVDHNTRTTTWKRPTLDQTESERGDQ
FT                   LTANTELERRQHRGRTLPGGATDSGGITVQTSASATPAVNGAAAAAFAVTGATTSGLGE
FT                   LPPGWEQRYTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPSNNTIQQQPVSQLGPLPS
FT                   GWEMRLTNTARVYFVDHNTKTTTWDDPRLPSSLDQNVPQYKRDFRRKVIYFRSQPSLRI
FT                   LPGQCHIRVRRKNIFEDAYQEIMRQSPDDLKKRLMIKFDGEEGLDYGGVSREFFFLLSH
FT                   EMFNPFYCLFEYSSHDNYTIQINPNSGINPEHLNYFKFIGRVVGLGVFHRRFLDAFFVG
FT                   ALYKMMLRKKVVLQDMEGVDSEVYNSLKWILENSIAGILDLTFSADDERFGEVVTVDLK
FT                   PNGRNIDVTDDNKKEYVELFTQWKICSRVEDQFKAFIDGFNELIPEDLVNVFDERELEL
FT                   LIGGIAEIDVEDWKKHTDYRGYQESDEVIKWFWKCISEWDNEQKARLLQFTTGTSRIPV
FT                   NGFKDLQGSDGPRRFTIEKAGEVQQLPKSHTCFNRVDLPAYHDYDTLKQKLTLAVEETI
FT                   GFGQE"
FT   CDS_pept        587313..589187
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15752390"
FT                   /gene_name="DSE1"
FT                   /locus_tag="ADL054W"
FT                   /product="Protein DSE1"
FT                   /biological_process="cell cycle"
FT                   /biological_process="cell division"
FT                   /biological_process="cellular cell wall organization "
FT                   /protein_id="AAS51866.1"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG058663"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0000252A40"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AI1"
FT                   /transl_table=1
FT                   /translation="MADTELRQVARPGCCLEPCAGCVATVRAGTGLSTATRAHMRLSSL
FT                   GEATAGSAAPAVVCGSRTDLYIACSCTEGQCSRADSMALNERGMQMDRGQARPAVRQPD
FT                   ERERKQRLVNRCFRESRVPDSESSPGTERRTAELSGFYTTKKLRSLYWTLRTDASLTAF
FT                   AVAQERDTILISNRHHSEENLKLYQYDNVKSKLRRIQTITLPGGSVVACALPGPGFNVV
FT                   MGEALRRTHDQLILTGHEDAVVNLIATSLEEGDARIIRRFNPAKYLRRLRAQYGDEAAD
FT                   MPWLQEIDSLRVRQLTPWRSVKTDATGFIALVNELIFIYTFDDTREPLYMHHFPGVESF
FT                   DVNPENELLLALSGSKYGANGISLLDLTKMRGIGRQYAPAGHLKAFERAADSKHCLWLD
FT                   KSLLVNSVGNILRVWDIRCSTGLKCEVLGHKSNITAVRYHKNSHTLYSCDEDGYIFSWE
FT                   LSHLLRELEGMTDVRRMTLCRSPQSIKTADDCSTTIQCGNIVVAPDTEFSSKRNSSVRS
FT                   SSSRLGRLHLQFLGDGTLITLDALELGVHKVQDAKCYIAPSKNKLRRHSELPIKTLAPS
FT                   AVSHAVESDSSLSSDSTLVERAQLEELHHDIFGSGFMSLDLHAEVDHS"
FT   CDS_pept        complement(590014..591429)
FT                   /codon_start=1
FT                   /gene_family="HOG000182055" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752391"
FT                   /locus_tag="ADL053C"
FT                   /orf_name="AGOS_ADL053C"
FT                   /product="ADL053Cp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS51867.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000252A41"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AI0"
FT                   /transl_table=1
FT                   /translation="MGNRGSQHVVGIHYAVGPKIGEGSFGIIFEGENMMEGGDAGRRPV
FT                   AIKFEPRRSDAPQLRDEFRAYRILNGVRGIPRAYYFGQEGVHNILIIDLLGPSLEDLFE
FT                   WCGRRFSVKTTCMLAKQMIERVRAIHGRDLIYRDIKPDNFLISEFQREVAAGEVVRGCA
FT                   ATAGGDANLIYVVDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHFGREQSRRD
FT                   DLESLGHVFFYFLRGSLPWQGLKAPNNKAKYEKIGLTKQKLKPEELISENIPVQFAEYL
FT                   KYCRSLRFDEEPDYDYLISLMDSVMHDLNIEDNQHYDWMDLNNHTGWNIAVNKRANLHG
FT                   YGNPHPRNNNHTTSNLHQQQVQGQAQLKQQPSSPSYHMQYQEHSHKYSKLHRSHSQSTP
FT                   HRNSQSGKNRVELSTGSNEILTNHPSGKQAVAVQSYDAFGKRVTRSGQQNHIEQDSLTD
FT                   AGFFSRICCCRWC"
FT   CDS_pept        591938..592993
FT                   /codon_start=1
FT                   /gene_family="HOG000190863" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079843"
FT                   /gene_name="EAF3"
FT                   /locus_tag="ADL052W"
FT                   /product="Chromatin modification-related protein EAF3 "
FT                   /function="chromatin binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin assembly or disassembly "
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="chromatin"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51868.1"
FT                   /db_xref="GO:0000785"
FT                   /db_xref="GO:0003682"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006333"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG396389"
FT                   /db_xref="HOGENOM:HBG525584"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR008676"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="InterPro:IPR017398"
FT                   /db_xref="UniParc:UPI0000252A42"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AH9"
FT                   /transl_table=1
FT                   /translation="MFGPVEVLRKAVQCRGMCGARSDGEKFEARRAATTSPRDTAMAFE
FT                   IDGKCLCYHGPLLYEARVLRVYDPASQTYRDRTRTGVPLEEEDGLPAESRGREHWFVHY
FT                   QGWKSTWDEWVGQERIRPYNDENLALKRQLVQDAKAAAAAAKRAKARPGKRERSPAPAA
FT                   PAAPAQGPRLAVRMPVELKALLVDDWERITKERKLVALPCAPTVGDILDAYYRERTAQL
FT                   ASPVAQTLLHEFVEGVHLYFDQCLSHLLLYRLERLQFDEACGGAAPAASGLPAPPEPRP
FT                   SAVYGGVHLLRLLSMMPELICGTTMDEKSCHTVVAQCESLLAWMATHADDLVSGDYINT
FT                   SAQYEGVALGM"
FT   CDS_pept        complement(594119..594631)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059072"
FT                   /locus_tag="AGOS_ADL052CA"
FT                   /product="ADL052C-Ap"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ADJ41763.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001DB28C0"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGC0"
FT                   /transl_table=1
FT                   /translation="MMGPAQEGAVVSLDPPDRQIGEEPAWESFLDILEDSYTPYVGPFQ
FT                   SFPWTQSLPHGEDRGLTPPLTLSLGAPLVCASLADARPLSEKTCPICNKTFTRKVSVAI
FT                   HMVVHTNLKPYACDFPGCKKKFNVKGNLQRHTKSHHLHGHSRLQTGPPAAAPSSTNRVA
FT                   AGPRHSP"
FT   CDS_pept        595905..596426
FT                   /codon_start=1
FT                   /gene_family="HOG000144410" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775594"
FT                   /locus_tag="ADL051W"
FT                   /orf_name="AGOS_ADL051W"
FT                   /product="ADL051Wp"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS51869.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG024634"
FT                   /db_xref="HOGENOM:HBG058664"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000252A43"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AH8"
FT                   /transl_table=1
FT                   /translation="MPHTYQVPETLTIFTGPLHSFPWTVKFEAPVASQDEGLAVGSSLA
FT                   PCARGGGNPDLAGKNKETDATLRGGALSLGGSQRLYEGQLVSLALQDVTLSCELSKGVS
FT                   DPANSVHKVSGKTCAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCNKTFNVKSNLYR
FT                   HERIHKRNCS"
FT   CDS_pept        597638..598078
FT                   /codon_start=1
FT                   /gene_family="HOG000144410" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752392"
FT                   /locus_tag="ADL050W"
FT                   /orf_name="AGOS_ADL050W"
FT                   /product="ADL050Wp"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS51870.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG024634"
FT                   /db_xref="HOGENOM:HBG058665"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000252A44"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AH7"
FT                   /transl_table=1
FT                   /translation="MLPTLHSEEPKKTFTGPVQSYPWTRLEDPGQSSAEDGGTAGEQEY
FT                   TMAADGDAPAARPSPFGSPPALSPLMALNSKTCPVCLKEFTRKTSLNTHLLIHADIRPY
FT                   LCDYANCNKSFNVKSNLNRHLRIHRGHELHHEQGSSQEPSDP"
FT   CDS_pept        598544..601282
FT                   /codon_start=1
FT                   /gene_family="HOG000180633" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20623081"
FT                   /gene_name="AGC1"
FT                   /locus_tag="ADL049W"
FT                   /product="Mitochondrial aspartate-glutamate transporter
FT                   AGC1"
FT                   /function="binding"
FT                   /biological_process="amino acid transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS51871.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0006865"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058666"
FT                   /db_xref="HOGENOM:HBG203953"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0000252A45"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AH6"
FT                   /transl_table=1
FT                   /translation="MMELSSASTVKKKRQLAIFNAYATPLRQDERRLRASYEHGGVVGG
FT                   HVASNEKVLLFDDFVDLISNSRSFYSKFTDHCFNLNQIPNTVFGCIFFAIDENNKGYLN
FT                   VNDWFYFNNVLEYDNYHFIILYEFFRKFDAARERAYGPSVKSINYGNRFLSFDELYLDL
FT                   EQFQATLRLLHSCVRDDFIVNNKLFLDWKQFRWLKWYQFYPRGLLQNGPHITLNSLISI
FT                   VQNDLKSEKLLLGFHCLSQLDHRTNSMTISKNQLVYLMRLFYSHKIPADIFNSLNMSTL
FT                   SCAKCDNNHINYNVFRDLFYLIQNFDLLNQIVHRYAEVHKFSDRDVREQHISRKDLLRF
FT                   MNTEYNKINNIIEFSPAQISLLFSIVTNSKKLNYLNNARQNNPELSYHHRDSEIDSFIH
FT                   NEYINGNAASSLHNESLEKFNDDFENIIQADAGDTKQQISSTDWRSVFSWSSFLSSFEW
FT                   LHFKKRKSVQTNGLSDEYVNEALTLEDIMKIVNPNYLNDLVHHMELRRIESESRSSNLY
FT                   FYPIFDSIYNFTLGSVAGCIGAMVVYPIDMVKTRMQAQRDFSKYKNSIDCLLKILSKEG
FT                   VRGLYSGLGPQLIGVAPEKAIKLTVNDHMRATLAGRDGKLSLPCEIISGATAGACQVVF
FT                   TNPLEIVKIRLQVKSDYVADAARNSVNAISVIKNLGLIGLYRGAGACLLRDIPFSAIYF
FT                   PTYAHIKSNVFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQIDPK
FT                   KGESVYNGIWDAARTILKEEGIKSFFKGGPARVLRSSPQFGFTLAAYEIFHNLFPAPRY
FT                   DDSTTHRPTREPVGALAPINKTVSAFFPDQLEPHVGNNKWASRLYGPNIDPYSSSFLNY
FT                   YYKSCQVAKAFMDLDYNFAHFDFNTYQQFHDELNAMKNKKH"
FT   CDS_pept        complement(601602..602699)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752393"
FT                   /locus_tag="ADL048C"
FT                   /orf_name="AGOS_ADL048C"
FT                   /product="ADL048Cp"
FT                   /protein_id="AAS51872.1"
FT                   /db_xref="HOGENOM:HBG058667"
FT                   /db_xref="UniParc:UPI0000252A46"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AH5"
FT                   /transl_table=1
FT                   /translation="MLVQEGPPSTQQYEIKDWLRGLSWEHLVSLQYDIADELARRVREM
FT                   KLASGLSKDKEDHTEELISTQTSATEAVQPQTGYLHMGAPSTFPEGDGDSQPLIPGTLE
FT                   LRNKHFVLSSSPLKKELPESQNSQNSPRRNLRLLLGPRLAPKQSSPTKSPRRSPTKEVS
FT                   TPRAKQTQEAHEPIDEDEAEQISDSEGDLSWDSKLPDVHEGQEKRAKIDFNTNPIAKRP
FT                   WIYEDFQANHEVLEELSKKRLKDHRRNVMDGLAGLPNKLGGEANYDSSFDESFPMYDNL
FT                   RHRSKSPPGYGRLDFPTTQEIQDDKRKAQDMIYQRTKHRFKMAVQRKIPIFEREYFFKN
FT                   PQLNTWVDNGEISWSKEELQIFKRT"
FT   CDS_pept        602829..603641
FT                   /codon_start=1
FT                   /gene_family="HOG000112094" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775595"
FT                   /gene_name="CWC26"
FT                   /locus_tag="ADL047W"
FT                   /product="Pre-mRNA-splicing factor CWC26 "
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="AAS51873.1"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG058668"
FT                   /db_xref="HOGENOM:HBG204465"
FT                   /db_xref="InterPro:IPR018609"
FT                   /db_xref="UniParc:UPI0000252A47"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AG5"
FT                   /transl_table=1
FT                   /translation="MSLNSYLTEAYGPKRAAKSRNGSKREAKVSNVSITDSAEQLVFTN
FT                   NKPTGHATDIKAKAKRTGLFKNLETNELTEFKPASEVQEPNEVKMSSGAHAGLQSAEQV
FT                   AEQIGKKQREAQREAAAAAVNKETVFRDSSGAQIADYSTYMRDRERADKLRERFQQNKS
FT                   REMNMGDIQLHQLRNPDWRPARCEGEQIRRDDPAAQFTAESSAATYKLSPLGRKLYNKA
FT                   WPENRFQIAPGWRWDGVDRSNGFEQKWFAKQGELAERKAQQMAAQQDY"
FT   CDS_pept        complement(603805..608229)
FT                   /codon_start=1
FT                   /gene_family="HOG000160331" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752394"
FT                   /locus_tag="ADL046C"
FT                   /orf_name="AGOS_ADL046C"
FT                   /product="ADL046Cp"
FT                   /function="5'-3' exonuclease activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="nucleobase, nucleoside, nucleotide and
FT                   nucleic acid metabolic process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS51874.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006139"
FT                   /db_xref="GO:0008409"
FT                   /db_xref="HOGENOM:HBG036144"
FT                   /db_xref="HOGENOM:HBG611558"
FT                   /db_xref="InterPro:IPR004859"
FT                   /db_xref="InterPro:IPR016494"
FT                   /db_xref="UniParc:UPI0000252A48"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AG4"
FT                   /transl_table=1
FT                   /translation="MGIPKFFRYVSERWPNISQLIDGTQISQFDNLYLDMNSILHTATH
FT                   GNEDDIKKRLSEEEVFARIFVYIDHLFHTIKPQQTLYMAIDGVAPRAKMNQQRARRFRS
FT                   AMDAETSLNRARERGDEIPEGEPFDSNSITPGTEFMHKLTTNLKYFIHEKVSSDSLWQN
FT                   KNIILSGHEVPGEGEHKIMQYIRTLRAQQDYNPNTRHCIYGLDADLIMLGLSIHDTHVA
FT                   LLREEILYGRAQKPKALEQQNFYLLHLAIMREYLELEFQEISDELEFKFDFERLLDDFI
FT                   LVMFVIGNDFLPNLPDLHLNKGAFPVLLQTFKETLKHLDGYINENGTINFARFSVWLDY
FT                   LSKFELMNFERDDIDVDWFNSQLENISLEGERKRKRIGKKLLLKQQKKIVGAVKPWLMK
FT                   KFSETLSPDVTEEEITMTPWLEKDLAEKNIDFLKEFALELGLIVVHSDSNDTYTFKIDL
FT                   DSYSMNQSAEEHQTRVAELRRSIKKFEQAIIINDEEELEEAQEKYNERFIRWKDSYYKE
FT                   KVGFSIHDEDKLKEMANNYIEGLQWVLYYYYQGCPSWSWYYRYHYAPRISDIRKGLDVN
FT                   ISFSLDQPFKPFQQLMAVLPARSKELLPPVYRPLMYDDKSPILDLYPAEVELDKNGKTA
FT                   DWEAVVKLKFVDQDRLLAAMAPLDDLLTPEEKKRNIVGTDLIFVFNPQVDNVYKSPLKG
FT                   VFTDIANNHCVEREYVHPSMEGRSILYGLPEGAKLGTSALAGFPTLKSIPFNAQLAYNE
FT                   CTIFNQPSRHHSMLLTIKDVYQSSNLSVNDVAERYLGEIVYSNWPYIRESKMVSIIDNN
FT                   YVYIASEKCKKSGGTSVVRKPATPEEKKAFSSMVKNIIHGYSKKKGIVLPEVRAIARVL
FT                   PVTGLIRQPDGSYQKCFSKVEELYPLQLIVEDVENKDERYMERPPLPIDEEFPTGSRVI
FT                   FLGDYAYGGEATVDGYTSATRLKLTVNKQSTKAEPNIGKRRAEMDRKAVHYWPSFVVAK
FT                   RLGLHPLFLSRITSRFLIEVDNRSVNVGLMVKFPARDEKVLGYARKNRESWEYSNLTLQ
FT                   LVDQYRKNFPDFFNALMNVDKKIPKLKDLLSRRNAEEASAMLASITAFIKDARQSFVIV
FT                   PLESDSLTKASIQAVEKEIMRIADLPDQSEKRQLAKVPREAILDPRQSFALLRTQRFDL
FT                   GDRVIYVQDSGKVPLFSKGTVVGYTTIGSRISIQVLFDQELAAGTTFGERLQTNRGIGV
FT                   DSSCLLNISKRQFIYHSKASKQYTDKAAKKKQTNVRQPPKITPEQRRKRVEETKKQQAH
FT                   EMLNRIRNENSSVPDNSNQLSGTNFANGIKGPSIIMNTQVPLNTVGKSVANNVYNAVVS
FT                   QLANPAMDQNIPFGLQSAHMMANHMPHSGIVPLPPNGMVPMHQPVVFGFPPHGGAPPNM
FT                   PVSRDFSRPSMVPQAFHVNAIGNITNPPVDEASTAAMKNLIHPQRQDKKEAGRSQYSGR
FT                   GRKGPYRGNHAKK"
FT   CDS_pept        608554..609705
FT                   /codon_start=1
FT                   /gene_family="HOG000246824" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928590"
FT                   /locus_tag="ADL045W"
FT                   /orf_name="AGOS_ADL045W"
FT                   /product="ADL045Wp"
FT                   /protein_id="AAS51875.1"
FT                   /db_xref="HOGENOM:HBG104545"
FT                   /db_xref="HOGENOM:HBG253516"
FT                   /db_xref="UniParc:UPI0000252A49"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AG3"
FT                   /transl_table=1
FT                   /translation="MEGALHRHTGKTRALGPSKHMFSFGNQSGTGGAQGSSGLFGQAAA
FT                   QPQTGAGSGGLFGQTTASGATTGTSFGQTGAGGAATGGGLFGQQGVSNSGGLFGQNAGG
FT                   SSGGLFGRDTTGTAKPGGLFGTQSTGGGAFGSKPAATGGLFGGAGGGAPGALFGTQAAP
FT                   QPQPSALHSIAQLPITSMTRIGDLPPQVRQEIEQLDQYIQRQVAISHHLRAEEDEHLEL
FT                   ISSIPRDVQFIMKTYSLTTQSLQQDLKRIQAIKALTDDNIRDSECFSLILNQLLTPGTK
FT                   VSSAELQKFFQEKIQLYRVRLDEYFRVLSDIKSAVNGLDSDMFGSQENSTEYAEPTKTG
FT                   INSIVATVIEEFELFMDMAERVAQLHQRVKELNGSGKNPVISS"
FT   CDS_pept        610125..611255
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079844"
FT                   /locus_tag="ADL044W"
FT                   /orf_name="AGOS_ADL044W"
FT                   /product="ADL044Wp"
FT                   /protein_id="AAS51876.1"
FT                   /db_xref="HOGENOM:HBG058669"
FT                   /db_xref="UniParc:UPI0000252A4A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AG2"
FT                   /transl_table=1
FT                   /translation="MPVVNRELDRAWNVVRVVDACDIGEAQVIEDALNFDDVLSNTSSD
FT                   ESECVFKPNTADNGGGLESEAEGSEYGQSTFVQADSEESTVPKEHSECDNPVAGNGERA
FT                   THPVSRIGSLSTLQVVLLTSSTTVVAYYWLQQLWFWLRPQNTGYPSPGVMTPSVLGLGN
FT                   DDTLVFNSAGLPVPFEKYGTKRFMVDFENKVAYPVHAPEDFLALYAGKYVVSNVLSYQV
FT                   ALLYRLNYEWLPKLAYKYQVFRTHIHDSLSAPAHQLGAYCLPSYSALRQIAASASDNVR
FT                   EIVTIYIQRTCRTVEISYEGAVHALSTMFRELQPKLNIPLQRFESRLISIKQRTVEPLL
FT                   QSGLLNYNALRRWGLRKTVLVATQVRKYVAKCASIF"
FT   CDS_pept        complement(612500..614521)
FT                   /codon_start=1
FT                   /gene_family="HOG000113240" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752395"
FT                   /locus_tag="ADL043C"
FT                   /orf_name="AGOS_ADL043C"
FT                   /product="ADL043Cp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS51877.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058670"
FT                   /db_xref="HOGENOM:HBG202569"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000252A4B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AG1"
FT                   /transl_table=1
FT                   /translation="MAENTQLRRKRTRAFDLNGSRAVGAQNGRMGAAGVEMGDATGTAR
FT                   NGLYIEEEPDPLVNDMLQRQMFLLGSNSGNSGDSGSLVRDADDADSSLAFMGDVGDMVG
FT                   ELALGGTHAGSNYTARRFKKQRTVSLPQLPHAKLFYRLDARGPAASKAVPRRSQNDDEL
FT                   LHISGSSSRTLDGNRMVTLPVIRSESPSSLLPPTQLEQQTALNGSAITKATSLLTGQQK
FT                   LPKLITRRQRSIRRDNFNTDKEGHYVFHGNDIFANGRFMTEELLGQGTFGKVVKCVDNA
FT                   EPTKKHVAVKIIRALDRYRQAAKTELRVLQTIRDNDPLGQFQCLLLRDCFDYRNHICLV
FT                   TDLFGKSIYDFMCNNGNPRFPGSHVQAISRQLIRSVCFLHDLGIIHTDLKPENILICDE
FT                   SFVETPLPDTVLATLSTRRKQVSGGKHKVLTNPEVKLIDFGSAVFCEEYHPPVISTRHY
FT                   RAPEIVLGLGWSFPCDLWSIGCVLVELVTGESLYPIHENLEHMAMMQRVNGQSFPRKMI
FT                   SKMFYKVEHKLGNLPTDLMTTVVRHFDKTSMALQWPERNYKGEIVTKEKSMKRVMATCD
FT                   RLDKHISTKLQRDYGEWLIIDWDYTPEQNWSMIESKFYNRTMRIDRETFLFWYWFVDLC
FT                   RKMFEFDPTKRITAKDAMDHEWFTYGILDEGISSFGQT"
FT   CDS_pept        616227..617072
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928591"
FT                   /locus_tag="ADL042W"
FT                   /orf_name="AGOS_ADL042W"
FT                   /product="ADL042Wp"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS51878.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058671"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000252A4C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AG0"
FT                   /transl_table=1
FT                   /translation="MSQNYRMHPDSCHNYCAATAMSADVHVRNSHQLQPSDLAVAASHP
FT                   ISGGGSYHYYPSDISSGTKNSSSSITSRSLPSLPSLKEILNSTPAVPVAPPVPRHYIAP
FT                   GVSTCQSKVMLPPIQVAHYLPQQRQYEHMYAQDKSGHSSVLDSPRMTPLIMLNVSSPPA
FT                   NPISGVSATSTQQIHQAQILPRRNSLPCFTASQTPPQQPLLNSPLHTRKNPYRGSAYKK
FT                   NGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRKHKEAP
FT                   "
FT   CDS_pept        complement(617958..618257)
FT                   /codon_start=1
FT                   /gene_family="HOG000208239" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20623082"
FT                   /gene_name="COX19"
FT                   /locus_tag="ADL041C"
FT                   /product="Cytochrome c oxidase assembly protein COX19 "
FT                   /cellular_component="mitochondrial intermembrane space "
FT                   /protein_id="AAS51879.2"
FT                   /db_xref="GO:0005758"
FT                   /db_xref="HOGENOM:HBG203264"
FT                   /db_xref="HOGENOM:HBG756691"
FT                   /db_xref="UniParc:UPI0001DB28E1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AF9"
FT                   /transl_table=1
FT                   /translation="MSGNPGSALQALSPTPPERGSFPLDHEGECTAQMMEYLNCMKLVR
FT                   GENAPNCRLLARNYLKCRMDHRLMDRDEWAHLGLPDDKRAEAAASADSARPPRQ"
FT   CDS_pept        619264..620256
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752396"
FT                   /locus_tag="AGOS_ADL040W"
FT                   /product="ADL040Wp"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS51880.2"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058672"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001DB28E2"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AF8"
FT                   /transl_table=1
FT                   /translation="MGIAGSFLWVPSVKQECGYIIRISLSNASTKICLHSAVEAYLRVP
FT                   RTGIYTEPRVLCPERAWWIQAKKLDDQRNSVERQMYLPSRIDNIPPPGARIECTQATRA
FT                   SGLGAAGLGCSGRLGGEAHYHSVLWCGGDATPRSCGLHSSHACTRSRVTLPPLASLLQS
FT                   SGYMGFNSEPRAVTRSCLGATHPEGHYGRDMLSSAVGHAACYVGRQSPLLPLGDAIAPA
FT                   LPPKPSHRCVAGNAQLRRPVLPIVGPAASPRYETNKTCLVCGRRCTRPSTLKTHMLIHT
FT                   GELPFQCSWPGCSKRFNVRSNMNRHVNSHKRRLMKESKKKSSSPGAGML"
FT   CDS_pept        complement(621035..622705)
FT                   /codon_start=1
FT                   /gene_family="HOG000226032" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079845"
FT                   /locus_tag="ADL039C"
FT                   /orf_name="AGOS_ADL039C"
FT                   /product="ADL039Cp"
FT                   /function="ATP binding"
FT                   /function="aspartate-tRNA ligase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="aspartyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS51881.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004815"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006422"
FT                   /db_xref="HOGENOM:HBG370907"
FT                   /db_xref="HOGENOM:HBG745843"
FT                   /db_xref="HSSP:1ASZ"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004523"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniParc:UPI0000252A4F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AF7"
FT                   /transl_table=1
FT                   /translation="MSEQVEQVADKVAELSTKEETVILGEDGQPLSKKALKKLLKEQEK
FT                   QKKKEERAAQLAAEAEARQKASAASDTARDNYGALPLIQSASRTGEKRIQFAELTAEDE
FT                   GKEVLLRSRVHTVRQQGATLAFLMLRQRSSLIQALVKANAEGTVSKQMVKWAGSLNLES
FT                   IVLVRGVVRKVEEPVKSATVQDFEIQITQLHTISETPQQLPILIEDASRSEAEAEAAGL
FT                   PVVNLDTRLDARVIDLRTVTNQAIFRIKAGVCGLFREFFQSRNFTEIHTPKLLASPSEG
FT                   GANVFEVKYFKGNAYLAQSPQFYKQQLIAADFERVFEVAPVFRAENSNTHRHMTEFTGV
FT                   DLEMAFEEHYHEVIEVMGEMFMFVFTELKKRFAREIAQVRKQYPVEEFKFPADGKMVIL
FT                   HYKEGIAMLREAGKEIGDFDDLSTENERFLGKLVREKYDTDFYILDKFPAELRPFYTMP
FT                   DPADPRYSNSYDFFMRGEEIMSGAQRIHDPELLRERMKHHGLQPEDAGFKDYCDAFTYG
FT                   CPPHAGGGIGLERIVMFYLDLKNIRRATLFPRDPKRLRP"
FT   CDS_pept        623719..628245
FT                   /codon_start=1
FT                   /gene_family="HOG000111493" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752397"
FT                   /locus_tag="AGOS_ADL038W"
FT                   /product="ADL038Wp"
FT                   /function="guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of small GTPase mediated
FT                   signal transduction"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS51882.2"
FT                   /db_xref="GO:0005085"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0051056"
FT                   /db_xref="HOGENOM:HBG058673"
FT                   /db_xref="InterPro:IPR000651"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="InterPro:IPR008937"
FT                   /db_xref="InterPro:IPR019804"
FT                   /db_xref="UniParc:UPI0001DB28E3"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AF6"
FT                   /transl_table=1
FT                   /translation="MAESLTSSQPPTLVKCKDVVRALCDFVPLKKQHLPLKAGDVVYVL
FT                   SRHESGWCDGIIIEQTAKGNSTVTQCQRGWFPRTYTRSIRERRCTQSSSAGAAGVAHNF
FT                   VSRPHMMLRNPSTPTLRRNSLNIRVSHLGGNTSNHGGTNLARAVTGQSDTHFSPHMFTT
FT                   TSSPGSSQTHLKQDYKLDMRRRSVCSQRRASMASSHNTRSPSKSPFTELLPVDPLQRLP
FT                   IDETPNTEPSQTKNSPAPAQKSNSYRAQLLSVAEVQMFFNSLGSIRYVPVWSPVGTEDG
FT                   EVLFYNKEHNIYCRTLPLLQEPRMDCQSIFPKDDHLIDLSLRKPHEIKNATSNITAEGQ
FT                   YPTALNCPNTDSGEICVRDLSREATDGPDAQSRAATRTQKCELETTMEKVPVLFSKQEL
FT                   FFHHTSDMRTWTELRDCTLYYLYLSHDSFFRRNQLQFKRNFDHLARLTTMWQLACRLLR
FT                   NEVTKKNMHKEIRKLVKGLTKSLSKISLASTIYVSTDCRQPGTSSAERRSTAADDISFI
FT                   RDMKASVTSRSTTLNEVDLSPTIDNSERDPPTESSVRNEDMIPDIPESTIEIDQGGATT
FT                   VLPAIPSRLINRTEPERGSAALSPTVKTGATYDKSPNFLDETSILSIEMLFHVIDHEVD
FT                   QYKGKIAKLYHLLKSELLTEDVIPQLYPRMLKNSFDGGAWTNPFHPQMFPLSSSGDINF
FT                   TSNSGSLSVGKAGSSGTESARLDARNFSNTSSKTVTSIFNRNKSRTFSRSKLSKKTRYP
FT                   LNEDTLRLIKGKVTHLTDKLEEYDSYVLNLAKSKHRDLEMAASTYEIIAIISQLIDMLE
FT                   SLDLTFFVNLRNLPTLETAANLDKESMELRDHCVATVTVLMMEFFEVKQALHDIAIGVI
FT                   IEVQGLTLRDPFVFSPMRDDLGEAGEYDFKKHSFIKQDRFAAALARSLVQQDVECNNVN
FT                   FPVSDPVSMEAASKLVQMVETGYQLTEQLVSERENILNYAARLMKNDLIAELMKGEHDR
FT                   WFEEDDTNRSVGVEGGIADSHDIQKKKIDLPWYLDSQYESQLVYDANGNIRGGTKEALI
FT                   EHLTSHLVIDASFNVTMLITFKSMFTTTELLSALILRYNLYPPEGLSYEEYNEWVQKKH
FT                   LPIKANVINIMKLWFSQYWSPAYYDPCLEELVAFAQLASAEKIPDSDPLIDLIKKVVAQ
FT                   KNDMQGFIPRRIPFMVENSVFFQAGSSSYVPSPPLPPNHSLTTNASSASLGTSFRLKKL
FT                   KQVDIEASVFAKQLTIKENLLYCKIHLFECLDRTWKTRYCDFGGSPNISNFIQNSNHLT
FT                   NYVSYMIVKQTDLKRRVQIVQYFIDVAETCRALNNFSSMTAITSAMLSSSIYRLKRTWA
FT                   MVHDNYKESLDRMNALMDSAKNFRKYRELLESLGDCPCVPFFGVYLSDLTFTAGGNPDY
FT                   LKGTTGVINFAKRARIVNVLKEIDSYQRISYRLKRIAEIQEFIDERLLNVPNIEKQYEL
FT                   SLRIEPRQEVSTGLNADASYAKHGSAAMKGKKLGFVNRIKRSHGSAS"
FT   CDS_pept        628864..629007
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059073"
FT                   /locus_tag="AGOS_ADL037WA"
FT                   /product="ADL037W-Ap"
FT                   /protein_id="ADJ41764.1"
FT                   /db_xref="UniParc:UPI0001DB28E4"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGC1"
FT                   /transl_table=1
FT                   /translation="MYYQQPAQPVYIQQAPPPQQESSCCGTCCKVLLCCCIFQMCADMC
FT                   CG"
FT   CDS_pept        629399..632062
FT                   /codon_start=1
FT                   /gene_family="HOG000113062" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15752398"
FT                   /gene_name="IMH1"
FT                   /locus_tag="ADL037W"
FT                   /product="Golgin IMH1"
FT                   /biological_process="protein transport"
FT                   /cellular_component="Golgi membrane"
FT                   /protein_id="AAS51883.2"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG058674"
FT                   /db_xref="HOGENOM:HBG202533"
FT                   /db_xref="InterPro:IPR000237"
FT                   /db_xref="UniParc:UPI0001DB28E5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AF5"
FT                   /transl_table=1
FT                   /translation="MFKQLSQFGKNITDELAKGINEDTASEGQHGAGAQGGRREEGGSP
FT                   YEELPKEIQAKLRKFEKYEQKYPLLLNAYKAEKEKSDEVELLLKVLSENTPVSAIGDVE
FT                   TLRGFFEDVGVKTAMLTEEIKRITGENNGLQKQLAEAQESLEQRQRDLTSREEELAKSS
FT                   REATELRELRQQAVAEKDAAVTERDDAQKAAAEMETRCTEAEAHAAEMKSQIESMETEL
FT                   KRTEKLLTTYKSTIQELGASQATGEAQPSSEAPSVRGKKGKGKRGKGKKRVQAADEKAD
FT                   TSSELELGEEKTPSTSSAGDEIIEAIETKQKYENLVEEHQQLSLELEKSRHWEQECLDS
FT                   RKKVETLETELKDVKAKLKNSNEELETVRGMLKTVGNELVHARDELKQLNCEGTNEVER
FT                   LKSELQELRTENSTQIATLKEQLQLLNDQKKALETDVEQHKRKMEDLESELLKSQENVS
FT                   KFRNQNNDLSEKLRDYIVLKKSEATTRMSLSQKEKTIEYLEEQVRQYNSKEIEDKKAFA
FT                   DSKTELERWQRTAANLEKQLERIRLETKRHDDNLESYIKENGKLSERLEVLQEKYDSLQ
FT                   NLKSNSGDQVSAIRKQCEELNSKLKEATKRVMSLEDELNETSTVLQERTREATTMRRMI
FT                   NSDRSSKDTKIRELEDRVAAASEERDKLKSELDVLLARKNHETQDLKNTNQELVVKINA
FT                   LELKEQELATEVQQLKVLNQTIRRHSSTAADGSEELELTVRKLKDSLRTSEKKMRELKD
FT                   SNEELKSLNDELNAKLDRLANRYKVLSTQLKMSKDMSSQSRHSSRSGSLVSPSSDNETG
FT                   NSPRKISISSAHPAPVVASYDNSAEMESNEKLAYIRNVLLGFLEHREQRSQLLPVVSTL
FT                   LQLSSHDEKRLLTSLK"
FT   CDS_pept        complement(632308..633246)
FT                   /codon_start=1
FT                   /gene_family="HOG000094344" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752399"
FT                   /locus_tag="ADL036C"
FT                   /orf_name="AGOS_ADL036C"
FT                   /product="ADL036Cp"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="AAS51884.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG058675"
FT                   /db_xref="HOGENOM:HBG397914"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniParc:UPI0000252A52"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AF4"
FT                   /transl_table=1
FT                   /translation="MKSSLLKKALVLACASGRFAAAMPSQNEYEVDAEMTPFPAWLTEL
FT                   TGLSQWPDADPPYIPIESIDLSKVPDYKPYREGECHLNPPESCSFDCYKCLAIDDVHTC
FT                   PRLSQTFDDGPSEATLELLGHLNHKTTFFNLGYNIVRNPAVYRQVMAAGHLIGTHTWSH
FT                   PFLPSLTNEQVVAQLQWSIWAMNATGNHLPRWFRPPYGGIDNRIRAIARQFGLTTVLWD
FT                   RDTFDWMLQSSEFSRTEQQILDDVTEWMRTGTGLILEHDGHERTARMGIQVNDMIGPNQ
FT                   MTVAECAGGVDYLQSLPWFSRNSHLSSEEAQ"
FT   CDS_pept        634116..634343
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752400"
FT                   /locus_tag="ADL036W-A"
FT                   /orf_name="AGOS_ADL036WA"
FT                   /product="ADL036W-Ap"
FT                   /protein_id="AAS51885.1"
FT                   /db_xref="HOGENOM:HBG058676"
FT                   /db_xref="UniParc:UPI0000252A53"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AF3"
FT                   /transl_table=1
FT                   /translation="MFSKNAFQILSPAVMARCAVPRGEIKTTTFPQLARAASTAAATRL
FT                   WSLGNKEQKPTVVISSDSDEVETVCDHIRV"
FT   CDS_pept        join(complement(635067..635117),complement(634463..635014))
FT                   /codon_start=1
FT                   /gene_family="HOG000233456" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20623083"
FT                   /gene_name="UBC12"
FT                   /locus_tag="ADL035C"
FT                   /product="NEDD8-conjugating enzyme UBC12 "
FT                   /EC_number="6.3.2.-"
FT                   /function="ATP binding"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="AAS51886.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG492183"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR015580"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI0000252A54"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AF2"
FT                   /transl_table=1
FT                   /translation="MLRRMPPATEPATRYTMLKLRQLQKEKQRQAAQAQAPAQGRSAAS
FT                   PAQLRVEKDLATLELPTTVTLDTKCLGSENKVYLRISPEEGVYRGGHFRFSVVFRDTYP
FT                   IEPPTVKCLNTIYHPNIDYSGNICLNVLREDWSPVMDLQTVVLGLLFLFLEPNGSDPLN
FT                   RQAADTMLRDPYRFETNVQATMMGGHLDGQVFDNVRH"
FT   CDS_pept        635174..636523
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20623084"
FT                   /locus_tag="ADL034W"
FT                   /orf_name="AGOS_ADL034W"
FT                   /product="ADL034Wp"
FT                   /protein_id="AAS51887.1"
FT                   /db_xref="HOGENOM:HBG058677"
FT                   /db_xref="UniParc:UPI0000252A55"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AF1"
FT                   /transl_table=1
FT                   /translation="MAPELPGFYYDSARGRYFRVAAAGAPAGAERYGRDELRRKRAHNS
FT                   DNLRRQQEAARAEQARRELVLALARGRAGDLRRIAGAPAPPTTGRVREHLDVFRERPPA
FT                   TLLPQMFYEDGVFLLMDQRAVLYAVRDADGSVSTAAPAAGFGAGEAAGPVLDEQGGLGG
FT                   WLLRAHGAYSLAAPDGTLRDTALPRGGEVFAALALGDEAFFAQHARVLRAPAGARRLPR
FT                   SADTDVLALAVAPHGAALFAGCRNGQLFRLPPAPHAPPELIHTFPGPVVGLRPLPGTPL
FT                   LVASVHAHPAQLLCVLDTRGPARQPVVRRLATRLRNAAAATEILQLAGSLLLYGSTAAR
FT                   DGRGDWDLFCLDPLAHHAADYDPACGAPSVLPAMTMDQCLAPCSRRRLLAAALCPRLHA
FT                   ADADGLFHAACSAHQTQFYRETDTQQPRMRVAMLCRDADEVGLVLRSTDL"
FT   CDS_pept        636729..642479
FT                   /codon_start=1
FT                   /gene_family="HOG000179764" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775596"
FT                   /locus_tag="ADL033W"
FT                   /orf_name="AGOS_ADL033W"
FT                   /product="ADL033Wp"
FT                   /function="binding"
FT                   /function="inositol or phosphatidylinositol kinase activity"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="phosphatidylinositol phosphorylation "
FT                   /biological_process="phosphatidylinositol-mediated
FT                   signaling"
FT                   /protein_id="AAS51888.1"
FT                   /db_xref="GO:0004428"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="GO:0046854"
FT                   /db_xref="GO:0048015"
FT                   /db_xref="HOGENOM:HBG058678"
FT                   /db_xref="HOGENOM:HBG325491"
FT                   /db_xref="HSSP:1E8X"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="UniParc:UPI0000252A56"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AF0"
FT                   /transl_table=1
FT                   /translation="MRKYGVCAMVPNINLTIGCRKGDFSVRASALKRLSQITLDGGGNL
FT                   DRITRSLPVAYSADTSKLYTIPLTVNELEILLSVSEAVPRTQAQAAQLLDHVIGVYFVE
FT                   APRQRFTDNLLHRFRIAHLRHPVEVETFHLTNFLITLDTRFGELDGRVRELLRGFLERV
FT                   FTQVDLVGLLALIGFLRAFIDYRHGTAISDLQAYVLELFHKYMDATFLGRVEQVVSETV
FT                   VNETLVNYFDNGCEVCAFLFCKLVGDLQLATVSNLLDIPRGDKKITTFLLRMQDLEYQY
FT                   ENAKDGEENDLDCLDRFKTAVRSNKQFLFKVLNFAHQQVNELEEGLKFANLNTLQRLHL
FT                   AYATKASALEVLSLGIFVDQQRYQTPLVSILSTELTNIYTMGPSTPSGTLETVISSASL
FT                   MNFFTEELSTQLLRIFPNIVSSPHIPTETVTTISMLFAIGLKPLTQDSVVSSVYSLNNL
FT                   LAVSANGSSMPILKECRYTANYETQIDKLFNARPLRSNTAAPYQQVVSATKANETANSS
FT                   SSNGEQISDDTSLTQHAHFEEGAAYHDALFKNAVTAVITIAANYNDSTIAALVVTILTQ
FT                   KFRVVSEQLDMIILEGLSDLCYFVKDTEFHLLMKFYNGATAVAMKEGNESLLQGVQSAR
FT                   TSISKKLKTKLDHPMYITYLRELLEVIIARGDVDKLEHHRSHSEIAIIAEQIAVYLKPL
FT                   ATLLPSQGEKPLNLRNDEITTSLYRNIWYNMVVHGFHAESRLTEKYYQELRIIAYNSPP
FT                   LASDFPANNRETSVDMNTILRRGSSNHNVKEQKNRLNSHLNMNTVAARSISIPKIMFLA
FT                   ATLFLETLRCDSGDCSTSLSYFLNTSIVSSSLDKFVNSIIISIVHKFTKLVNKGDTRVF
FT                   SSERIASQLSNMILLLSHRNSHLQDCAFQCCDILIKRVPSSLCHRDPLFMLLDSLTMLF
FT                   DSIVDCETNKYEPCYEFELKHSKTKVMISDSQQWRKTSLQRLHKSAREWVRIILKKANQ
FT                   DVKILLQSYLSDLGGFHRLSSVEFGVSFAFEMAGSVLSIDRELSKLNNCGMEKPDTISG
FT                   FLAQHSWRSKFLVEKAALSSCEALELERVSSKTEIEKMLDASQRIPEQLMADYLDLCST
FT                   LLLLHSGDASKLVYDMVSIPFRDFSSYSMKIATNVWLSVIKGRKDLSHFLVAEIASAFI
FT                   RSVDEKRGLYSHEHDLVPESYQHMEYSPYDKHHIELMANKAANSIQPHVHVVRLFASHF
FT                   EGTLFESTHLLKIFMRMAYHGVTNLKYASFHPYARTARNELLNFALMILSFIINQHTWD
FT                   AKILSQAIINGALMWFKKPRSWPFGSNELKIRADLSLLMELQNHIKVLDSVLHGYMGDK
FT                   VTLLECFLISEIHILETWLNPLHEGTELPHLPQGLIQVAFDIDPAMAVSLVGRYPYKKH
FT                   KETLSNLVHKNPLSCIHIPDALYNFLQKGGANSPYVLYWAPLGPIQVINLFLPEWSNYK
FT                   LLLQYNVRALESHDVNLTFFYVPQLVQCLRYDKLGYVQRFILDTAKQSVLFSHQIIWNM
FT                   LANSYKDDEATIEDDLKPTLDFIREKMIADFSAAHRDYYQREFGFFNEVTSISGKLKPF
FT                   IKKTKAEKKNKIDEEMAKIAIQPDVYLPSNPDGVVIDIDRKSGKPLQSHAKAPFMATFK
FT                   IRKTVSDEETGAVSYIEKWQGAIFKVGDDCRQDVLALQLISVFRTIWASIGMDVYVFPY
FT                   RVTATAPGCGVIDVLPNSISRDMLGREAVNGLYEYFTTKFGPENSIEFEHARNNFVKSL
FT                   AAYSVISYLLQFKDRHNGNIMYDEHGHCLHIDFGFIFDIVPGGVKFEAVPFKLTKEMVR
FT                   VMGGSPDTQAYQRFQELCTKAYLAARPHMDTIVQCVLPMLGSGLPCFKADKTIRHLEAR
FT                   FQPAKSDHDAAHFMRGLIRRSYESVFTKGYDEFQRLTNGIPY"
FT   CDS_pept        642848..645178
FT                   /codon_start=1
FT                   /gene_family="HOG000224293" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079846"
FT                   /locus_tag="ADL032W"
FT                   /orf_name="AGOS_ADL032W"
FT                   /product="ADL032Wp"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="aconitate hydratase activity"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="AAS51889.1"
FT                   /db_xref="GO:0003994"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="HOGENOM:HBG025113"
FT                   /db_xref="HOGENOM:HBG295973"
FT                   /db_xref="HSSP:1AMJ"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006248"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="UniParc:UPI0000252A57"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AE9"
FT                   /transl_table=1
FT                   /translation="MLSARALGRTPVARGMATVAKLTRDSQVKQNLLEDKSFINYKQNL
FT                   EYVDIVRQRLGRPLTYAEKILYGHLEDPHGQEIERGVSYLKLNPDRVACQDATAQMAIL
FT                   QFMSAGLPEVAKPVTVHCDHLIQAQVGGEKDLARACDLNKEVYDFLATATAKYNMGFWK
FT                   PGSGIIHQIVLENYAFPGALLIGTDSHTPNAGGLGQLAIGVGGADAVDVMSNLAWELKA
FT                   PKILGVKLTGRMSGWTSPKDIILKLAGITTVKGGTGKIVEYFGDGVDTFSATGMGTICN
FT                   MGAEIGATTSVFPFNKSMVEYLNATNRHQVAEFAQLYKKDLLSADEGAEYDEVIEIDLN
FT                   KLEPYVNGPFTPDLATPISKLKEVAVEKNWPLEVKVGLIGSCTNSSYEDMSRSASIIKD
FT                   AAAHGLKAKSLFTVTPGSEQIRATIARDGQLDTFTEFGGIVLANACGPCIGQWDRRDIK
FT                   KGEKNTIVSSYNRNFTSRNDGNPETHSFVASPELVTAFAIAGDLRFNPMTDKLKGKDGK
FT                   EFLLQPPTGEGLPSGGYDPGENTYQAPPKDRNQVEVKVSPTSDRLQLLSAFKPWDGKDP
FT                   QNMPILIKSLGKTTTDHISMAGPWLKYRGHLENISNNYMIGAINAENKKANCVKNHYTG
FT                   EYSGVPETARAYRDQGIKWVVIGGENFGEGSSREHAALEPRYLGGFAIITRSFARIHET
FT                   NLKKQGLLPLTFHEPAAYDKINPEDTVDIIGLSEFAPGKPLTLRIHSSSGTWETPLDHT
FT                   FNKEQIEWFKAGSALNKLAAAKK"
FT   tRNA            complement(645416..645489)
FT                   /gene_name="tRNA-Ile"
FT   tRNA            join(645713..645750,645766..645809)
FT                   /gene_name="tRNA-Leu"
FT   CDS_pept        646184..647587
FT                   /codon_start=1
FT                   /gene_family="HOG000246417" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18928592"
FT                   /locus_tag="AGOS_ADL031W"
FT                   /product="ADL031Wp"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transferase activity, transferring alkyl or aryl
FT                   (other than methyl) groups"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="AAS51890.2"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0016765"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG380413"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0001DB28E6"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AE8"
FT                   /transl_table=1
FT                   /translation="MGYHFDTLQLHAGQEDAAENANSPRAVPIYATTSYVFNDSKHGAQ
FT                   LFGLEAPGFIYSRIMNPTNDVLEKRIAALEGGAAALAVASGQAAQLVAIGGLAHAGDNI
FT                   VSTSYLYGGSYNQFKVAFKRLGIECRFVEGDNAEDFEARFDSKTKAVFLESIGNPKYNV
FT                   PDFERIVAVAHRHGIPVVVDNTFGAGGYFCQPIKFGADIVTHSATKWIGGHGTAIGGLV
FT                   VDSGKFPWKDYPAKFPQFSEPSEGYHGLVLNEALGPLAFVGHARIELLRDLGPALSPFA
FT                   AFLFLQGLETLSLRAERHGQNALALAKYLETSAYVSWVSYPGLESHDYHSNATRYLQNG
FT                   YGGVLSFGVKPLPDTDEEADPFKAAGAQFVDNLKLASNLANVGDSKTLVIAPYFTTHQQ
FT                   LSESEKLASGVTRDLIRVSVGTEYLQDIIADFEQAFSTVYGTPKGIAPVDVSADNSRLV
FT                   EGVPDKIQV"
FT   CDS_pept        complement(647828..648565)
FT                   /codon_start=1
FT                   /gene_family="HOG000230605" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775597"
FT                   /locus_tag="ADL030C"
FT                   /orf_name="AGOS_ADL030C"
FT                   /product="ADL030Cp"
FT                   /function="ribosome binding"
FT                   /biological_process="mature ribosome assembly"
FT                   /protein_id="AAS51891.1"
FT                   /db_xref="GO:0042256"
FT                   /db_xref="GO:0043022"
FT                   /db_xref="HOGENOM:HBG311487"
FT                   /db_xref="HOGENOM:HBG589638"
FT                   /db_xref="InterPro:IPR002769"
FT                   /db_xref="UniParc:UPI0000252A59"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AE7"
FT                   /transl_table=1
FT                   /translation="MATRTQFENSNEVGVFSKLTNTYCLVTIGGSENFYSAFEAELGDA
FT                   IPIVHTTIAGTRIVGRMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRIEERLSAL
FT                   GNVICCNDYVALVHPDIDNETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHP
FT                   QTTIQDQEELSSLLQVPLVAGTINRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIF
FT                   RLQDANPDAISGNLRDTLIETYS"
FT   CDS_pept        648987..650594
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775598"
FT                   /locus_tag="ADL029W"
FT                   /orf_name="AGOS_ADL029W"
FT                   /product="ADL029Wp"
FT                   /protein_id="AAS51892.1"
FT                   /db_xref="HOGENOM:HBG058679"
FT                   /db_xref="UniParc:UPI0000252A5A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AE6"
FT                   /transl_table=1
FT                   /translation="MWCAAMVSRIAQITVSAARQRQRMRKDTAFGFCVTQTIYLLNEDL
FT                   QSSAAVILLAQAKMSDLVNLSSWSRKVRTISQHSSCMEGPRKSTASSGGVCKSSGTAPD
FT                   EVLALQNENCHLQLMLSEKGSEVELLKSKVGQLQQRLDELLLSNNSAMTGNVPLSDLYL
FT                   KPDEDEVMTHFSGSPYRGSRPFSHSTKHSAVSVTSNSRHMSYLFVSRQLVPYMREAISI
FT                   FERSDLFSGQALKARRAFVKAIDGALSAVPQFDDLVDVLDELTILQRNAIVCLNRELEY
FT                   KKVSQQLEYLATIFRDPKECGLRTEDYVEHLRKQLIEVITNIHSTMPLLDPACYSSVPT
FT                   ENTTSDPLRHDATDVTPSESLLPDDTDRSPPMMPHQQCENTPAPRTPHPTFRTMLPIAA
FT                   HRTAPSALPELFKRTRPPKLAGTHTSPQLRRGPSASNNYVQALSDLKLTMPARRTPKEP
FT                   LEFIPIGFDGRLSGAQTPSRLTSPRKLGKVVLTPLTWSRDGCDDYVSGDPLEQFYAERV
FT                   SGTDLEDTRTTITGFNSI"
FT   CDS_pept        650834..652633
FT                   /codon_start=1
FT                   /gene_family="HOG000184670" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752401"
FT                   /locus_tag="AGOS_ADL028W"
FT                   /product="ADL028Wp"
FT                   /protein_id="AAS51893.2"
FT                   /db_xref="HOGENOM:HBG058680"
FT                   /db_xref="InterPro:IPR022043"
FT                   /db_xref="UniParc:UPI0001DB28E7"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AE5"
FT                   /transl_table=1
FT                   /translation="MHNTQAASPNQDVLPFFQGETAVKEDNIERDEDQLVTKRSSPARD
FT                   ASVCEVQCVDIGSDEDAGAIDIIEVDTKENDAVEAADCVTVLEEAPAEQKPGAPLGENR
FT                   KTRSKGAVKESSKAKKQATKEQLELKKRQEREERELKKLRDKEERELKKLREKEERELK
FT                   KLREKEERELKRQKEKEERELKKLREKEERELKRQKEKEERELKKQLEKEERERKEEEK
FT                   QKKTEAKERAQLRIGSFFKKTVISKSLDDSKSDYDRAFLPFYIKRDVKVAGLHQLDRGK
FT                   LQDSEAAIDKRLHDAAAPQDTLDWLASVRPPKCGYEIRCTAVEVLQKMTAKQKTDEELQ
FT                   TLLGQVPHKYIKFYENIRPPYIGTYSKNVTLPRCNPFSTEETGFNYDYDSDLDWINDED
FT                   EEGGDVDDLEADDDDDDDDDDEQDQGDEHEFDGFLDSDDDSGSTSKKSFAGPLIPVVHL
FT                   VRDFDNLKADEQQYFNMLAVQYLIEAQPFPIDPNYAPNKRPPPRGVCESTTSPEHGQAQ
FT                   KKAKSLISEPKDLLKLLDEVHESTFSLGTISEIVQKHVPHYSKETIKNTVKHYAARSSG
FT                   KGNTSRKWQVIDVEGWEQLKVNR"
FT   CDS_pept        652822..653832
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15752402"
FT                   /locus_tag="ADL027W"
FT                   /orf_name="AGOS_ADL027W"
FT                   /product="ADL027Wp"
FT                   /protein_id="AAS51894.1"
FT                   /db_xref="HOGENOM:HBG058681"
FT                   /db_xref="UniParc:UPI0000252A5C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AE4"
FT                   /transl_table=1
FT                   /translation="MSLYDQRSLSSQRTSISQNHGFWNELYNATVGSLFELSTVVTARA
FT                   GALRKNFWDDFTNYRNYLYPIRGFCEFLKWPRYWGFGLIVGFCYALLFIMLTALYFTFL
FT                   LPILSAWQVVLLGPIGMVISIIQMVLQCNMWTVRGVKWFVLPVIKEDLFDTYLRRKGYG
FT                   RLLNTLKQRSFPVVPTYRKNHLEFWIYQIPLQVFLFVCSVTLTIFIIALSMVPIIGPTF
FT                   ATILLSPRRSFNYYNTWMNQLRMTRQMKCDSYYEKLGQHMAFGLSCGFFELFPVLSIIG
FT                   ICSNVISTALVVEDEIDQRRIALDSAELASIATTSTTESSSQTSQTTGTSSTSSS"
FT   CDS_pept        654128..656794
FT                   /codon_start=1
FT                   /gene_family="HOG000224127" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775849"
FT                   /locus_tag="AGOS_ADL026W"
FT                   /product="ADL026Wp"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /biological_process="DNA-dependent DNA replication
FT                   initiation"
FT                   /protein_id="AAS51895.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006270"
FT                   /db_xref="HOGENOM:HBG409874"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR008047"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="UniParc:UPI0001DB28E8"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AE3"
FT                   /transl_table=1
FT                   /translation="MTSSPSRPQEASSPALFYNPSSSSQPDTYERGQQNAGNMIGSSPF
FT                   HYPSSSQSQQNTRSNRGGAFSSQGVPRSERSYAGSSLPGTARTRLQHYGRSDIHASDLS
FT                   SPRRMVNFNSPSTLSSSDPPSENDEPMRIIWGTNVSIQEVACTFKNFLMTFKYKYRKIK
FT                   DEQELFINETTDEELYYVNQLHQMRQLGTCNLNLDVRNLISFPGTEKLYHQLLNYPQEV
FT                   ISIMDQAVKDCMVQLAVDIDGAEGNENLIEVESKIYKIRPYNLDSERGMRELNPNDIDK
FT                   LVSIKGLVLRSTPVIPDMKLAFFKCSVCDHTTAVEIDRGIIQEPLRCPRVACNQRNSMS
FT                   LIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCIYDELVDSCRAGDRIEVTGIFRSI
FT                   PIRANQRQRALKSLYKTYLDVVHVRKVSARRLDIDTSTVEQQILQNQMDNVEELRKVTD
FT                   EDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGILLQLFGGTNKTFTKGGRYRGDI
FT                   NILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGAL
FT                   VLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISVAKAGIITTLNARTSILASANPIGS
FT                   RYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELAKHLTSLYLEDKPAHVSES
FT                   DILPVHFLTMYINYAKQHIHPVITEGAKTELVRAYVNMRSMGDDSRADEKRITATTRQL
FT                   ESMIRLSEAHAKVRLSQQVEVSDVQEAVRLIKSAIKDYAIDPKTGKIDMNLIQTGKSVI
FT                   QRKLQEDLAREIVRLLTERSADVITYNELARLLNENSQDRLDNMTISDALNRLQQEDKI
FT                   VVLGDGVRRSIRLNGRV"
FT   CDS_pept        657167..657526
FT                   /codon_start=1
FT                   /gene_family="HOG000246804" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15753453"
FT                   /locus_tag="ADL025W"
FT                   /orf_name="AGOS_ADL025W"
FT                   /product="ADL025Wp"
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="mitochondrial proton-transporting ATP
FT                   synthase complex, coupling factor F(o)"
FT                   /protein_id="AAS51896.1"
FT                   /db_xref="GO:0000276"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="HOGENOM:HBG191494"
FT                   /db_xref="HOGENOM:HBG395565"
FT                   /db_xref="InterPro:IPR006808"
FT                   /db_xref="UniParc:UPI0000252A5E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AE2"
FT                   /transl_table=1
FT                   /translation="MASRVQAFINCASQKASFFVSKTVYCGKVAGELTKTVYFKEGLQP
FT                   PNISDFEMVYWRLLKQFKNAAAHPQQTLASVKSLGKNDLVKYGAVGVQMLGLYSLGEAI
FT                   GRRHLVGYTNYSSHH"
FT   CDS_pept        complement(657744..659453)
FT                   /codon_start=1
FT                   /gene_family="HOG000242486" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775850"
FT                   /gene_name="ROK1"
FT                   /locus_tag="ADL024C"
FT                   /product="ATP-dependent RNA helicase ROK1 "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="AAS51897.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0000252A5F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AE1"
FT                   /transl_table=1
FT                   /translation="MDIFRVLTRGASVKKDGKQVDFSRVQSQRTARPGQRGKDEDEEQL
FT                   SRELDFFRTRRSVPAAAERPAEETGDAHRDETEQDEGAEDVAPPPRITTAEEASQLRRS
FT                   YRGKVTGADAPLPIGSFEDLVTRFKLDKRLLSNLIENNFTEPTPIQCEAIPISLQNRDI
FT                   VACAPTGSGKTLAFLIPLLQQVISDKAVGTGVKGLIISPTKELANQIFDECSKLAQRIF
FT                   LEKKRPLSVALLSKSLAAKLKNQIVSDKKYDIIISTPLRLIDIVKSESLDLSAVKYLIF
FT                   DEADKLFDKTFVEQTDDILSACSHPNISKVLFSATLPSSVEELAQSIMTDPVRVIIGHK
FT                   EAANTNIEQKLVFCGNEEGKLVAIRQLIQEGMFRPPVIIFLESITRAKALFHELLYDKL
FT                   NVDVIHAERTQVQREKIIERFKSGDLWCLICTDVLARGIDFKGINLVINYDVPRSAQAY
FT                   VHRIGRTGRGGRKGTAVTFFTKQDAIAVKPIVNVMKQSGCEVAAWMENIAKMTKREKEM
FT                   IKKGKAFVDRKQISTVPKILKQKKRQQKEMIEASKKRKLAQQAGDASEEEHA"
FT   CDS_pept        659739..660425
FT                   /codon_start=1
FT                   /gene_family="HOG000246803" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15753454"
FT                   /locus_tag="ADL023W"
FT                   /orf_name="AGOS_ADL023W"
FT                   /product="ADL023Wp"
FT                   /function="RNA binding"
FT                   /function="ribonuclease III activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="AAS51898.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004525"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG058682"
FT                   /db_xref="HOGENOM:HBG202536"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="UniParc:UPI0000252A60"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AE0"
FT                   /transl_table=1
FT                   /translation="MLCSKISIGTRQSTRHASYIVNGIKVRGLKNPNEDLKNPAGLHYN
FT                   EVDPARHQAKFKQAFNLDKYGLQIPDDILLQCLTHKSFANSAKPYNEKLSLLGGQLLKW
FT                   YASALTVQQPGAAGVQQKPVNGLNVANLGHEPYTLWTDSKVISEHMRTRDVDDLIFWNK
FT                   RDSRATEKFNGLPKVRTTVLQALIGSSLTFNGEEKTAKFVLEELMDSNNANSLPSLALQ
FT                   MAELKA"
FT   CDS_pept        complement(660801..670979)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18080123"
FT                   /locus_tag="AGOS_ADL022C"
FT                   /product="ADL022Cp"
FT                   /protein_id="AAS51899.2"
FT                   /db_xref="HOGENOM:HBG058684"
FT                   /db_xref="InterPro:IPR013724"
FT                   /db_xref="UniParc:UPI0001DB2901"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AD9"
FT                   /transl_table=1
FT                   /translation="MGEENQELRGGQAGQVYGYYVALRQFCDVTGNSQDRSTSTRAQKA
FT                   RAKLLKLSPAQFFELSTDVHDELQRRIDETQEQPDHLLPKDHFHVKRNQARQKLANLSQ
FT                   TRFNDLVDDILYEIQRRGYHLRKPEHGSNATRGSPHHTRQSVPHSGSEASPSKAQSPSA
FT                   SLRGQDTAADSRKSDKSSSASGQVPMLVAPNTSVQTSQVIPKTASIDWSSDEEEVAAAT
FT                   KRVSRLKHMSKVMISTEDGTVVSPKHGSPGSYSARHSSPKSALLKQASPKLASKHSSPK
FT                   HGSKSASPKHPSPKSLSIASTPSHKSVALMDTTSISPTSPLHQRTSSASRQALSAVLGR
FT                   DKDRDIVLLLEEGNKLEAKLMQITEENKSLEQKSDELAGQVTQLLSEKEILTEQVLDLH
FT                   TKLEESEKTVTDLSEEVVKLREKADAGVVLQQQISALTNQVNELTFENEALTQKNLTLT
FT                   TQLADQDATVGRSMGDSFKEKLSALNSQLEELITQNQTLKLSKAELAAKLSKQQDIIAS
FT                   RSVDDNFQKQMSVLTNQLNDLSIENETLKQSNAELTLKLKRISNITASPLNIFIPSSSK
FT                   STNVAIESISKFISPEGSIPLPLIKSFNSKLELVFKHLNQGEQTGNVLFEDIAQVSEVV
FT                   EHMLNLVSPSDYQQATLLLKAATSHAITTIRYYAAYPTILPVFTAESALTNISFAVCKL
FT                   VAVAGIKQGSYDELPITPLTKVAHDEISQSNASNDGLDMSNTSHAASNFDSNDDMSTVK
FT                   PLRITQKVNSALFTPPKEKPLMPRRPSGTSLISSIITSEKKEANRNRNKLNLSIPTDSS
FT                   SAVPSRRGSVSSNMGNSVSPERELSDTNTIHTNPGNPTDASDGNTQRLMKNKPFDTVAG
FT                   QNPGGSALPSNIGKTKPTSFLSLGKGYQQSSDSFVTAPEDNKESPTIKPGNSDSRTRSN
FT                   LTLEPINFGSPQQKAEIDGLAANLTMNNDSHQEMLPDSGEVATRSLQASGKQALSSIPV
FT                   ASSAFSSPRSLTDSDKSDLNVTPKGVSPKVLPHTSTIQPKELNSGNDGISPSKSPGVEL
FT                   LEPISKQGDAASLSHSEKDDIGLSSLDTGKQSRNLGKLMKMSSDLSEVSSKHYSIESTE
FT                   SARSNSTPASSKKSASTPTSPISSVNRHMQTPSGVHSYSPSHVIATVTPERRVFNGFTE
FT                   DSYDDNSSDDGSANTMVSDDDSTYQALKNSMRRNRAASPGSLVSAQNLAKMQQTSVADN
FT                   NLKPGDTPIVDTLGGSPFNFETSSGFNGTPQTMAEAMSVTPLETNFPNTVVYDKGFTTN
FT                   SYHIKPTTYAPDMVSNFAYQKKDQHMDQSIEITEEHIDHPARSEFSSSASSSVKQASPL
FT                   TPQKVRLPGSNTGTISKRPLQLDSPIDEQQDTMPLQIGNTRQLHNAVSSPTSDSTVSTE
FT                   EPYSANPEVFSPMRGEGFLLNSAFSVTPLGVDATSNSKPPFSAVSSSGASVRRVRLGST
FT                   KRPHATAIQPVIDDARMSESSENERGIMSSGGSSNYTGIHSTPAALTSREQTPKSQTFG
FT                   KSGLSPVPDQISTKALVFGVAAQASPDAQKRVINLQSRTSPPKSETHSHIRHNASSVYQ
FT                   SETTDNITKDTGMFSAVKSGFPHIQQKTISAGSELDDTDFQRTQTTSTGPLPTSSEYDS
FT                   APVTVHGGLDISPRPPSSSSTDFDEYPTGTITESHRRPYNVSQLPENNGNSAATRVIKR
FT                   NSSVLSSPGSVTTTPMVNRATVLSASPGAVKLTEKQHSPASSSDISTANKTHSNSIDLN
FT                   TTPNVPHHSPVINVMRSITEETRNKRSSFSSSMHSDNIDGETLSKDAINMADTLHGDNA
FT                   HSTPSSFAMSSLHSTPTVYAQPRNQDHAAMKPSEGPQFKKFEADAHYSSVMSSKKEGSV
FT                   KEKDYRIALKNESADDRRAVEFSKSISGSSLQSDKQNIPIRKELHLTFEEQNDNTHASS
FT                   DLTLEVLQDAQTRDTGSLTNNLAHTPLNTRTEAGEIPSAFETFIEESQTRKRYSIESHE
FT                   ISTDHGKLDFTRGLPARSEVISPGGLTTLGDFKPTAHGEVQSIAHDQVNNFTEGSTVHD
FT                   EANATEGSYAFDKLKHSEGSPARGELKSTIHGELNSAPLGELKSTARTEAISTDSSPAR
FT                   EVVISTGTSPVRNEVNATEDSTASAQVKLTSNGELKSPVRHEAISTGTSPARAEVHSTE
FT                   DLPACDPVKSTARGEVISARVSPANIDVISTGSLPDHDEVISTGTSPALGEMISTGSSP
FT                   ARGDAVHDESKTAAPTQLISTGVSPALGEVKSVAHDGSRPTARTQVISTGVSPARGDAI
FT                   SAGSSPARGEVKSVAHESRPTARTQVISTGVSPARGDVISTGSSPARTQVISTGVSPAR
FT                   GEVTSVTHNESRPTARTQAISTGVSPADSDVISTGSSPARGEVKSVAHDGSRPTARTQV
FT                   ISTGSSPARGDVISTGSSPARGEVTSVAHNESRPTARTQLISTGVSPARGDAISAGSSP
FT                   ARTQVISTGVSPARGDAISAGSSPARGEVTSVAHNESRPTARTQAISTGVSPADSDVIS
FT                   AGSSPARTQVISTGLSPARGEVESVAHDGSKTTAYTQVISTGVSPARGGVTSVAHDELK
FT                   FTGSLSARNEVKFTEDLPAIGAAKSIVRDEMKSTEGSASQVEMVSIGSSPARGELKSTA
FT                   RDNAVSTRSSPASGEAKSTPRSELMSTGGSPAPGKLTSTPRHAAVSARSSPARGEAKST
FT                   PRSELVSIGGSPAPGRLTSTVRGEVKSTTRVEAKSTPRHAAVSARSSPACGEAKPTSRN
FT                   ELISTGVSPAHGEIKSTAHDAVISTGDLPDCDEVKSTEGSDAHREVKLTAPSELKSTAH
FT                   DEEKSSGCSPPRGEVTSTDRGTQKPNLLDELKYNGGFHVRGELKSTGGSTTHEVCEDLP
FT                   TVRVSTDREHDFNPPSTTIASPDFTPSNVAMENVPAMTANSLPGTTSNTNDIAKDSMAD
FT                   SADFQRKVEVKLSTYQDPQMEHTPVKTTFGSPQTASREPLSIPTEHHVTPMKRHVSQYD
FT                   DNNESEFSKSGESRVFLHDGGIIPQEKLPSTRLNTVGDLEGKVSVSKAPAGISTTPIYS
FT                   EGVTNSENIVDDSTAEKDNKSSHSRIIGKPSSLEEPKDDHPLPKSTSSGETTNIGKDRT
FT                   AVGDNQQHEHIRNTTIPKDSPAIKHGNAAKTYENDSNISRTASHSMKLNARPSAAPLIL
FT                   KTNNNHAPLSREAELPRKTTTYEPETPRIDFYGTPTSANSTYTDQSDDYDDDGEIDFNV
FT                   DDFDIENPDNTLAELLLYLEHQTIDVISTIQSLLTGIKQPKATTGVLRRESNAINQVIG
FT                   QMAGATSVSMNQSRNAALKEHGNWVVQSLVDCRRRITVLCNLRPDGILVADERDDHFAD
FT                   KHFKQRLAGVAFDVAKCTKELVKTVEEASLKEEIEYLNSKLAK"
FT   tRNA            671607..671679
FT                   /gene_name="tRNA-Thr"
FT   CDS_pept        671894..673282
FT                   /codon_start=1
FT                   /gene_family="HOG000164982" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20623355"
FT                   /locus_tag="AGOS_ADL021W"
FT                   /product="ADL021Wp"
FT                   /function="catalytic activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="AAS51900.2"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG056738"
FT                   /db_xref="InterPro:IPR004886"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0001DB2902"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AD8"
FT                   /transl_table=1
FT                   /translation="MRLGANLAAVTLALAVANAASDSSSSSMAPIEVRGNAFFKKGSDK
FT                   RFYIRGVDYQPGGTGELVDPLADTEICKRDVENFKELGLNAIRVYTVDNTKDHDECMKM
FT                   LADAGIYLILDVNTPKASISRFNTECSYNANYLQHVFATVDAFQKYDNLLGFFAGNEVI
FT                   NDKDTTETAPYVKAVVRDMKKYMKAKKYRKIPVGYSAADVAENRVLAAQYFNCGDDEDA
FT                   RIDMLGVNDYSWCGSKTFRTSGYSEKMNLYEGYSVPIFLSEYGCNTMPGAREFGEVSSI
FT                   FSEKMSSLFSGGLAFEYSMEGNNFGLVEIKGGKVKKLEDFENLKKQYAEAKDPEGDAGY
FT                   SKDGKPASCPPYDKGTWDADTKLPEMPKDAEAFFKGKTPKPNSLDLETQSNCGGLKDSG
FT                   DSSAKGGSSSSASSASSGATATAKAESSSSAAPESSSSAAGAYNAARVPLAFYWVLGAA
FT                   SYLI"
FT   CDS_pept        674470..675570
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928860"
FT                   /locus_tag="AGOS_ADL020W"
FT                   /product="ADL020Wp"
FT                   /protein_id="AAS51901.2"
FT                   /db_xref="HOGENOM:HBG058685"
FT                   /db_xref="InterPro:IPR002889"
FT                   /db_xref="UniParc:UPI0001DB2903"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AD7"
FT                   /transl_table=1
FT                   /translation="MRLGVMTRRNMSMHDQILWWVSLALSTFVVLGTDLSSNEHFGEWI
FT                   NLKDAGEMGCFAQLPSSFTKKKLDGQTSYTCFLECREVGTRYMALFNRDYCLCGNSRPD
FT                   GAKSESCNLGCKQYPGENCGGPNAYFVYNIAPDKNGESSSALASSSTQGAASSSTTDPA
FT                   GAGGKNPTTTNGERPDATPTTKAEGATTPTVAPSAAVTTTPAAAGGNTLTTEVIATTLR
FT                   VTNSAGVYQTTVTAVASSTPSSDSAPEPEHKKKGPPTSTLVGAIVGSLVGLLFLIFLLI
FT                   YFLRRMYARREQERMEKEYQEAIKPVDYEEAMYMTPTLPEGKELERSETTKLNPFDDTR
FT                   RISTGSLIDSSPVTANHILTVVNPDQ"
FT   CDS_pept        676253..677980
FT                   /codon_start=1
FT                   /gene_family="HOG000209704" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15753455"
FT                   /locus_tag="AGOS_ADL019W"
FT                   /product="ADL019Wp"
FT                   /protein_id="AAS51902.2"
FT                   /db_xref="HOGENOM:HBG174756"
FT                   /db_xref="InterPro:IPR018810"
FT                   /db_xref="UniParc:UPI0001DB2904"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AD6"
FT                   /transl_table=1
FT                   /translation="MSVLTDSPDEQELAVVPYDEVEILNYFTDVRNLLSRLKQDRNQYL
FT                   NSRDVMATYQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLL
FT                   SLSFLTVGLKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNS
FT                   YMSMVEDEAPLDELAEEKRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSD
FT                   KLFHIRRELLSLAASAKTDRAAGEGSTERSTTPASPNTLASRLKDLESMILEVESHRDD
FT                   SGKFISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQPIYEELLEI
FT                   KTTLENLLVTRRWTLRETDLFAYQKRLAELDNLRVNRKSPSSSSASKGQALILYLLRRC
FT                   YATIYKLLESSEPVSESLQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQMKLASLDN
FT                   MRVDGKFYDADGNIPEGQGTLNALLAECFDILHEMKIEAEVREEQLPQVNEDDAGEYNS
FT                   SPCIEMTKDPTDRDVAADTSSTSRYLSVQAADNDDNDDLSAHYSEHSYEEEETRNTYD"
FT   CDS_pept        678655..679389
FT                   /codon_start=1
FT                   /gene_family="HOG000022344" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15753456"
FT                   /locus_tag="ADL018W"
FT                   /orf_name="AGOS_ADL018W"
FT                   /product="ADL018Wp"
FT                   /function="antioxidant activity"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="AAS51903.1"
FT                   /db_xref="GO:0016209"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG491141"
FT                   /db_xref="HOGENOM:HBG493509"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI0000252A65"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AD5"
FT                   /transl_table=1
FT                   /translation="MATELRRSTRLATRKASDASEYAESKLPLTKRVRKAPKTDAPKKV
FT                   ATDAPKKVVTEAPKKEAGAAKKVETPKKAAAAEASTGPGGELQVGDVLPEITLKNQDQA
FT                   DVKLSDVVKKNKIVVLFAYPKASTPGCTRQACGFRDNYQELQKHAVVFGISADSVKSQK
FT                   SFQQKQKLPFDLLSDPKRELIGALGARKTAQTGVIRSHWVFVDGKLGSKRIKISPEMSI
FT                   ADGLSEVLLFAKKSLAGNPGKT"
FT   CDS_pept        complement(679547..680878)
FT                   /codon_start=1
FT                   /gene_family="HOG000173247" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15753457"
FT                   /locus_tag="ADL017C"
FT                   /orf_name="AGOS_ADL017C"
FT                   /product="ADL017Cp"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="clathrin adaptor complex"
FT                   /protein_id="AAS51904.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="HOGENOM:HBG058183"
FT                   /db_xref="HOGENOM:HBG525531"
FT                   /db_xref="InterPro:IPR001392"
FT                   /db_xref="InterPro:IPR008968"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR018240"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniParc:UPI0000252A66"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AD4"
FT                   /transl_table=1
FT                   /translation="MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSV
FT                   LPPCFSFNGVQYLFIQHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESI
FT                   KDNFVIIYELLDEMMDHGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNS
FT                   VSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLN
FT                   DKGIFAQGDDDDDEEGASGGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFE
FT                   LMSYRLSTPIKPLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADS
FT                   PKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAAEMGLPSVSDNSDHKLKRPVQIKF
FT                   QIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYTIRM"
FT   CDS_pept        join(complement(681377..681661),complement(681052..681375))
FT                   /codon_start=1
FT                   /gene_family="HOG000112404" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /ribosomal_slippage
FT                   /gene_id="IGI15753458"
FT                   /gene_name="EST3"
FT                   /locus_tag="ADL016C"
FT                   /orf_name="AGOS_ADL016C"
FT                   /product="Telomere replication protein EST3 "
FT                   /function="telomeric DNA binding"
FT                   /biological_process="DNA duplex unwinding"
FT                   /biological_process="telomere maintenance via telomerase "
FT                   /cellular_component="chromosome, telomeric region "
FT                   /cellular_component="telomerase holoenzyme complex "
FT                   /protein_id="AAS51905.1"
FT                   /db_xref="GO:0000781"
FT                   /db_xref="GO:0005697"
FT                   /db_xref="GO:0007004"
FT                   /db_xref="GO:0032508"
FT                   /db_xref="GO:0042162"
FT                   /db_xref="HOGENOM:HBG058686"
FT                   /db_xref="HOGENOM:HBG202999"
FT                   /db_xref="InterPro:IPR019437"
FT                   /db_xref="UniParc:UPI0000252A67"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AD3"
FT                   /transl_table=1
FT                   /translation="MPKVVLASRAHKADSIFLREWLVDAVVPALERSGACAPWAGVECF
FT                   IPALPPATATLSLEPTVIQNPKRFLRIVRFTRVHDFAVCAVARDAGCCILVEFTPHCVS
FT                   NFERRYHQRITSSTVNSLFVIGNTSLLFYARSDAAAAFEVPALMNGSSTLPVLRVGDCA
FT                   IFDQDQVESHRRFPLVQEHPRFVQSLDMAMQGSVLSRYT"
FT   tRNA            complement(681741..681812)
FT                   /gene_name="tRNA-Asp"
FT   CDS_pept        complement(682324..684060)
FT                   /codon_start=1
FT                   /gene_family="HOG000110941" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775851"
FT                   /locus_tag="ADL015C"
FT                   /orf_name="AGOS_ADL015C"
FT                   /product="ADL015Cp"
FT                   /function="2-isopropylmalate synthase activity "
FT                   /biological_process="leucine biosynthetic process "
FT                   /protein_id="AAS51906.1"
FT                   /db_xref="GO:0003852"
FT                   /db_xref="GO:0009098"
FT                   /db_xref="HOGENOM:HBG000329"
FT                   /db_xref="HOGENOM:HBG289752"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0000252A68"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AD2"
FT                   /transl_table=1
FT                   /translation="MPYYSDPSAKYKPFVNSVKLTNRQWPSRTIEKAPRWLATDLRDGN
FT                   QSLPDPMSFDEKKLMLNKLVEMGYKEIEVAFPSASNIDFEFTQYAVKAVPDDVYVQVLS
FT                   PCREELISRTIESLRGARNAIVHIYLATSACFRNVVFGKMTEEESIKKAAACTALVRKL
FT                   TKDDPSQQGTNWMFEFSPETFSDTEPEFVIKICEAVKEAWGPSKDVPIIFNLPATVEVA
FT                   TPNIFADQVEYFATHISEREKVCISLHPHNDRGCAVAAAELAQMAGADRVEGCLFGNGE
FT                   RTGNVDLVTLGLNLYTQGVSPNIDFSDMSSIIDVVEKCNKISVHPRAPYGGQLVVCAFS
FT                   GSHQDAIKKGFSQYEKDLVTAQEKHGPEAVVPWKVPYLPLDPGDIGRTYEAIIRVNSQS
FT                   GKGGASWIILKNMGLDLPRGLQVDFSRVVQRETENLQRELKCQELIDLFAGEYFLSTPC
FT                   DSQIRLVDYDFSRHQGVCSLKVQISVNNETRDMEGTGNGPISCFVNAVNSAVGANLNVN
FT                   DYHEHSLGNRSNSQAATYISLESDQALQWGVGIHEDVTEASFLCLISCINGLRRSGSFS
FT                   FF"
FT   tRNA            complement(684281..684352)
FT                   /gene_name="tRNA-Arg"
FT   CDS_pept        684547..684849
FT                   /codon_start=1
FT                   /gene_family="HOG000280990" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18080124"
FT                   /gene_name="URM1"
FT                   /locus_tag="ADL014W"
FT                   /product="Ubiquitin-related modifier 1 "
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS51907.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="HOGENOM:HBG016930"
FT                   /db_xref="HOGENOM:HBG314915"
FT                   /db_xref="HSSP:2AX5"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR015221"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniParc:UPI0000252A69"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AD1"
FT                   /transl_table=1
FT                   /translation="MVQVQVEFLGGLDVIFSKQRKHQVSVEGANGSVTVGDLIDYIVSN
FT                   MIQKQKDVSVFLEDNTIRPGILTLINDTDWELEGEKEYVLEDGDIVSFTSTLHGG"
FT   CDS_pept        complement(684942..685598)
FT                   /codon_start=1
FT                   /gene_family="HOG000216665" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928861"
FT                   /locus_tag="ADL013C"
FT                   /orf_name="AGOS_ADL013C"
FT                   /product="ADL013Cp"
FT                   /protein_id="AAS51908.1"
FT                   /db_xref="HOGENOM:HBG073698"
FT                   /db_xref="HOGENOM:HBG395648"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="UniParc:UPI0000252A6A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AD0"
FT                   /transl_table=1
FT                   /translation="MSEFDAIVGDLNRLTLDPSIRTQIETIKTLSLAELFALKKTVEDE
FT                   LGRLFDLLQNTHKCDLTNPLVTPDGFPRSDVDIVQVRILRRNINMLRNDLKAIIDHCNN
FT                   VMSPEFQSKRAEQPASRHGVSYELKIPFAVVTELTVDSPSSRAGILVGDKIVKVGNIHA
FT                   GNHQKLSAVGMTVRQSKDKQLSIRVLRKDGAFYDLTLTPSEWAGPGLLGCRLSEL"
FT   CDS_pept        complement(685825..686802)
FT                   /codon_start=1
FT                   /gene_family="HOG000111170" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775852"
FT                   /locus_tag="AGOS_ADL012C"
FT                   /product="ADL012Cp"
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="AAS51909.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG058688"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniParc:UPI0001DB2905"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AC9"
FT                   /transl_table=1
FT                   /translation="MPANDLNSAISMFEMNAGTPGAGAAVAPCSAPVAAYHMGVTPAEQ
FT                   HEALQSSSSTSSSDSSILLGELVFEKFACADNLDHEALAKLERSMPMFSESKSSTDLDS
FT                   AVENFFGSSSDSTPLFEFEGLGKTADPKTWSSLFDDDIPVTLEDVGAVEPISAAAGTES
FT                   CFLPTPIIEDAVLKPPKRSLTKRDADSVPASKSASPVSISSNISSPALNGCTSASATSR
FT                   RRSSVMKSEKYDHLGVITYNRKQRATPLTPVVPESDDPVALKRARNTEAARRSRARKLE
FT                   RMNQLEERVEQLLQKNSELEAEVARLRSLVPSSEQPKYTSRAGN"
FT   CDS_pept        689719..690168
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15753459"
FT                   /locus_tag="AGOS_ADL011W"
FT                   /product="ADL011Wp"
FT                   /protein_id="AAS51910.2"
FT                   /db_xref="HOGENOM:HBG058689"
FT                   /db_xref="UniParc:UPI0001DB2906"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AC8"
FT                   /transl_table=1
FT                   /translation="MMSRSDTSYSARERVTRSVTLSVAVCKRRWAEITPSARRVPVWTS
FT                   LCLFFGIIFGFIFSSLFWYIRDRIRYVSHPTYSTGSPLPQRTGSADGTQDLAQKLVGTV
FT                   KDECWSREVVKQEHAYVPLGKQGPIKRRWFPSSRLSTLSPFITWS"
FT   CDS_pept        690994..692637
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15753460"
FT                   /locus_tag="ADL010W"
FT                   /orf_name="AGOS_ADL010W"
FT                   /product="ADL010Wp"
FT                   /protein_id="AAS51911.1"
FT                   /db_xref="HOGENOM:HBG058690"
FT                   /db_xref="InterPro:IPR018608"
FT                   /db_xref="UniParc:UPI0000252A6D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AC7"
FT                   /transl_table=1
FT                   /translation="MEVSPSYHGYIETNTDALLLAQAILDGKLKPVSRRPYEIERPQLI
FT                   ISGNVFVFIEEKSGIKRWTDGVSWSPSRIMGKFLVYRELDKQNSSLLQGHAGQSGRRKN
FT                   SDVAEPLQEDQRNPVSKALVGSLNSSYAFKPGGLVKKTMSLKLKRASHVETIHIISYYT
FT                   AEDVESGKLLKPSGTPFFKQLQPCRELILALDSSSVGNSRNASSNMGSSNQVVNVSNVP
FT                   VLPLCTQLPGAAVSSYINPPIVQPIVNQSGYQGLGQLTTHHHHQHHHHHHQQLSQASLQ
FT                   GQAHNPFYSHNYYPGSSQHNPNAPLYHSYSYYTQNNPNMHLSPDHQHLSLNKPHDHQHQ
FT                   QQPQQPQEQVAQRRPHTGSAASATDISQLANASVASAPSSLSATSSPPHGQFAALPLPG
FT                   SLFAADQQKQTGIQLPLPFPQGSSASAPPSASALRQPPPQQHAPICPKGTAAGYAPYPG
FT                   YNMQQYVQTPPIYPVSRYGISSAAQLSFAPHMVSPSAQISPLPQQVYAYPLQHENPPSR
FT                   GSASGTHTTVNADTLLNFTGRKTMHGKERK"
FT   CDS_pept        693536..694675
FT                   /codon_start=1
FT                   /gene_family="HOG000188210" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15753461"
FT                   /locus_tag="ADL009W"
FT                   /orf_name="AGOS_ADL009W"
FT                   /product="ADL009Wp"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS51912.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0000252A6E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AC6"
FT                   /transl_table=1
FT                   /translation="MDVDAGGAPPLELAQERLVAGRRGAEGGGNVVSAEDIVAPDCSTP
FT                   LSSAEVLEELIGGGGTAGSGGSGRGLRGTGSALQLLDDTQVTAVSGALAGFVSGIMVCP
FT                   LDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGLYKGLAPIVLGYFPTWMLYFS
FT                   VYEKCKQRYPSYLPGGFVSHAASALTAGAISTALTNPIWVVKTRLMIQSDVSRDSTNYR
FT                   STLDAFRKMYRSEGLKVFYSGLVPSLFGLFHVAIHFPVYEKLKIWLHRNTPAADGQRLD
FT                   HNKLQLDRLIVASCLSKVVASVITYPHEILRTRMQVRHSGVPPSLLNLLGRIRASEGYV
FT                   GFYSGFATNLVRTVPASVITLVSFEYFRKYLRMWNEGLM"
FT   CDS_pept        694966..697053
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775853"
FT                   /locus_tag="ADL008W"
FT                   /orf_name="AGOS_ADL008W"
FT                   /product="ADL008Wp"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="AAS51913.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG123879"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI0000252A6F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AC5"
FT                   /transl_table=1
FT                   /translation="MWVTLRVCIYVSLFAGRVFSASVGTPATEPAGEQEKMPEPLTSVD
FT                   FSSTMSTGLHMVEFYSPLCHHCKLFAPTWEKTWKEFHKKGARMGISMAQVECLQSGDLC
FT                   KQENVVSYPSIRLYGPAGYIKDYPHMERDQESLVQFMMAEARNKNNMELMGLESKSEPL
FT                   NKKRFNQLLEAGVESPTLISFWPAPEVADITKVTQFRNCRYCAAFRNTWKLLSNRADTE
FT                   GISTFHFSCYLNGDLCRKVGLERLTKRSGDGEKIPALALLLPNVDSLIFYERDSYAFED
FT                   FLDFVLRSYSNYLAPHISPEEVAKMLLTVPKVSDISEGFAGKTILLYNPAPTTNAEKDG
FT                   KLLHSLLRELDGIPNVYIYKFEGRLKKNIDRMLDRIYTTLLERASQELVGLNKELFHLR
FT                   TLSVGDPLFIMFKECSRTPIALQNQVDQEDISSRAIQWIKENSYPYLRDFTRTSGKPLL
FT                   KGKDSPRKPVVIQVLDTSNEQEVKSSKNIKGFFDVISKFEGTWDEYVYKGLSRLYGDKA
FT                   ILKIVNGNDKTETAFLSEINEKLTENYNGVLYGYIDKSSKKALKRLGLNVHDYELENGD
FT                   VLIVDEKGKFYYAKGLDGSRMTVHSPEHVVDAIRALVFPESGKSRNDLRRFLVGSPFGP
FT                   RWRFFEHIHQYGFLGWFLLIVAVFFALRLPRIYKKYVQRKKYAARHDTMGILGKEGAFP
FT                   E"
FT   CDS_pept        complement(697157..697564)
FT                   /codon_start=1
FT                   /gene_family="HOG000209281" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20623356"
FT                   /locus_tag="ADL007C"
FT                   /orf_name="AGOS_ADL007C"
FT                   /product="ADL007Cp"
FT                   /protein_id="AAS51914.1"
FT                   /db_xref="HOGENOM:HBG333022"
FT                   /db_xref="HOGENOM:HBG498724"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="UniParc:UPI0000252A70"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AC4"
FT                   /transl_table=1
FT                   /translation="MSSRFDHNTAHQRTQLFGPNYGKPVKRSSSPFSNPSIDYSQSTLA
FT                   QLESQSDADVGVMREKIMALKTLSERMGEEIRGSSKTLDSLGSTFDATANKLKRTYKKM
FT                   MVMASKSRISVKVWLAIFFGFGVLFFYVWVR"
FT   CDS_pept        697707..698645
FT                   /codon_start=1
FT                   /gene_family="HOG000079916" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20623357"
FT                   /gene_name="CFD1"
FT                   /locus_tag="ADL006W"
FT                   /product="Cytosolic Fe-S cluster assembly factor CFD1 "
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="ATP binding"
FT                   /function="metal ion binding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS51915.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="HOGENOM:HBG411641"
FT                   /db_xref="HOGENOM:HBG586485"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR015223"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="UniParc:UPI0000252A71"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AC3"
FT                   /transl_table=1
FT                   /translation="MIHRLIEVITSHLHLVSSSHEHTNKVQREIEMAEEIVVEPESLRE
FT                   IEHIVLVLSGKGGVGKSSVTTQLGMALACRGLKVGILDIDLTGPSLPRMVGMEGKSVLQ
FT                   GPRGWIPVDVPTGMEQGCLRVMSLGFLLDDRGDSVVWRGPKKTAMIKQFISDVYWGALD
FT                   YLLIDTPPGTSDEHISIAEELRGARPDGAIIVSTPQKVAVADVKKEINFCRKVNFKLLG
FT                   VVENMSGFVCPHCSECTNIFARGGGESLALESGVPFLGTVPIDPAFVEMIESQSSREEP
FT                   LISLYKTSGLYPIFARIVQHVLDQGIPSRCQ"
FT   CDS_pept        complement(698684..699661)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18928862"
FT                   /gene_name="VAB2"
FT                   /locus_tag="ADL005C"
FT                   /product="Protein VAB2"
FT                   /cellular_component="cytoplasmic membrane-bounded vesicle "
FT                   /cellular_component="vacuole"
FT                   /protein_id="AAS51916.1"
FT                   /db_xref="GO:0005773"
FT                   /db_xref="GO:0016023"
FT                   /db_xref="HOGENOM:HBG058691"
FT                   /db_xref="UniParc:UPI0000252A72"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AC2"
FT                   /transl_table=1
FT                   /translation="MSFLFSGELRSPKNASTERFVSVRGSDAYKELCSLGMLPSSKDLR
FT                   QDSIFRAVANEVKQVKQDVVEINSRVVAEVQVEKELAEHLNQKLKASEYKVDHLAKKLV
FT                   RLRQKHSTNTQRQVRKLDDCIGDFESNIRELHGTVAEMVDRLGSVDMGLPEKERLIGDH
FT                   QLNARHYPLLYELFRDKFPSKFGAPRGLGIASSLPERAFPKALGESDTGDLSHHDVATR
FT                   EAPPLEMDSAEEGCFYHPQNLAVDHIRNHFMNSRSSDINERELEISGSAHATKASSARE
FT                   NIPERILMPQFQKVASPQTAPTLENIEVTVPFSSKSAGHERHSG"
FT   CDS_pept        join(700507..700531,700587..700903)
FT                   /codon_start=1
FT                   /gene_family="HOG000211843" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15753462"
FT                   /locus_tag="AGOS_ADL004W"
FT                   /product="ADL004Wp"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="prefoldin complex"
FT                   /protein_id="AAS51917.2"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0016272"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG329661"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="UniParc:UPI0001DB2907"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AC1"
FT                   /transl_table=1
FT                   /translation="MSAEQRSNVLQLKYNEYKQTLEELQTKIIELGNDKEEHEVVLTTL
FT                   NGVDKARKCYRMVGGALVETDVQTTIPILQTKKENLSSTISALKGELVKVAEEFEKWKK
FT                   DNKIQVLKQ"
FT   CDS_pept        complement(700982..702265)
FT                   /codon_start=1
FT                   /gene_family="HOG000246553" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15753463"
FT                   /locus_tag="AGOS_ADL003C"
FT                   /product="ADL003Cp"
FT                   /function="dolichyl-diphosphooligosaccharide-protein
FT                   glycotransferase activity"
FT                   /biological_process="protein N-linked glycosylation via
FT                   asparagine"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="AAS51918.2"
FT                   /db_xref="GO:0004579"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0018279"
FT                   /db_xref="HOGENOM:HBG390611"
FT                   /db_xref="InterPro:IPR005013"
FT                   /db_xref="UniParc:UPI0001DB2908"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AC0"
FT                   /transl_table=1
FT                   /translation="MLERVLLGLLYVVSMAAAISVHGMKTLLIYDSRITDLGQYQNFLG
FT                   MLRERQYQVEEVSVDGTASSISLYDGDVRLYDNLILFPIKSRTISKDINVKSLLQFFEE
FT                   GGSVLAVTSPNGVTESARVYLEQMKIHVSPRDYKLVDYFHDGPIDVLPVNTSTVRNKHI
FT                   FSSDSVSELTYSGSSALLRNDGLVIPVLPAPRTSLSKNKKGEQWTAGSQGYLVASVQNL
FT                   NNARTSWVGSDSFFNDGNWQKNGAFVEELIKWTFGEKAVIKSTGFTHKHSNGLTFDQLP
FT                   YKIKDNIFYEIGFSEWNGSKWVPFHADDIQFELRMLDPYYRLTLEPSRVSVDSQYYSTG
FT                   NFALPDHHGVYTFVTQYMNSGLSFVIQKDVKPIRHLANDEYPRSYEITNSWVFLCSISA
FT                   VIALFVAFVAIYLFTPVVPSVSPEKKKS"
FT   CDS_pept        702496..702699
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059081"
FT                   /locus_tag="AGOS_ADL003WA"
FT                   /product="ADL003W-Ap"
FT                   /protein_id="ADJ41765.1"
FT                   /db_xref="UniParc:UPI0001DB2909"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGC2"
FT                   /transl_table=1
FT                   /translation="MTIDPASEVSTKEFLEAFQKLKEGEETADRMEKMLNKLEGNIEAL
FT                   LAAAEELNKSDKATNSNIEPSA"
FT   CDS_pept        complement(702756..705593)
FT                   /codon_start=1
FT                   /gene_family="HOG000179717" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15753464"
FT                   /locus_tag="ADL002C"
FT                   /orf_name="AGOS_ADL002C"
FT                   /product="ADL002Cp"
FT                   /function="inositol or phosphatidylinositol phosphatase
FT                   activity"
FT                   /protein_id="AAS51919.1"
FT                   /db_xref="GO:0004437"
FT                   /db_xref="HOGENOM:HBG058693"
FT                   /db_xref="HOGENOM:HBG396456"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR002013"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniParc:UPI0000252A75"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AB9"
FT                   /transl_table=1
FT                   /translation="MKLFVRKEPRAIALASNDYVLVFERSKNNPKQPQVKNAPPTIMVK
FT                   TMSEASLVNGGGFVEWTAFLIKGLLGVIHVRNQVFIGLITGVKDVAKPRWRIRDGKMKS
FT                   IESIFQILSVNFYCLDSPLYDQWLYYVSEICQEKLLTEHPCAPLKKLFSDGTFYYSRDF
FT                   DISNVLQERGLKHRIENTIENQEKKFIWNLNLMSEILQLRGRITPAELQAFDGGQFLTF
FT                   LIRGFCKTVFANEIHSPTSLTLISKTSIEDLDSINDFQKGIDEEGNVARFIESELIIQT
FT                   ERYLFAYVQTSADIPLSWEVVEGQLLHSKKLKLTKSPERIQATFDRHFDDMISRYGVIS
FT                   IVNLVKHRSSSQETLSGAYKACAEVKELHYTAVDYPVDVIKKSPYKLMYFLRDDIYEFG
FT                   AFAYDIARGVYVGKQTGSFRVSAVDATSKMNLVEMCISREVLDLTTDELEDFAITTSLV
FT                   KKHEALWSDNDFWLHRIHTKNIKNPAKYKKVYSQVFSLSSKVLLYDPLHAHIAKCLKKL
FT                   KNEYTYEKEISIFAGTFNVNGKQCKDEAMGTWLFPPNGESEGNYADIYVIGLEEVVELT
FT                   PGHMLSTDPMSKQFWEKTILRHLNSQEGRHYNCIGTNQLGGVLLLLYVNESECSKIKHL
FT                   EYDVKKTGFGGISANKGAAAIRFMYSATKFCFIVSHLAAGLENVEQRHSDYKTIMKSIG
FT                   FSRGKRIKDHDGIIWMGDFNYRILLSNEEVRRAILEGDYGKLFEKDQLNQQMIAGESFP
FT                   YFNEMEITFPPTYKFDPGTKSYDTSEKMRIPAWTDRILNRGEILKAISYGCAEDVIFSD
FT                   HRPVYATFKARTTVVDEEQRGQLSRIIHERLTEMFSGLNDEQKYAFLVDSELIVDKIEM
FT                   EGKLPLVSQVKKGKRLPPPSSDLRKWWIGNGKQVRITLDVDPKKQMLNPERPVNPFIPG
FT                   EDGQAYVVPKSRLNN"
FT   CDS_pept        complement(707146..707808)
FT                   /codon_start=1
FT                   /gene_family="HOG000148590" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18080125"
FT                   /gene_name="IRC22"
FT                   /locus_tag="ADL001C"
FT                   /product="Increased recombination centers protein 22 "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS51920.1"
FT                   /db_xref="EMBL:AAO16964.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG190124"
FT                   /db_xref="UniParc:UPI000006CB06"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8J1F5"
FT                   /transl_table=1
FT                   /translation="MKLSNLLLFANVGTLLVKATDENISPNEENTPRYAQFNIDYSVLD
FT                   QPNYDPMAPMEFENGENITLAFNFANNEEVPVKLIAVGGNIINARSGDEVANITRSSLG
FT                   EIEVDVNTSVSFNQAINLKLDEGDYFLLPNVFVLKEGELMAVGTSPSRIKILPPPMSFF
FT                   NPKFLSIQAVLIGVISYFTYFIFRSSKKERRGVVSKTKAPKKVKLDESWLPENHLKK"
FT   mat_peptide     complement(707149..707751)
FT                   /gene_name="IRC22"
FT                   /locus_tag="ADL001C"
FT                   /product="Increased recombination centers protein 22 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8J1F5 "
FT   sig_peptide     complement(707752..707808)
FT                   /gene_name="IRC22"
FT                   /locus_tag="ADL001C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8J1F5 "
FT   CDS_pept        complement(708895..709869)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775854"
FT                   /gene_name="YIB1"
FT                   /locus_tag="ADR001C"
FT                   /orf_name="AGOS_ADR001C"
FT                   /product="ADR001Cp"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAS51921.1"
FT                   /db_xref="EMBL:AAO16965.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG058694"
FT                   /db_xref="HSSP:1OO0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000006CB07"
FT                   /db_xref="UniProtKB/TrEMBL:Q8J1F4"
FT                   /transl_table=1
FT                   /translation="MVESAVLSNPVPGNSAAIPIESPRSDEQLADTEDSSWEQDMSSDS
FT                   KGDQDEQSSYNSLDSTTPVSQPLSKDRKHAKQVELDSRSVFVSSITPEATAEMLEEHFK
FT                   DVGVISRITILYNKKTGEPKGYAYIQFESISSVEKALQLDGSSFNGNTISVAKKRTNLP
FT                   GFNRPFNYYPYQQFHAHGNGRYHHPQSHHPHPQQHQFFYGNQWQNGYPHAHWNYGAYGG
FT                   AYTPYKNVNFYNSYRFQQQGQHLPQMIPNENSRAHLREGRAGTRGNKGGNPNSSRKSRQ
FT                   TVGPSKTNDAKLMNDPPVSNSTSHSVNSVSTSATTSETGVKRE"
FT   CDS_pept        710195..710905
FT                   /codon_start=1
FT                   /gene_family="HOG000048344" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15753465"
FT                   /gene_name="NOP16"
FT                   /locus_tag="ADR002W"
FT                   /product="Nucleolar protein 16 "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="AAS51922.1"
FT                   /db_xref="EMBL:AAO16966.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG175985"
FT                   /db_xref="HOGENOM:HBG396451"
FT                   /db_xref="InterPro:IPR019002"
FT                   /db_xref="UniParc:UPI0000252A76"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AB6"
FT                   /transl_table=1
FT                   /translation="MASVRKRKMARSSVRKVTRRNRDKQRKVNIACNPIIEKNWDYNLT
FT                   LAQNYKRLGLTAKLAPRAGGEEIDLSKVIQKSVPICSAFEDYDSESDVEQEKRNNDDAL
FT                   EDGEYDPAKIPEGEARIQRDENGDVVKVVYGTMKTVDVDEDISELKQKLEQDKVKTEVV
FT                   QELESYASRPVNRRVRYQSSREEEWLGRLYEKHGEDYNSMARDLKLNIYQQSVGDLKRR
FT                   MKKWLKAHHIDERQ"
FT   CDS_pept        complement(711034..712323)
FT                   /codon_start=1
FT                   /gene_family="HOG000241277" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15753466"
FT                   /gene_name="PMI1"
FT                   /gene_synonym="PMI40"
FT                   /locus_tag="ADR003C"
FT                   /product="Mannose-6-phosphate isomerase "
FT                   /EC_number="5.3.1.8"
FT                   /function="mannose-6-phosphate isomerase activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS51923.1"
FT                   /db_xref="GO:0004476"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG011907"
FT                   /db_xref="HOGENOM:HBG590632"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016305"
FT                   /db_xref="InterPro:IPR018050"
FT                   /db_xref="UniParc:UPI0000252A77"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AB5"
FT                   /transl_table=1
FT                   /translation="MSAKLFRLDAGYQQYDWGKIGSSSAVAQYAANSDPSVQIEEDKPY
FT                   AELWMGTHHKVPSRHHDTKVALSDLIAANPEGMLGSGNVEKFHSRKDLPFLFKVLSIEK
FT                   VLSIQAHPDKNLGRRLHIQDPKNYPDDNHKPEMAIAISDFEGFCGFKPLEELAEELQRI
FT                   PEFRSLVGEDIAAQFCAGIKVGAQEGSEEDKSNRKLLQSVFSNVMNASDDVIASHARHL
FT                   VERAKQSPADFNNETLPALILRLNEQFPEDVGLFCGCLMLNHCVLKAGESIFLRAKDPH
FT                   AYITGDIIECMAASDNVVRAGFTPKFKDVKNLVEMLTYSYDSVEDQKMKLLPFARSSGS
FT                   GDSILYNPPIEEFAVLQTNFHGSTGTHHFDGLDGPSIVITTNGSGYIQSGDVRLKAEAG
FT                   YVFFIAPHAEVDLQTEDSNFTTYRAFVEPN"
FT   CDS_pept        712542..713117
FT                   /codon_start=1
FT                   /gene_family="HOG000141893" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928863"
FT                   /locus_tag="AGOS_ADR004W"
FT                   /product="ADR004Wp"
FT                   /function="transferase activity"
FT                   /protein_id="AAS51924.2"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG058695"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniParc:UPI0001DB290A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AB4"
FT                   /transl_table=1
FT                   /translation="MADWIETSNGNRISKKATITGSQRILIAGSCLIRENCVVEGNVRT
FT                   LEKSASAISMGRFCMLGRASVVKPAVIGYKTDKNTGKSVSIHCPLVMNSYTLVKPGAQI
FT                   HCKRMGSRVVVGANSILARCCTIGDVVIIEDDVVVPENCYVPSFSRVRRHSEWPGSIDI
FT                   TPLNDSMRQVIENWCKQEYLGMTPDYDD"
FT   CDS_pept        713333..714007
FT                   /codon_start=1
FT                   /gene_family="HOG000258441" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15753467"
FT                   /gene_name="FMP52"
FT                   /locus_tag="ADR005W"
FT                   /product="Protein FMP52, mitochondrial "
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="AAS51925.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="HOGENOM:HBG199800"
FT                   /db_xref="HOGENOM:HBG564164"
FT                   /db_xref="HSSP:2A35"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000252A79"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AB3"
FT                   /transl_table=1
FT                   /translation="MNALVVGATGLCGAAILKHAAEATSFNKVYALVRRQIPNSAARVE
FT                   TIVNEQSDSWPESVPAGVDVFFSGLGTTRANAGGLENQYKVDHDLNIAVAKAAKERGCR
FT                   VCVIVSAIGASVNARLPYNKLKGDIERDLLALEFERTVILRPGVLLGERETHHKGFGNS
FT                   VAVFLGKLVYRGRFQALLGYPVYGDEVGQVAVALALSDDKSKVRIVESAEILSLVKQEN
FT                   TQ"
FT   transit_peptide 713333..713464
FT                   /gene_name="FMP52"
FT                   /locus_tag="ADR005W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AB3 "
FT   mat_peptide     713465..714004
FT                   /gene_name="FMP52"
FT                   /locus_tag="ADR005W"
FT                   /product="Protein FMP52, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AB3 "
FT   CDS_pept        714108..716153
FT                   /codon_start=1
FT                   /gene_family="HOG000246725" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15753468"
FT                   /locus_tag="AGOS_ADR006W"
FT                   /product="ADR006Wp"
FT                   /function="hydrolase activity"
FT                   /protein_id="AAS51926.2"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG190991"
FT                   /db_xref="InterPro:IPR000407"
FT                   /db_xref="UniParc:UPI0001DB2923"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AB2"
FT                   /transl_table=1
FT                   /translation="MLCIPPVGPPKKAGTGTRDSLYTLLNSINNGKPLLQRRRGDMVEE
FT                   DKEIAEHDKYGVVIDAGSSGSRVYVYKWTDPTALGKETSDESVLHSVPHIRTRKEWTKR
FT                   IEPGLSSFNKKPERAYKKHIKILLEHAKEVIPEDKHHETPIFIQSTAGMRLLSDVEQKR
FT                   ITDVLCRKIRDETHFLLENCAAQIETIDGETEGIYGWLSLNYLKKYFDEYDGKLTDHKS
FT                   HGFLDMGGGSLQIAFKPSDPEEISKHREDISTITLKSVNGDVQQWDVFTSTWLRFGTRE
FT                   VRKRYLNQLVHTALNGSGEKSPKALKDRGVYDPCLPKGSEHSFTYSGTELRIKGVGEYE
FT                   QCSKTIYPLLLKNSPCLEQPCSFSGVHMPKIDFTRDSFLGVSEYTYTINDVFHMDAEYN
FT                   FSNFSGKVQQFCELDWQKILQERENGNYGDISKSSLLEACFKANWVINVLHEGFGIPRK
FT                   GIDPPDAGSGDVGNHITFSSADNVNGNELTWTLGKILLYACSMVQLGENIKVGLQPSAL
FT                   SAKNDGKKFIPGGISRDLEYDSVMVQFLHSLGQMVLLFSVGLLLYWLYVKLHIKQYVSI
FT                   NSLKSAINYVRGKINKIRYSKVMNPGQLEQLEAGVLPMSRFGGDRDGFKFRSRTMLNLS
FT                   PQGYEDHPIPGGRASGAASPALSENAMGTIFSMADFSDFNRPSSNY"
FT   CDS_pept        complement(716351..717415)
FT                   /codon_start=1
FT                   /gene_family="HOG000108634" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15753469"
FT                   /locus_tag="AGOS_ADR007C"
FT                   /product="ADR007Cp"
FT                   /function="transcription regulator activity"
FT                   /function="translation initiation factor activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /protein_id="AAS51927.2"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG236599"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="UniParc:UPI0001DB2924"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AB1"
FT                   /transl_table=1
FT                   /translation="MSLPSAANANAAAAARRKVPNLNIVISCPECKVYPPKVVERFSEG
FT                   DIVCALCGLVLSDRIVDTRSEWRTFSNDDQNGDDPSRVGEASNPLLDGNHLSTRIGQVQ
FT                   GSDVKLTRELNRAQSKSIVDKKDNELQAAYAKITMMCDAAELPRIVKDCAKEAYKLCFE
FT                   ERALKGKSQESIMASVILVGCRRAEVGRTFKEILSLTNVRKKEIGKTFNIIKKILREKN
FT                   DSGFANVDTANISTGQTNAETFIPRFCSHLGLSVQVANAAEYIAKHAKDINVLAGRSPL
FT                   TIAASAIYMANLLFRYNITPSQISATLQVTEGTVKGGYKILYEHKEKVVDPELITTGKV
FT                   SFDDLPKVSDKGDK"
FT   CDS_pept        717681..719222
FT                   /codon_start=1
FT                   /gene_family="HOG000207716" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15753470"
FT                   /locus_tag="AGOS_ADR008W"
FT                   /product="ADR008Wp"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS51928.2"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG285492"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR014813"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="UniParc:UPI0001DB2925"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AB0"
FT                   /transl_table=1
FT                   /translation="MRVRKRTSKRTSTRLREGIKKKAAAQHRKERKQAKKDVTWKSRAK
FT                   KDPGIPASFPYKHKILEAMEEKKREDQEERERRRQERQEAKRLARERGEEVMDDEDSDE
FT                   EMEEGNGLSALVESAQLAAKEYDGAVGGDAEEDVEVQDLDVDFYADAGEAESELEKSRK
FT                   AYDKIFKTVVDAADVVLYVLDARDPEGTRSRKVEEAVLQAQGKRLLLIINKVDLVPPHV
FT                   LEQWMTFLKSSFPTIPFRAAPGATNAASFNKKLTLSATASGLLECLKTYAHQSNLKRSI
FT                   VVGVIGYPNVGKSSIINALTSRRGGSFKACPVGNMPGVTTSLREVKIDNKLKILDSPGI
FT                   CFPSESTKKTKSEQEAELALLNALPPKYIIDPYPAVLKLIKRLSQNEEMTASFKKFYEL
FT                   PAIPAPDAESFTKQFLIHVARKRGRLSKGGIPNLTSAGVSVLNDWRDGKIMGWVLPNSS
FT                   KAASAKATQPGASSETGPAGVRSSTEQTTIVEEWSKEFDLDSLFASLDNAIQTAN"
FT   CDS_pept        719439..720911
FT                   /codon_start=1
FT                   /gene_family="HOG000141894" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775855"
FT                   /locus_tag="ADR009W"
FT                   /orf_name="AGOS_ADR009W"
FT                   /product="ADR009Wp"
FT                   /protein_id="AAS51929.1"
FT                   /db_xref="HOGENOM:HBG103923"
FT                   /db_xref="HOGENOM:HBG190992"
FT                   /db_xref="InterPro:IPR000938"
FT                   /db_xref="InterPro:IPR023092"
FT                   /db_xref="UniParc:UPI0000252A7D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AA9"
FT                   /transl_table=1
FT                   /translation="MKYKVGERLDLDGELCTLRYIGAIPDWPGQVAYGVEWDSQGRGKH
FT                   SGTLHGVKYFETSRPDTGSFLKESRVLKTVGITRTLLEALHSRYGEKLLELDEMYIGSK
FT                   RLEGYGFEKLTLINNDYLNLKVLSLSKLGINRIGSDEDLSNFVTNCSNVEELDITSNLF
FT                   IDFGAVISIASNLRKLRTLDVSNNKFSITGGFMNQCLHVKRLIIRHCRLDVTSLRRILE
FT                   AFPNLENLDVLDNSIDDIDSVKLPKTLKTFNVSQNTIKSWQSQSLKGLQTLIAANNIIA
FT                   DIPPDPCPTIRTLDLSYNNIALWDVVDKFQTVFPNMHDLRINNNIFSSDEEDTDEFYQI
FT                   IARIPSLTMLEGSILGKDTRREAELYFISKVRSGDISYDCSSIRWKSLLYHHGISDNST
FT                   QNFSYETLWHDICVLEVHFEGKQLELHLLNTSSVRLLKNLIAQLLDLDLLAMSLSYSIT
FT                   PGIVSEFNYEFSPLTTFGIRSDAIVYVNPSDC"
FT   CDS_pept        join(complement(721559..721569),complement(720970..721504))
FT                   /codon_start=1
FT                   /gene_family="HOG000223988" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20623358"
FT                   /gene_name="TMA20"
FT                   /locus_tag="ADR010C"
FT                   /product="Translation machinery-associated protein 20 "
FT                   /function="RNA binding"
FT                   /biological_process="translation"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS51930.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG128790"
FT                   /db_xref="HOGENOM:HBG553443"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR016437"
FT                   /db_xref="UniParc:UPI0000252A7E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AA8"
FT                   /transl_table=1
FT                   /translation="MFKKFSKEDIHTRTKVKTSVQRSLKSKLVEQFPKLEEVIDELLPK
FT                   KTELQIIKCSDKIQLYAVGDEVLFFQKFEELIPTLRFVHKYPEAFPTIQIDRGAIKFVL
FT                   SGANIMCPGLTSSGAALPEAPGLAQDSIVVVNAENKENALAIGKLLMSTEDIKSINKGH
FT                   GVETIHHLGDCLWNFSLV"
FT   ncRNA           complement(721821..721964)
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR14"
FT                   /product="AgSNR14"
FT   CDS_pept        complement(722135..725368)
FT                   /codon_start=1
FT                   /gene_family="HOG000066122" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15753471"
FT                   /gene_name="MPH1"
FT                   /locus_tag="ADR011C"
FT                   /product="ATP-dependent DNA helicase MPH1 "
FT                   /EC_number="3.6.4.12"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="DNA binding"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51931.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG058697"
FT                   /db_xref="HOGENOM:HBG448053"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001DB2926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AA7"
FT                   /transl_table=1
FT                   /translation="MLQHATITKMTDFSDLDDDDIVGLLDQDVNRCVETSVTRHKLAMQ
FT                   RDLTGKVLDGEKRYYEEVVTSVTYKPTHHQLRYENLNTYLYPTNYEVREYQFNIVHRAL
FT                   FENVLCAIPTGMGKTFIASTVMLNYYRWTVGTKIIFTAPTRPLVAQQIKACLGITGIPY
FT                   NDTAILLDKSRKHREQIWSEKRVFFATPQVVENDLKRGALNPKDVVLLVIDEAHRARGS
FT                   YAYVELTKFIDRFNTSYRVLALTATPATDLEGVQEVVDNLQISKIELRTEESEDIVRYM
FT                   KRRDTEEVIVPLIPEIEDIIEQLGIAITPVLKEAVQLGLYDDCEPVNINAFIAMQQSQK
FT                   ILANSSIPEGVKWKNYFILQLLCHVGHMLKRLKIYGIQTFYTYFDNKYREFTTKYGIGK
FT                   STNKTAASFYYSSILKNITKTCQAYTANPSFLGHGKLYRVRDELSTFFASAGDDSRVII
FT                   FTELRESALELVKCVDNMNDRFIRPHIFIGQAKGKESFDDGEYLRKHAPKGRKKVDRIR
FT                   RLEEEKRLADEKLRKKEEEKLARTARRTGSSEEAQISGMTQKQQKEVISLFKKGDYNVL
FT                   VCTSIGEEGLDIGEVDMIICYDTTSSPIKNIQRMGRTGRKRDGRIVLLLSDNEPRKFEQ
FT                   AMEDYAQLQRLIGEESLNYKVTDRIIPKGINPQCQKEFITISEKNSAVNGMEDADSVIK
FT                   YATQAMLGKLDKRKAVKKSTGKAAPKRFFMPDDVETGIVPAMKLVKSYKYTENGEAFPV
FT                   AESVKGRRPKSKDTLLDRLEYDSLESELSSPEKATKSQNVVEIRPKLLSDILLKDEDTL
FT                   HFEHSSSCPKVDSLASVTTLSSDNKSTPDQLKRSQSDNGFGIPPKRQRLCYDTSANCSS
FT                   TDTHLMEAQSKNKDNPANRKTGEPHYKLEVSPLKREEDDRDVIPQNIAVKPEVPHLTQE
FT                   CLTTGRVYKSEFSKYDGFLTVSERRYFEQNYSPVHLVSLEPRPVFSRSRNRVAIVPHSE
FT                   RVQRLINIFAAMDTDDKVHIIDMHRKHALARRTVHGGPTENSDLLQPSSDGIIVPNDDI
FT                   RLFSLRPRATDFEDMLEDDEGLSELLDSD"
FT   CDS_pept        complement(725553..729506)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15753472"
FT                   /locus_tag="AGOS_ADR012C"
FT                   /product="ADR012Cp"
FT                   /protein_id="AAS51932.2"
FT                   /db_xref="HOGENOM:HBG124893"
FT                   /db_xref="InterPro:IPR019160"
FT                   /db_xref="UniParc:UPI0001DB2927"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AA6"
FT                   /transl_table=1
FT                   /translation="MLKRFSHSRGESLDDNGSGHSIFHKRTPSTQAAANAAGLGAAAHR
FT                   RTTSRSSVSSTSSNFLAEQYERDRRAIIQSCFQKVDAVTGLPMNVYITHVRIIEDSRYP
FT                   SSRPPADSPLTNKKKRALIVSTRANGLGMQLHKARENSNGTFQIGRSWDLKELVLIERD
FT                   LERPEGFVFIMGKKYYWETNSAKERLVFIKSIVKIYMENSNGRVPQLINWDLSIFYLDE
FT                   QSYQRAVIRAKSQPDVPPANARDGAHVATHVGNTMHTGSAIHPSAMNIGMQPGPQAQAQ
FT                   AQTQSQFVPPQSKTSFKELSAFSPDPTYTENSSADVLPHNWPSYSPGHDHSQAPQQAPQ
FT                   QAPQQAPQQAPRQNNPLGSAQSSAHGEPPRPAVQQPNIPTAATHTVAGAIPSGPPSSTP
FT                   HQGSHPYSSFYARGRSDSGNKTLRIPHSPSSVRSDVSKTGISPVMPLNVSPEEGQQKED
FT                   SPYQRSMQENVTPGPAQPTAVGRHKPGTVTESRVSFENDRYMEELDGALRSSLDINRDH
FT                   SPSNINTFSDEPSPYKKETNMQEAPAAPMLEAIRKFPSELSFGEDDIRPERFSHTKTDS
FT                   HSKFSLPTRNEPRIAVPELSPPETTGSHTEISENEVLDFQAMVGILDEIHWSANDGSDV
FT                   VLERLLLKVAEAEYQFNKQLMSLPKKASDLKLYKAKTVQECDRMDPTLSLFTMELSSIS
FT                   KDIEYVERQSNGLQVNCVNKKLLSKDLSGILDSVSLAESSLEELLNLSLVEKNLDKIES
FT                   LLLGLHKAIGAIKGGKKDEQSDLGEIRALKDRRQAYERITDSFLKKLVSQMDAKFKKMQ
FT                   VCSSDLNELLSGLLVFSSLPLFCKDVSEHTFNVLLENWSADVCKLYNTRVASVLDYMQE
FT                   RTAKLQQPPSTTGKDELVQLWDTYRKTKSLSFASCTKSNEVDTILKSLGAIEELCITYQ
FT                   NFVDRFFHMSSSFTFPEYVKKFDTKSRQFDLYTVKSMESNRDSAKLKNQMVTTVFQAEF
FT                   ASFFAEVSQTLRKNQWHIPVVLLYLDNRIKWLKPTDQEFLLSAIVKIYEKLKQDWEAYI
FT                   NEQTVHHERAVIDYKARYLFPPVLNFPIFVKTAEDELAHAFTNFNLSPEHSSDILNYLD
FT                   ETYCGWGASVVKLLGREDKSELGSTKLPPVNHSANIERCVSIVKNSHWFVEILPIFRKD
FT                   SFLDIIQQSKQVFDKQKESYADMLLYQEMGELFAFVDGTHGLINSSSAKADPSRWAAYS
FT                   PQHLNTLLSKYTSQQIDNIVDKMYNNMVQHFSEHAESKMAESLREKLWSCIQGQTVSFY
FT                   LKLYSLIDRHYKGIHVHFTKNDIISAFEGHKNW"
FT   CDS_pept        729916..730293
FT                   /codon_start=1
FT                   /gene_family="HOG000197024" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15753473"
FT                   /gene_name="NTF2"
FT                   /locus_tag="ADR013W"
FT                   /product="Nuclear transport factor 2 "
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS51933.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG061558"
FT                   /db_xref="HOGENOM:HBG319937"
FT                   /db_xref="InterPro:IPR002075"
FT                   /db_xref="InterPro:IPR018222"
FT                   /db_xref="UniParc:UPI0000252A81"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AA5"
FT                   /transl_table=1
FT                   /translation="MSMDFSALAQQFTEFYYNQFDTDRSQLGNLYRDQSMLTFETSQLQ
FT                   GAKDIVEKLVSLPFQKVQHRITTLDAQPASPNGDVLVMITGDLLIDDEQNAQRFSQVFH
FT                   LMPEGNSYYVFNDIFRLNYSA"
FT   CDS_pept        730481..732229
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928864"
FT                   /locus_tag="AGOS_ADR014W"
FT                   /product="ADR014Wp"
FT                   /protein_id="AAS51934.2"
FT                   /db_xref="HOGENOM:HBG058698"
FT                   /db_xref="InterPro:IPR021582"
FT                   /db_xref="UniParc:UPI0001DB2928"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AA4"
FT                   /transl_table=1
FT                   /translation="MINTAIKRSNSSASERPALAHSEQKMSEPPPIPERPKVPIRPKKR
FT                   LTASSLESAARSSPLPEEATNAGAASDAPDAEAQEGRHADGHALGAGIPAPHECVEHAG
FT                   EETIACRVPDESAHKHRGAAGATTNDALSLEQEGARAGLVPQREGVPRNGDELTEQATS
FT                   PRNVPEAAAADEENSVSAHKPLPQATGETSEQPASAAGALMNAEDETPAAHSQGAARAV
FT                   SPDLAGASSSLGGSPGRSKGKPLVPKKPSSKIAAFQEMLQRQQTEIYGSKVHDEHHSVL
FT                   TPAKLGGSRANFTQNLNNLFAMPGIAPGGQLPPLSRKLTSASESTGGSRSPTGSPVHRS
FT                   VSPPRHSASPPRCSLSPPRRSQSPPKSTVPAPLPTSNTRVRGPSRKLPSAFKGVEKAKP
FT                   VSTNTITSFPTWSVTFTARAPSEEIASNSSSASVNSAFSASAGTAFSASAGTAFSASAG
FT                   TAFSAGARSASSVSPTAVSSAGSSHDASSEICLSSAADASSAAGPSAVHASRLDVSRES
FT                   TSEYSIGDYAQDGDTDDRWRQRLLQKYQTSSSMGNNTTSQLDSAPASPNNGSSTNDFMD
FT                   YITKDL"
FT   CDS_pept        732632..733942
FT                   /codon_start=1
FT                   /gene_family="HOG000186929" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15753474"
FT                   /locus_tag="AGOS_ADR015W"
FT                   /product="ADR015Wp"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="AAS51935.2"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG336641"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI0001DB2929"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AA3"
FT                   /transl_table=1
FT                   /translation="MVVDTAYYDLLGVSPDAKAIEIKKAYRKKSVQEHPDKNPNDPKAT
FT                   ERFQAISEAYQVLSSDELRAKYDKFGKEEAVPQNGFEDAGEQFAAIFGGEAFASYIGEL
FT                   TLLKNIQKTEELVQQDEEEKQREKQRVHEKTQDQKKGATPQTGAPAAGEPAAAAERVKP
FT                   SGRGAIEENGGAKAASDKGDGETQDERKKTKLEQFEEQQRLDKEKMIDKLSKILCDRLS
FT                   VVTESSYDEPCKRAFEKKFEEEANMLKMESFGLDILHTIGEVYCQKAEIFLKNQRILGI
FT                   GGFFHSVRAKCGFVVDTVRTVSAALDAQNTMQELEKLKLAVDSDEPLRDDKGNELPKPT
FT                   VEELAHMEQLVMGKVLSAAWHGSKFEIMSTLKSVCTRVLEDKNAELETRIRRAEALIML
FT                   GRVFKRTYRTPVEQEDAQVFEELAAEATKNKSRSRRK"
FT   CDS_pept        complement(734086..734802)
FT                   /codon_start=1
FT                   /gene_family="HOG000107599" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15753475"
FT                   /locus_tag="ADR016C"
FT                   /orf_name="AGOS_ADR016C"
FT                   /product="ADR016Cp"
FT                   /protein_id="AAS51936.1"
FT                   /db_xref="HOGENOM:HBG178104"
FT                   /db_xref="HOGENOM:HBG324715"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="UniParc:UPI0000252A84"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AA2"
FT                   /transl_table=1
FT                   /translation="MSHSRALSKFSTCDVADGLLNFCGIDDGGFLGNLTQWSGSEQGTL
FT                   VGPAYTVLFDKVENVDEEVNYIDSLPRGVVLVIGLPLEQQLPTAPHVIVSQALYGGLMS
FT                   TRAQYLGSRGTIVFGRVRDVDEHRQLNYPVFSHALGVCAPRMAVKPAKIGVALPILMPD
FT                   GSVRHLNPGDYVVADENGVVQIPASVSSKMEKLINYIDHSIKADQRVAQDIKIGVPAKQ
FT                   AQRNRRAALKDLIEPN"
FT   CDS_pept        734917..735438
FT                   /codon_start=1
FT                   /gene_family="HOG000174091" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928865"
FT                   /locus_tag="ADR017W"
FT                   /orf_name="AGOS_ADR017W"
FT                   /product="ADR017Wp"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAS51937.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG245628"
FT                   /db_xref="HOGENOM:HBG398346"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000252A85"
FT                   /db_xref="UniProtKB/TrEMBL:Q75AA1"
FT                   /transl_table=1
FT                   /translation="MNQIRSIQKLSETELEHGILSEEASWHYQYKDQAYIHFSGLNVEL
FT                   TEGDILTVFSQFGVPTDLKLVRDRETGESRGFGFLKYEDQRSTVLAVDNLNGVNLCGRV
FT                   LKVDHCFYEPRDEDEAYVKTVREELARDLVDVEVGTTAPIQGKITLTEDAELADPMGEF
FT                   LSSKKDVDGR"
FT   CDS_pept        complement(735558..739304)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15753476"
FT                   /gene_name="PAN1"
FT                   /locus_tag="ADR018C"
FT                   /product="Actin cytoskeleton-regulatory complex protein
FT                   PAN1"
FT                   /function="actin binding"
FT                   /function="calcium ion binding"
FT                   /biological_process="endocytosis"
FT                   /cellular_component="actin cortical patch"
FT                   /cellular_component="endosome membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="AAS51938.2"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0006897"
FT                   /db_xref="GO:0010008"
FT                   /db_xref="GO:0030479"
FT                   /db_xref="HOGENOM:HBG058699"
FT                   /db_xref="HSSP:1C07"
FT                   /db_xref="InterPro:IPR000261"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI0001DB292A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AA0"
FT                   /transl_table=1
FT                   /translation="MYNPYQQSGGPAYGADGYGQQGYGQAYGQQGFGQAYGQQGGGYEA
FT                   GPAATYTAGAAQPLRPTATGFVNAAASRGLNTELKIPLFRLSFLTAADQAKFETLFRSA
FT                   VRPGATTITGEDCKHILLRSGLSPFQLGLIWTLCDTNNAGELLFPEFALAMHLVNGVLQ
FT                   GERIPRALDSKVKNEVSSFVDLINFSVGSNSPPPEGQKARTPFDALTQGAGTLQPQATG
FT                   FMPPTSFGVPQATGLGFGQAPMQPQATGYMPPTSFGAGLGAHTTGGNALASQMTGGLQQ
FT                   YAGGAFQNYQATGGKGLGAQVTGGFAQQPAGANPLLSQLTGGQGFQQQRQPTGANSLMP
FT                   QVTGGFQQPSNAIGSQPPAMGMPQGLSQGQSVGLQAQATGFLPPSQFAPTAPLAAQKTG
FT                   FGNNEIYSHAAFASGFPAGEDDKLTPEEKSLFYNIFDTYDTDKTGQLHFKVAAEIFRKS
FT                   GLNRSELERIWNLCDTNNSGQLNRQEFAVGMHLIYRRINGHNLPHTLPPSLVPSSTRIL
FT                   NNVKNQLKVSSSSKKEPTRIDGLAYKNNDDDILPSFKNRRKTFTEPRQSKDNKTVDDLK
FT                   KLVEEKRRKLESERSQLSLRQKDQQIKDEETMRHVDSLMHQIRSLPMKKHAAVPSDMKA
FT                   RFDSLTSSISTLFNNIAEIDDEITNAKVHLYRLKNPSSIVGSGPNGEVTEYDQKKARQK
FT                   AVLAARMAALTGTPIETPSEADLRREEQGLNEEVAKIKEESRKNQEILNDIKSSITEIS
FT                   APISTFIYGSGNADKDPAYERWELGIGLEPEVCDFIRKLKETQTQAQAQEQARAQEQAR
FT                   AQEQARAQEKARAQEKARAQEQARVQEQARAQEQARAQEQARAQEQARAQEQARAQEQA
FT                   KADAASRESTRSPEEFARWPQDQSPSHPGLTASVSPQSQSVSVSNRGTPQLGQQQMGSG
FT                   FYSDYQSADARAAYVRQQSQLKQPAPAPTSTTDFNSEDEEDEEERSLREQLAALKLKRK
FT                   AEKEAKLAVGRNQTGASQDPAVRASPDEWDEQPSRPSHTPVYSTSPAMASQGELPKQGS
FT                   SAPHLHPTTTGDRSPFFKQKQGSTSTFDLKAAEQQRRLQRGLDDGDGWSDDEDSSSKPT
FT                   QPTATTSATDIPSSGADSGARAPVSAAPASIVRPDGSTATQPPVVPSPPVPQPGPSSGA
FT                   PIPIAPPLPTLNGQQAGPAPSVAPTGHVERAASQPQINDGNEDDEDSDVLSIPESVESE
FT                   DGKDQYTTAIPEIPYIPPPPPLP"
FT   CDS_pept        complement(739637..740269)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15753477"
FT                   /locus_tag="ADR019C"
FT                   /orf_name="AGOS_ADR019C"
FT                   /product="ADR019Cp"
FT                   /biological_process="response to stress"
FT                   /protein_id="AAS51939.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG058701"
FT                   /db_xref="InterPro:IPR000992"
FT                   /db_xref="UniParc:UPI0000252A87"
FT                   /db_xref="UniProtKB/TrEMBL:Q75A99"
FT                   /transl_table=1
FT                   /translation="MKFQSAAAVAALVATAVAAVDKLESSSLDVLFSDAQAHTQDYMGF
FT                   FKPVGTHDPPRGLKEAFFKLLAGNFPTEADYEAIDFETVKNGVKDLPWYNDRLAKPLAA
FT                   IGGAAEQPAKTEAPASSAPASSAPAKTEAPASSAPASSAPAKTEAPASSAPASSAPASS
FT                   APPAPASSAPAASTSSHAVATKDGAANVLPWSAGLGVVVAGAIGMLM"
FT   CDS_pept        complement(740845..742659)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928866"
FT                   /locus_tag="AGOS_ADR020C"
FT                   /product="ADR020Cp"
FT                   /protein_id="AAS51940.3"
FT                   /db_xref="HOGENOM:HBG058702"
FT                   /db_xref="InterPro:IPR022751"
FT                   /db_xref="UniParc:UPI0001DB292B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75A98"
FT                   /transl_table=1
FT                   /translation="MILQRQVQRRWLPSCRALLVACVALLLLWWARASWSTRSTVANNN
FT                   GLRAALKFSPLFMLDTDSYRSPFGGWGERSLRMRCKTYFRQTYEVHNAWENRLLLRNED
FT                   QYFKDIVASLAMERLRVYDECFISGGLAVHDSMLEPLTRIELRTRMFPFLAPSHRQDLI
FT                   WPTVINATSGRHIRRLLKISTGELHRIRPDRSFWYNWREFANGRGIAVAVNDELADSFQ
FT                   ALLAVLDHLGNTLPVQAVHNGGELSQRRFDELVAHIQAHSRQQVFFVDCTPTLRNMWLR
FT                   KFARVPPSRLAALFNSFDEFVLLDASAVPFVPPAQLLALPEFADTAALFFKGRAYTTQP
FT                   QRSCLHSMARLLPSAEEARLWRGAAAFNASGAAAAFNASGAAAARDGAAAALLRAGLVD
FT                   GLDHALVLVRKPRALAALLAALLLDLQPRAPGCRPHARSLFPLALHAMALPYAVHPGAA
FT                   GALGELDPAAPADCPVLCSAQLAHLDAAGRLLWASGGLRRCHTSDARRDFRDNDAHFRP
FT                   APASPDGLAEARARPLSVHAFLAPASPAGWTPHPDCAHTTHCAALCRQPSADVMLGTLL
FT                   RFGQAERRRHADLTRIWNDALPAFLRQA"
FT   tRNA            complement(742765..742837)
FT                   /gene_name="tRNA-Thr"
FT   tRNA            743538..743609
FT                   /gene_name="tRNA-Met"
FT   CDS_pept        743735..744265
FT                   /codon_start=1
FT                   /gene_family="HOG000201071" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18080126"
FT                   /locus_tag="ADR021W"
FT                   /orf_name="AGOS_ADR021W"
FT                   /product="ADR021Wp"
FT                   /function="dioxygenase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="L-methionine salvage from
FT                   methylthioadenosine"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS51941.1"
FT                   /db_xref="GO:0019509"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051213"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG020936"
FT                   /db_xref="HOGENOM:HBG660685"
FT                   /db_xref="InterPro:IPR004313"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI0000252A89"
FT                   /db_xref="UniProtKB/TrEMBL:Q75A97"
FT                   /transl_table=1
FT                   /translation="MVEAYVHDNNTHVDCRAPHHSGKSVSLERLASLGVFYRHCRSQDE
FT                   VDAVACARHYSNRDEVTISPASFPSEDAFRDKLAVFYTEHLHEDEEIRYALAGEGYFDL
FT                   RDATTGDWIRVKLTTGDLLIVPAGIYHRFTVTESNFIRAQRLFKDEPKWQAFNRPEGDA
FT                   RPVHKEYLASLAI"
FT   CDS_pept        744696..745769
FT                   /codon_start=1
FT                   /gene_family="HOG000248556" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15753478"
FT                   /locus_tag="AGOS_ADR022W"
FT                   /product="ADR022Wp"
FT                   /protein_id="AAS51942.2"
FT                   /db_xref="HOGENOM:HBG058703"
FT                   /db_xref="UniParc:UPI0001DB292C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75A96"
FT                   /transl_table=1
FT                   /translation="MLNSTVIGRDVGEAAAALGGGAPGFGSYWPRIDQFYIPPWLDVQF
FT                   LANNIISFTPLFSYGTTVWSIKRSKTALGFSIDICATMLIASILRVSYYLITPYDVALL
FT                   RQSLVMIFIQLILLYTSLCYRPEEYKYESLKPVERFGQLSQDVWQEFFPLCSMGAGWKG
FT                   IWQAMSWNSFAGYMEKMLLVALYKFLKFFDPGYQRIGAFWQWNNPRYFWLFLLWFTCGQ
FT                   FLMTFFIARVMNLEWLGQWLGSFIGSLGLLIEALLPLPQISILHTLKSVQGFKLILLVS
FT                   WLCGDILKISYLVFGAKNISMIFFLFALFQMGLDIYIAFIYVYYKYYFPKYRRKSEPPR
FT                   IEMQMLLSNGEAAAFSV"
FT   CDS_pept        complement(745828..748002)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18080127"
FT                   /locus_tag="ADR023C"
FT                   /orf_name="AGOS_ADR023C"
FT                   /product="ADR023Cp"
FT                   /protein_id="AAS51943.1"
FT                   /db_xref="HOGENOM:HBG058704"
FT                   /db_xref="HOGENOM:HBG103933"
FT                   /db_xref="InterPro:IPR013943"
FT                   /db_xref="UniParc:UPI0000252A8B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75A95"
FT                   /transl_table=1
FT                   /translation="MLGARNLRPLCCDRVVLGSRRIGSGIRCGSTETANVADEMTRNTL
FT                   DSVLATSEKLSSSVRRWPRPRRAAAARGAGSEKHIVLTGPFSMGLQEAGATELPPRLAH
FT                   GLERCLFQPLSVVPLRDRRSGVYNFEPFIERVIKVQDFDFEAIADFVPPSRDLRLLERA
FT                   KEGQARYVSSTSAMSGVLSHLHYLLSNFRPLNGRHLSATLLRKDAQVTKCCKMTSSMLL
FT                   QRRSQAPPIFSLSSDSSADREIILSQLGHALEALLTTDQADFARIYDKGKRAQPGSQPL
FT                   GKGHATSAFRFNKHGRFLLRSQLDAHDPKLPGTGVFDLKTRAVAAVRHDLDYVSQNGNT
FT                   TGYQLMRRSGQFESYEREISELVRNAMLKYSFQARIGAMDGIFVAYHNISRIFGFQYIP
FT                   LEEMDYIIHSSADRAAAMSLTRRESALQELFNPVEYVTRYRFENTARETASTLAQAEFN
FT                   YSMRILEHLFDEITSYFPESVPTVRIMLKTVEHKDKPPSMVAIATPLDTKQSEQLEKFN
FT                   LQREFLNSDPVSFTRHVNELHDFYHSVMPGSVKFTVSVKHSMSQDQKPVWTRSSAFFKR
FT                   NKADQQKLMDAASSDYYGPHWKHPYFFSPEDVSRWNIRVSISNPVAANAREYAQLLQDD
FT                   IAFLDGQAVVKKKETISNGKHGKMATAAKGSQLDQVSQLQALLRAFGIKGQKDEQVTME
FT                   RDRRSKNKYLLMWDGQKRQRVTTDPKDLTR"
FT   CDS_pept        748361..749779
FT                   /codon_start=1
FT                   /gene_family="HOG000248644" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15753479"
FT                   /locus_tag="ADR024W"
FT                   /orf_name="AGOS_ADR024W"
FT                   /product="ADR024Wp"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS51944.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG058705"
FT                   /db_xref="HOGENOM:HBG397801"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniParc:UPI0000252A8C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75A94"
FT                   /transl_table=1
FT                   /translation="MHFSKAIQTTRQIGRGLLLARKQSNGPMGLRPGAQQPDAAGEQVH
FT                   SAGSVVNTMFNKHSTTVTYTWPGREEPQTVAFSNVFLRDASRSPASVDAVSSQKLFTTG
FT                   AVLANEQATVPHSVAVTADGRAIEIGWGDGDMYAYPLEFIHQHSGTEPLQRTPRQPPVL
FT                   WDKQLLKTNIADLLSIDYESFMAPDCDGKLYQTLVNLQKYGISFITNIPDETTSELDSW
FT                   YVKTIAERIGNIRHTFYGELFDVINKAGAENIAYTNVPLPLHMDLLYLETVPGWQLLHA
FT                   IRNSTGATDLGMNYFADAFHAARYVRETDSDAYDALTHMPVNYGYNRDDKRYYRSRPVI
FT                   EEHEFGEGTSLSSQFNRLIKCVNYSPPFQKPFTYGIWEKPKGAEVSTPQGKLTERFVFR
FT                   DFQRGLRLFEQYINNPENQFRVKLPEGTCVIFNNRRILHARTGFTGERWLKGCYLDSDS
FT                   VLSKLQYLEEKYGG"
FT   CDS_pept        749923..751017
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15753480"
FT                   /locus_tag="ADR025W"
FT                   /orf_name="AGOS_ADR025W"
FT                   /product="ADR025Wp"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="catalytic activity"
FT                   /biological_process="DNA metabolic process"
FT                   /cellular_component="chromosome"
FT                   /protein_id="AAS51945.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0006259"
FT                   /db_xref="HOGENOM:HBG058706"
FT                   /db_xref="InterPro:IPR002815"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013049"
FT                   /db_xref="UniParc:UPI0000252A8D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75A93"
FT                   /transl_table=1
FT                   /translation="MVSLRHSLRELMDEHGTRGKLLNALQHTAKREIQLGPRTPVDRIE
FT                   AEVGMALDLIKNAMQLNAVPVVIKLVRCDGRCSRIVYPARGSTTSAGARRAATFVSVLK
FT                   TVHTRMRSRQTATVRDVFYGNVELYGRQQVVVDWLVALEQCFGVEKSVFRILAAQKGLV
FT                   HVPVPLEVEGQELKGVGLIPYVSDSSCVSCKQWDAVEAVIVVEKEAVFHRLTRAAAYCS
FT                   NKIIITGKGYPDQLTRVFLYRLLASAPRNVAVRAIADSDPYGIDIVLKYCGASPAPGMQ
FT                   RFDYGGIFIRDLIDAGVCANPVTEGCTLQDMSLREWKMAQKMLIALCNEGERGYLSNSG
FT                   AASIRRELQWQLLSFKKGEMNAIM"
FT   tRNA            join(complement(751113..751148),complement(751037..751072))
FT                   /gene_name="tRNA-Pro"
FT   CDS_pept        751856..752485
FT                   /codon_start=1
FT                   /gene_family="HOG000000781" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18080128"
FT                   /locus_tag="ADR026W"
FT                   /orf_name="AGOS_ADR026W"
FT                   /product="ADR026Wp"
FT                   /biological_process="transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS51946.1"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG334070"
FT                   /db_xref="HOGENOM:HBG372468"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="UniParc:UPI0000252A8E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75A92"
FT                   /transl_table=1
FT                   /translation="MLYPVVFLIGLLSGLAAVSADFSTRTPMSVMLPAFSRECVYFDLK
FT                   EGQDHILMSYQVLTGGNFEIDFEITAPEGNVIGSDTRSKYGDFHVYSWGVGQYSFCFTN
FT                   SYGTALKKVEFTLGLQEQERKVEKEDPEDLLALDSIDEINRNFDHITKIMAYLRAREWR
FT                   NMSTVKSTESRLVWLSVLTALVMIGVSAGQSIMVQFFFKDRHRNYV"
FT   CDS_pept        752725..753951
FT                   /codon_start=1
FT                   /gene_family="HOG000214998" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18080129"
FT                   /locus_tag="AGOS_ADR027W"
FT                   /product="ADR027Wp"
FT                   /function="binding"
FT                   /protein_id="AAS51947.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG013152"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019585"
FT                   /db_xref="UniParc:UPI0001DB292D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75A91"
FT                   /transl_table=1
FT                   /translation="MSDEESNYVEPAVNKVPNYEVSEHAFLLTQPKLHNRHPESLEFVM
FT                   KAIREEKMAPYYKYLCEEYLPSGLIEWDQALYDSLVDANTQDITELKEHLQEIEEKDEG
FT                   ELEKAQCWIKLGEYYAQIGDRKNAEETLTEAINKAVSMGAKIDIMLTITRLGFFYNDQV
FT                   FVKQKLAQINSMIEKGGDWERRNRYKTYKGIHCLAVRDFKEAALLLVDSLATFTCVELT
FT                   SYENIATYASVAGLYALERVDLKAKVIDSPELLSLMSTTPALQSITSLTISLYTSEYSS
FT                   YFPYLLETYDNVLMPCKYLNRHADCFVREMRRKVYAQLLESYKTLSIKSMANTFGVSVE
FT                   FLDKDLSKFIPNKQLNCIIDRVNGIVETNRPDNKNAQYHQLIKQGDGLLTKLQRYGAAV
FT                   RLTGTDRSV"
FT   CDS_pept        754378..756876
FT                   /codon_start=1
FT                   /gene_family="HOG000113808" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775856"
FT                   /locus_tag="AGOS_ADR028W"
FT                   /product="ADR028Wp"
FT                   /protein_id="AAS51948.2"
FT                   /db_xref="HOGENOM:HBG124674"
FT                   /db_xref="UniParc:UPI0001DB292E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75A90"
FT                   /transl_table=1
FT                   /translation="MTKLCAGPRRFTTRHRMKDTIALLLVFLSFNHLIALCILGLFAAA
FT                   SSSEGFLTECVSQLYWRWYGRPGKNGALSIFGFTLRKPHLERVKNAKRAPGALAESVPT
FT                   RPAPGSPAMLPKRALLALELFMAWMLQRFGRHHFKVPVENLAMSIVASSLVNDRGELLS
FT                   YATTCSVTYAVTTRIVWHIGVYYKWPYLFRLFPAEGEAIEKHLAPPYTHVGSASASTFE
FT                   HYILLLKYIISFHVVAWQFYASISRRPTPTPSLLNVKPLRMDSAGRFALNPASESKANS
FT                   AEQSTVTGGPCHEKPIVTAASQNSLTVSDGSCDSPRLSSHLLQNPLTNAEINQDSSVSL
FT                   VPTFTDRVVDFNTSAITTTGVANFDEKAKVAATAEHKEDSTETPGLFAYYTEVFLTRAA
FT                   NEESGFSSELDTCISRVNQFNLIQKLLRAKDRFVLPPLWATFTVLKVLFLRNIFWERLP
FT                   PALGPRKPSPRQSVILKPQELPANEEYYSDYKKLQLVAPAPTESTVCITEIGKTTATFS
FT                   VSNMARGELLVLVNELLWPYFSSAVTDNSTSRLCVVINGLVPACTYAIQFVNRIDGVGD
FT                   HLFADVLLQTEDKDGTKRSEQAPVTFECRPILSPLMTLKRSVLYTNARLAEERAKLKKA
FT                   KKETARKINALRQDVDHMKSKIESNSSQDEKSTFKIDNLKTVLHKNEDQILALEASLAA
FT                   IHDEQTALETEYLRSKENRLQRRSEYDELDATFKRDILSAHERLSKLQSDLEQLHAKRE
FT                   RLLLRKERLQNDLGQYTQECDKFREQFLRRRERARADKRQRHLQEADELELKAKGLEQD
FT                   ISRLEAENKAMARLIRPAEY"
FT   tRNA            757087..757155
FT                   /gene_name="tRNA-Thr"
FT   CDS_pept        757445..761089
FT                   /codon_start=1
FT                   /gene_family="HOG000246685" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15753481"
FT                   /locus_tag="AGOS_ADR029W"
FT                   /product="ADR029Wp"
FT                   /protein_id="AAS51949.2"
FT                   /db_xref="HOGENOM:HBG058708"
FT                   /db_xref="InterPro:IPR005554"
FT                   /db_xref="UniParc:UPI0001DB2945"
FT                   /db_xref="UniProtKB/TrEMBL:Q75A89"
FT                   /transl_table=1
FT                   /translation="MDNVVVHRSCIDNQKLLAMAPTKRNASAVEDASDVSSTKKALIET
FT                   SGQGAAEQIEEAMDDATDSSSGEEEDIGEQKRSTRKAGVGAQDIQIARETAELFKSNIF
FT                   KMQIDELQEQVKLKESHILRVEKFLHRLYDLLQGVPEWEGRGLAEVEAFFKDKAVCVPF
FT                   CDPKPASSTPYKFGYKTPSVALIGSFALKTAIYQPQGSSIDVLLTMPEELFEKKDFLNF
FT                   RCVHKRSVYLAYLTYQLSLALKKNRLEFLHLEYAHRNSDPLQPMLRISCNEASDSEYNF
FT                   HKTKFSVNLIVGFPYGVFEPKKLLPTRNCIRVGEDNSTPTPFYNFSVLSSCTHEHYLKY
FT                   LYKTKKQTEAFKEACVLGRLWLAQRGFHSDMSHAALLGGFGNFEFAILMAVLLNGGGVN
FT                   GNKILLHGFSSYQLFKGIMKYLATMDLCSDGYLQFHSDLDSVSNVPTSKYVEEGFRTPT
FT                   LFDKTTKVNILSKMSVSGYHMLKLHAQQTLAMLNDVVRDQFAGIFLTKLDKIPSVSYDL
FT                   SYDLEFPSQEELLSKFGPLEKVRFISFEEFLVNKLANVIRIALGDRIRAEEFELVGHKT
FT                   KFPINRRKPAGPMNFSSIKIKLLVNPVESEKLVTRGPANKEEQSAEAAEFTSFWGKKAS
FT                   LRRFKDGSIIHSCVWSTSANQPVITSILDYVLKLHISDDVKLSNAITRQFHSRLPQPNL
FT                   PGSLKLSVLNSTSFHQLKRSFDNLYKIVFQLKLPLSVKSILPVGAAFRYATMCQPVPYA
FT                   YSNPEFLQEVILEFETSPKWPDEISALEKAKTAFLLKIQEQLTAQQGDKYRCYFARDES
FT                   IPYNLDIVTLNILTPEGYGFKFRVLTERDEVMYLRAISNARSELKQELERTFLKFTSKY
FT                   QASIRHTRTLELLSHSFPFYSPVVRLFKQWLDSHLLLGHLPEELVELIAIKPFVEPYPY
FT                   AAPGSIENGFLKVLKFLSEWNWKEDPLILDLVRPEDSDDLETSIGASDLDSRAMKKLSE
FT                   KLTLQQYKTIQANFRSLRNGDPHGMQLQFFVASKNDPSGILYSTSVPLPIATRLTALAK
FT                   VAVNLIQVHGLNTQSINLLFTPALKDYDFTVRIRSPTPLRLSSGVLSPDGFKNLDEQPT
FT                   QFPKDLSTLSEKMDCTYQLVKYLNMKYKNSILFSSHLHVGVHGGPRGDENVITGLIRPA
FT                   FKSPFRFKANMDCNARPLDPDTVKLNSDAVFREIATFGKELVVSFESS"
FT   CDS_pept        761419..762237
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15753482"
FT                   /locus_tag="AGOS_ADR030W"
FT                   /product="ADR030Wp"
FT                   /protein_id="AAS51950.2"
FT                   /db_xref="HOGENOM:HBG058709"
FT                   /db_xref="UniParc:UPI0001DB2946"
FT                   /db_xref="UniProtKB/TrEMBL:Q75A88"
FT                   /transl_table=1
FT                   /translation="MDSSISSATPVCSIGPFRQQLVEHIGLLGYTVIVLSYIKFGGSIV
FT                   VFLFRLLLQSALLSPFPNRQQLVLRFGGASGRTEGEDEQTPGRGARGAEAEAEDMTKEF
FT                   LQRIQCALFHAAFTFNCLALVTWIIWPADFQELLGMYRYEGYPGPANTPLPLDNYVMQG
FT                   EWHGKWFFQLIGEAVPASNIGGNLMAVTYQLLILCLQFGLYMLSCVYFSPLTKTQLPGY
FT                   DGSGCTQPAGEGRINVAHINPVEVFRVIHGTTAHFRQGAGARNASPTSMV"
FT   CDS_pept        complement(762358..763452)
FT                   /codon_start=1
FT                   /gene_family="HOG000230845" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18080130"
FT                   /locus_tag="ADR031C"
FT                   /orf_name="AGOS_ADR031C"
FT                   /product="ADR031Cp"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="protein dimerization activity"
FT                   /protein_id="AAS51951.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG285589"
FT                   /db_xref="HOGENOM:HBG539019"
FT                   /db_xref="InterPro:IPR001514"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR011261"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="UniParc:UPI0000252A93"
FT                   /db_xref="UniProtKB/TrEMBL:Q75A87"
FT                   /transl_table=1
FT                   /translation="MTCSRNGALTSDLASLSAPRSPRVLSRAFPMSNIVNIEYNRVTNT
FT                   TSTDFPGFSHQKECAWDVDEFRRTMDVQIKSLDEREANFDLLRVDTSIANAFRRIMISE
FT                   VPSVAPEYVYFFNNTSVIQDEVLAHRIGLVPLKVDPDMLTWVDKSLPEAERFTDENTVV
FT                   LSLNVKCTHNPDAPKGSTDPKELYRNAHIYARDLKFEPQGKQLETFAKCPVVPADPDIL
FT                   LAKLRPGQEISLRVHCILGIGSDHAKFSPVATASYRLMPYINIVEPITGPDAEKFVKCF
FT                   PPGVAAINEKGEAFVQDARKDTVSREVLRHPELEQKVKLGRVRDHFIFNVESAGAMTPE
FT                   EIFFKSVRILKNKAEYLKNCPITQ"
FT   CDS_pept        763586..764701
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18080131"
FT                   /locus_tag="AGOS_ADR032W"
FT                   /product="ADR032Wp"
FT                   /protein_id="AAS51952.3"
FT                   /db_xref="HOGENOM:HBG058710"
FT                   /db_xref="InterPro:IPR002687"
FT                   /db_xref="InterPro:IPR012976"
FT                   /db_xref="UniParc:UPI0001E6BA0D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75A86"
FT                   /transl_table=1
FT                   /translation="MDLLEGLDDPPSPQDAHVSAAEAPSGALQQRLHALLQCAPRSRPS
FT                   ALPLLPELHEALAAGQLDLGTLGQLLPVLRDEAADVYRQLEARYRPVFPELAELVPSQR
FT                   TYVRVLRALETGAPLDELLTREQAMLVAMTRPQAPRADPARWPRELAPHADRHEQLHTA
FT                   VDAIDAHIVRQAHRLAPTVTALVGPVVAAALLSHAGSVRELAQVPACNLAAIGAPRHAA
FT                   HARRTDASGVRLRGHVWDTPLVQEQPPALQRQALRMLCARLALAARVDASAPDPALAAR
FT                   WRADILARIAARAAPPAPAAAAPLPVPADAKPRRRAGRRFRAHRSKFRLSAARQLQNRA
FT                   AFGVPERTAVDGFGEEIGLGLSGAPAAPPPR"
FT   CDS_pept        765140..766873
FT                   /codon_start=1
FT                   /gene_family="HOG000201972" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15753483"
FT                   /locus_tag="ADR033W"
FT                   /orf_name="AGOS_ADR033W"
FT                   /product="ADR033Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS51953.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058711"
FT                   /db_xref="HOGENOM:HBG396340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="UniParc:UPI0000252A95"
FT                   /db_xref="UniProtKB/TrEMBL:Q75A85"
FT                   /transl_table=1
FT                   /translation="MFSGRGNNVRDVDALAQDIGQLSFEGEMENRRHIVIDPPHTPSRY
FT                   LQRTPNGKSPAGRQGGYLTVENADYSGMDVDERPRDDIDLSRSPKKLPMDFHKRASSTK
FT                   TKRLVSVCQMFFLDYYCDMFDYVISRRERTRQVMNYLEQQRAQGLHSAQEISEEWQNYL
FT                   YRETDILRKRRLKPKNKDFEIITQVGQGGYGQVYLARKKDTKEICALKILNKNLLAKLN
FT                   GTDHVLTERDILTTTRSEWLVKLLYAFQDPHSLYLAMEFVPGGDYRTLLINTRFLQAPH
FT                   ARFYISEMFCAVDALHKLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMR
FT                   IRLEEVKNLEFPEFKETSMDYRRKMYHRVREKELNYASSTVGSPDYMALEVLEAKNYDF
FT                   TVDYWSLGCILFESLVGYTPFSGSSSNETYENLRRWKQVLRRPRCENGRPAFSDRTWEL
FT                   ITRLIADPINRLRSFEHVKKMKYFAEIDFANLRSMSPPFIPQLDSETDAGYFDDFTNEA
FT                   DMAKYADVFKRQDKLNAMVEESSNSSKLVGFTFRHRKGKTGSSGVLHNGSEHADPFATF
FT                   Y"
FT   CDS_pept        join(767013..767200,767267..768746)
FT                   /codon_start=1
FT                   /gene_family="HOG000247909" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775857"
FT                   /locus_tag="AGOS_ADR034W"
FT                   /product="ADR034Wp"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS51954.2"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG058712"
FT                   /db_xref="InterPro:IPR006767"
FT                   /db_xref="InterPro:IPR006768"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR011151"
FT                   /db_xref="UniParc:UPI0001DB2948"
FT                   /db_xref="UniProtKB/TrEMBL:Q75A84"
FT                   /transl_table=1
FT                   /translation="MFIPTPILGLAIGGQKFTVRVQACYAGAQTEKKNINIYIYSFSSV
FT                   KGTVSEAGHSSTMPKQKVLLLRSSSATLDEVLKKAADLNSKSGPFDATIITGAVLTDLA
FT                   FKPANPVSFPVYVTNGGQFVSELRGSHTICDKLILLNEHGIYELPSGMKIGYFTPSERI
FT                   EPSAVDAELEIFKKVGRLDILLTKEWPKSVRSKLEEVSGTDTVDQLVISSKPQYHFATL
FT                   GDKYFELEPFGWDRSSMPDITRFINLATFGSGEKWAYAFNITVGTDQEASVPTNLTTNP
FT                   FITMDRPKRDLDSDPLPPPKKRTKVLPAACHFCLSNPSVEDHMVISIGKHSYLTIAKGP
FT                   LSVPRGEMTFSGHCLIIPIDHVPKFNSASPDQTTSAIMETEMGKEVMRYESALVNMNYK
FT                   KFDMSTLVFEINSVNSVHFHKQVVPVPKYLIGSFTTALDRQLHINNEKFKKNANFTFQD
FT                   FEGLQHPDFLALVNDPKTNYMQFTVYETHKASPKVFIATFKSEDSIDLQFGRRVAAFLL
FT                   KLPKRVIWNSKACLQSKEEEEIEVKDFQRSFQDFEFTE"
FT   CDS_pept        complement(768814..771330)
FT                   /codon_start=1
FT                   /gene_family="HOG000211156" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15753484"
FT                   /gene_name="MRD1"
FT                   /locus_tag="ADR035C"
FT                   /product="Multiple RNA-binding domain-containing protein 1 "
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="AAS51955.2"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG012874"
FT                   /db_xref="HOGENOM:HBG412223"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0001DB2949"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75A83"
FT                   /transl_table=1
FT                   /translation="MSRVIVKGLPIYLEEARLRAHFLKRLQQQGRGSEDQITDVKIVKD
FT                   KSGNSRRFAFIGYRSEQDAFDAIEYFNGSFIDTARIEVAMAKSFADPRVPTPMREKRRE
FT                   ALKRLREREDRILAEKRQKQTKPQHGIDAEISKNKQLQEFIETMNPKMAAAAANPMARA
FT                   AEQPASANPLLSALHGAEDDEEVDMFQLSEQESDDEYTDLHQRPQSAEEDELEEPAVGQ
FT                   DLDAAPAPDAAEDGMATNQEVSDLEWLKNRRIRIRDGEDAEAAPAPQEQAAEEPAEQEV
FT                   PQEDEVSAEEAALTKIRATGRLFLRNILYDATEEDFKQLFSPYGELEEVHVAVDTRTGQ
FT                   SKGFAYVLFKDPEHAANAYIELDKQIFQGRLLHILPADAKKTHRLDEFDLKNLPLKKQR
FT                   ELKRKATAAQQTFSWNSLFMNQDAVLSSVAAKLGMEKSQLIDPENSGSAVKQALAEAHV
FT                   IGDVRKYFEARGVDLTQFEKFKKVTERDDRIILVKNFPHGTTREELAELFLPFGKIERL
FT                   LMPPSGTIAIIQYRDVPAARGAFTKLSYKRFKEAILYLEKGPKDCFSREPRGDELLEGD
FT                   AAPEDVKEIKKSVEDVMDADSKTPSSEATAIDGPTVSIFVKNLNFSTTSAQLAEKFKPF
FT                   SGFVVAQVKTKPDPKNSDKKLSMGFGFIEFRTKEQAGAVIAAMDGAVIDGHKIQLKISH
FT                   KQSSLPKTSKGSKKKISGKIIVKNLPFEATRKDVFELFSSFGQLKSVRVPKKFDKSARG
FT                   FAFVEFLLPSEAENAMDQLQGVHLLGRRLVMQYAEQESDDVEEQISKMTMKMKKQAAVS
FT                   KMGALRNSGKRKIDMSDDENDGLNGF"
FT   CDS_pept        complement(771519..772541)
FT                   /codon_start=1
FT                   /gene_family="HOG000212132" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775858"
FT                   /gene_name="ANT1"
FT                   /locus_tag="ADR036C"
FT                   /product="Peroxisomal adenine nucleotide transporter 1 "
FT                   /function="binding"
FT                   /biological_process="proton transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="peroxisomal membrane"
FT                   /protein_id="AAS51956.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005778"
FT                   /db_xref="GO:0015992"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG329967"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0000252A98"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75A82"
FT                   /transl_table=1
FT                   /translation="MSFENAVIGATASSLANIAVYPLDLAKTLVQTQLKDEFVEAGEEA
FT                   GEERAGSRRQNRIKPIALRSPQAAEQYKGALDALQRIYGAEGVAGLYRGLGSSTVAGFI
FT                   QSFSYFFWYTLVRKHYFRLKQARGGDARFSTPEELVLGIVAAATSQLFVNPINVVATRQ
FT                   QTRGQAAGAADMRTVAREVHAENGWRGFWAGLKVSLVLTVNPSITYATYERLREALFPT
FT                   PAAASHLVDSAALLSPGQNFVMGVLSKIVSTVLTQPLIIAKASLQRSGSCFQDFHQVLH
FT                   HLYSTEGPLSLWKGLGPQITKGVLVQGLLFMFKGELTKMLRKLMFYLALLRSSRRALKG
FT                   "
FT   CDS_pept        772903..773661
FT                   /codon_start=1
FT                   /gene_family="HOG000093327" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15753485"
FT                   /locus_tag="AGOS_ADR037W"
FT                   /product="ADR037Wp"
FT                   /protein_id="AAS51957.2"
FT                   /db_xref="HOGENOM:HBG358983"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR019053"
FT                   /db_xref="UniParc:UPI0001DB294A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75A81"
FT                   /transl_table=1
FT                   /translation="MSQYIGKTISLVSNNDNRYVGLLESIDSEQGVVTLNNVRCFGTEG
FT                   RRGGGADEVYPNPAVYNSVVFNGNDVKDLSILDCALEEVQPALPPQVPAAVAGYGVYAP
FT                   AASEGAAPAAAPAAAAAPAAAAGAVAAGAAGRAGADFDFEQSNARFSKGAAAGTAGAEA
FT                   PAAAAGEEVFYDKKSSFFDSISTSTETNTNMRWKDERQLNMDTFGQASARPRNGRGWFR
FT                   GRGGRGGRGRGRGGRRGGGGGGARPAKVDF"
FT   CDS_pept        complement(773742..774326)
FT                   /codon_start=1
FT                   /gene_family="HOG000078523" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15753486"
FT                   /locus_tag="ADR038C"
FT                   /orf_name="AGOS_ADR038C"
FT                   /product="ADR038Cp"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="AAS51958.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG530048"
FT                   /db_xref="HOGENOM:HBG742014"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0000252A9A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75A80"
FT                   /transl_table=1
FT                   /translation="MSSVKPFEATDLFKLNVINLDPFTENFPIEFYLEYLILWPSLFFK
FT                   SVETTSHTARDAVSGYMMAKTEGKAAEWHAHITAVTVSPSFRRIALASMLCNVLETTTD
FT                   FKPHEVNFIDLFVKCNNALAIRLYEKLGYSVYRRVVGYYNTAEEYRLHSLKVLREDKDA
FT                   FDMRKAMPRDCGRSIRPNGRKHLCHPHEVRF"
FT   CDS_pept        774758..776269
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928867"
FT                   /locus_tag="ADR039W"
FT                   /orf_name="AGOS_ADR039W"
FT                   /product="ADR039Wp"
FT                   /protein_id="AAS51959.1"
FT                   /db_xref="HOGENOM:HBG058713"
FT                   /db_xref="UniParc:UPI0000252A9B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75A79"
FT                   /transl_table=1
FT                   /translation="MFRTNLFQNKIDAYSNKTAKRKLFHLYEGDDREVFQYLSDQGTLK
FT                   NPDVLDTYLDNAAPDVRDFHQFVGRLLCLYDVTHDQYVYCATEFRQNARNILFPRLERI
FT                   FEIDSKMIGALPLRRCYKRIKQRFDSDLQEVVYNACEQRRAIEGNWIERQVQADDPAVN
FT                   NRFSAIINWENQECLDAGAYDRALQDNIVTWFVRMNKRVIEKLSARTSKFKTLCKSWFS
FT                   VSRNYCYWSVLECVMQSEHVYYEFMLEKLKKKADLMTNSPQVEGEITIADVQLVVDQFK
FT                   ELETSFSALEEDDNLLEDISSSDSSISSPQTLIPITNQAHWKKPKPHIEFAGKVTRVYH
FT                   PFQTPGDYLLEVPHTDSLAPGPLDIDTTYQQFSTRFRDLMVIYLRWDFVQKSGQSPGTG
FT                   PFGWFFLMFRNGDPVPVYITERVHKVVFEKPEEDENVPCDEEQHIKMEWPNELKMPVCN
FT                   TKRWEGRSVYIPMDEFAKDLVFRSKEAAVNRYYHTLGQLRELECL"
FT   CDS_pept        complement(776327..777748)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15753487"
FT                   /locus_tag="ADR040C"
FT                   /orf_name="AGOS_ADR040C"
FT                   /product="ADR040Cp"
FT                   /protein_id="AAS51960.1"
FT                   /db_xref="HOGENOM:HBG123906"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016520"
FT                   /db_xref="UniParc:UPI0000252A9C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75A78"
FT                   /transl_table=1
FT                   /translation="MEDPPGSVKVVVAQFLQKYGYQKTLGHFLNEAGLSLGALQSGDAA
FT                   EDLETIIGERTQYLERARNDEPSQLDVGVSSIACEQLPRWNYAVQWAAARELQGANGLV
FT                   ISADLSGAQPVLATSSREVLQYGSTLQLEKRSVSSIGCIRKFGWFAGPRGSRERYALGM
FT                   DGSLALLGADGVPLRSWRLHGRMITHAAFFVTTERKILCFTYGLDGYIRLHEFDEEMEE
FT                   PKSMDEYKLVNSCTGFQLAQTDDDEPTLYYTREDHTHLFVLQVHDLKLQEVYRIALNAA
FT                   QFSTHSFSVRDMIVVNFEHIYAADDRNSHLPWSGPGSVLIAATSHTPYMRLIFVELPNT
FT                   KELPVSSGVPHTNSATVPNLLDSFTGNSGTTPHQKPAVNSGPKVYYDKVKRNIATPVPQ
FT                   NLYSQPILALCTVSSGLLVGADDGVYAVDLHLGNTWKLALPNGNERVKAMALHDDFLLV
FT                   SLSNKTVFIWEAQKD"
FT   CDS_pept        778176..780617
FT                   /codon_start=1
FT                   /gene_family="HOG000224125" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18928868"
FT                   /locus_tag="ADR041W"
FT                   /orf_name="AGOS_ADR041W"
FT                   /product="ADR041Wp"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="DNA-dependent DNA replication
FT                   initiation"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51961.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006270"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG409874"
FT                   /db_xref="HOGENOM:HBG546212"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008050"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="UniParc:UPI0000252A9D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75A77"
FT                   /transl_table=1
FT                   /translation="MNAALPSIQLGIDYGRIKEEIEDFLVHFKGSSSTEDAGEIEMEED
FT                   MVGAGPKYLDLLQQVANRELTTLYVELDDVAAYQTMRGEAVDRMPGPQLCELILENALR
FT                   YTELFSEVVDKLLPPPTKEFDHHDDVLDVIVHQRQLRNQRQITERREELEQMDEDAGEE
FT                   QLNELARQQDEGQEDLFPPMLMRRYNLYFTPLTKFQGVGKHVRSHYGPFSAREVKGSHL
FT                   GKLITVSGIVTRISDVKPAVLVTAYTCDQCGAEVFQEVNKRTFTPFLECTSRQCQQNQN
FT                   KGQLFMSTRASKFSAFQECKIQEMSHQVPIGHIPRTLTIHVNGPLVRSMVPGDIVDVTG
FT                   IYLPAPYTGFKALKAGLLTETYLEAQYVRQHKKKFSSFEITSDVEKRVMSIVQQGDVYT
FT                   RLAKSIAPEIYGNLDVKKALLLLMVGGVHKTVGDGMKIRGDINICLMGDPGVAKSQLLK
FT                   SICKITPRGVYTTGKGSSGVGLTAAVMKDPVTDEMVLEGGALVLADNGICCIDEFDKMD
FT                   ESDRTAIHEVMEQQTISISKAGINTTLNARTSILAAANPVYGRYNPRLSPLENINLPAA
FT                   LLSRFDIMFLLLDMPHRENDEKLAEHVAYVHMHNRQPELDFEPIEPAAMREFIAFAKTK
FT                   RPIMTQEVNELVVQSYIRMRQDSKNVTDPKQQFGQATPRTLLAVIRISQALAKLRFSDQ
FT                   VDVEDVEEALRLIQVSKDSLYNDTQTRADDETPTTKIFTIIKKMAMETARLNKNLPMDT
FT                   ITKIVRSRGFTQQQLDACVEEYTYLNVWHKLEEENALKFVGGSEYDVEMTPSQDTEMVD
FT                   A"
FT   CDS_pept        781086..782414
FT                   /codon_start=1
FT                   /gene_family="HOG000141807" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928869"
FT                   /locus_tag="ADR042W"
FT                   /orf_name="AGOS_ADR042W"
FT                   /product="ADR042Wp"
FT                   /protein_id="AAS51962.1"
FT                   /db_xref="HOGENOM:HBG058714"
FT                   /db_xref="HOGENOM:HBG203913"
FT                   /db_xref="UniParc:UPI0000252A9E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75A76"
FT                   /transl_table=1
FT                   /translation="MPYPVISLKPSYNSIIRGCPGVPQTLPRIECELRIRSNDGRPMLI
FT                   DRIEVLLKTSEVLHSSVPAFTSKARLEKDIVHYKRSIRLSDKKIIGIDIPLTIALPDDI
FT                   KDTNYNKFGYTFTSFECNVLYFPKTEKHAVANATMNTESFTTVVNVEKYNLFASPSLFP
FT                   PLRRKFLSPDRKFKIKYCIQNPCLTTDDLLHINLIIVPNLSRNYPGSYSNKLFNKKVKL
FT                   KSIVFDVKEVLEVYDSHADVKENTLQSLIKPFNTTINEAGIEVTSDIKIYTKNVYFKEF
FT                   ERCMNEPAVMFQLPHNEPNLDAPIPETVLLKGKSKNVQAFQYHCSITSRGQLFSITHGL
FT                   SIKFKISNGKDFEIYQPLDVSAWPKVDINLVEKVIAHETEVAMHAKNFYDSFGGIRRNR
FT                   TTGALEYPPLPPVVYTADKNTLKHVGVMYNMDNKYSHKIPLIE"
FT   CDS_pept        782589..783311
FT                   /codon_start=1
FT                   /gene_family="HOG000203818" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775859"
FT                   /locus_tag="ADR043W"
FT                   /orf_name="AGOS_ADR043W"
FT                   /product="ADR043Wp"
FT                   /protein_id="AAS51963.1"
FT                   /db_xref="HOGENOM:HBG023306"
FT                   /db_xref="HOGENOM:HBG559171"
FT                   /db_xref="InterPro:IPR007143"
FT                   /db_xref="InterPro:IPR017898"
FT                   /db_xref="InterPro:IPR017899"
FT                   /db_xref="UniParc:UPI0000252A9F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75A75"
FT                   /transl_table=1
FT                   /translation="MSDRAPVNYYGSKNSTRSFNNALFEEVPLFDASTTPQQREVTETL
FT                   SEIYSIIVALEQVEKAYLKDGISSDDYTVSVNKLIAQYKTYLANNSDVQAVFGDLQQFR
FT                   QRWNINASNAIARLERGMPVTVEHGIQGSSGDNPASSSGTQFNAKAVAEATGNFITVMD
FT                   ALKLRLKAKDQLHPLMSELLLSINRVGPQDFEKRSKLVEWIVQINKMKANESLGDDEAR
FT                   ELLFDLDSAYKAFYTLLG"
FT   CDS_pept        complement(783328..784239)
FT                   /codon_start=1
FT                   /gene_family="HOG000112095" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15753488"
FT                   /gene_name="CWC27"
FT                   /locus_tag="ADR044C"
FT                   /product="Peptidyl-prolyl isomerase CWC27 "
FT                   /EC_number="5.2.1.8"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="AAS51964.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG058715"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="UniParc:UPI0000252AA0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75A74"
FT                   /transl_table=1
FT                   /translation="MSSEPSASGKCVLYTTKGELQIELWAKECPKTVRSFLQSIQDGKW
FT                   DGIVLGKVAEDAVWAPAGLCACSAEINGRLRFNRRGLVGMAPGQDQPFFTLASRGELDG
FT                   RAVVFGTLVGQSVYRLMEIAQGEVGDDGKTFVYPAEVRRAEVTIPYFDGLSGQKRRAEP
FT                   EQQAAPRPRKIATRVRLEYEESEDEASDPPLDVRIRAAHDILQDERLTDALHGDSPPPR
FT                   PAEAPRGSDSAPCVASPDRRAEAAPPTDGPPSRCASLAGPAPASPGPVTDLAPQLSARE
FT                   QGTLSSLAEFRCKRGGKNPLLG"
FT   CDS_pept        784481..785911
FT                   /codon_start=1
FT                   /gene_family="HOG000183658" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15753489"
FT                   /gene_name="TIM50"
FT                   /locus_tag="ADR045W"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit TIM50"
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS51965.2"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058716"
FT                   /db_xref="HOGENOM:HBG395644"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001DB294B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75A73"
FT                   /transl_table=1
FT                   /translation="MLHVIRRSRATSARQLPRVAGLLAGAAAVRSRTYIGTRILHEEQK
FT                   PKKPEPPNSILTEDMLARAGVDAERGPETEKAPAEDKAGESTETGSGAGKKKRARKTTT
FT                   EIKRERYANLFYLFSLTGLAGGAVYMSRDWDADEPEEERKGIENGYTPGLMYRRFKARF
FT                   DSLFTFFQEPPYPDLLPPPPPPPYQRPLTLVLPLEDFFVHSEWTQQHGWRTAKRPGADY
FT                   FLGYLSQYYEIVLFSSNYMVYSEKVVEKLDPIRAFITYNLFKDHCVYKDGIHIKDLSHL
FT                   NRDLGKTLIIDTDPNSVKLQMENAILAEPWDGKADDALLRYIPFLEYLVTQPINDVRPI
FT                   LNSFKDRHHIPEEFAERVEKLRAKFNADQKAKAGSGLSFLLNPGMASKPAKFPLDLIRE
FT                   EGEKNYVRFMKLIEEEKEKLKLQQEHMSAPTFTLKDMAEGNMPTPEEQMKMQLQKQKEF
FT                   EELYEKEKQKMQQQTKGQ"
FT   transit_peptide 784481..784507
FT                   /gene_name="TIM50"
FT                   /locus_tag="ADR045W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75A73 "
FT   mat_peptide     784508..785908
FT                   /gene_name="TIM50"
FT                   /locus_tag="ADR045W"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit TIM50"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75A73 "
FT   CDS_pept        complement(787956..790985)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20623359"
FT                   /locus_tag="AGOS_ADR046C"
FT                   /product="ADR046Cp"
FT                   /protein_id="AAS51966.2"
FT                   /db_xref="HOGENOM:HBG058717"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI0001DB294C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75A72"
FT                   /transl_table=1
FT                   /translation="MNHRDIESVVRVAAEPLPPLSGKTIQEIEDEYKDGPALAKNIRNN
FT                   PNDFTSKFLLDHVEFVRLTRGKVRTLHNLGRSGESRRYGPLKRREKKERMKSAKSGKSA
FT                   KTKAAGKTREARSAKTAKTAKARPASKGARAARRARGTAGAEDSAAVEGAEAAEGAGVE
FT                   AEPSAELELAAEPELAAEPELAAEPELATEPEPAMEPEHVAEKAAGGADALCVASAAPE
FT                   DDDDFRSVAEAAVLSASSATGAPSSCVEKDDEDDFKSIIDVDVQQGSSHAAEDIVVDVD
FT                   VTQFRAKSERGLNPIPEKDEDSESGAHEHASQHAEHSSESAKDDKSAAALSAKESAGIA
FT                   SPAPSGDDNKTAKPSNAATGDASTAPYWGSAVPGYESAAPEYESAAPAYESAAPEGPSP
FT                   LPSASELTTCGAKSSTVVDAGGDSAKTEVRGPTVGGSDASEAKSTCGAATATTTTAAGS
FT                   ATAGLDLKTEAGSACEPSATVSAIAFGNQQSPAGSVLTSTANETEGANSAHTDAVSTIK
FT                   ADDASGSIETKLHSADVPVQSPALDGSKADSIPGTASPGNVSPVKIGGNTAAGSAVATE
FT                   SDVVVSTDAGSGASSPGKTELEAGVSGASSPLRTSPLARSATNGALPINEAVLPPTGGK
FT                   DAQHCGTASSSKVGTAPISTTSEAPSGKAATTGKSTTSKKKKSDKKSKKANQSPISILS
FT                   LGQGTAKSTDKSADKPADKPVDNKPLTPVQPSNDAPEPAANPQVGEAQANGEPLLVNFM
FT                   IHGIGGNVKHFEPLMYMLDILGEKYLAFDLPGFGESDHWADGYPMMEVVESIKELLDIM
FT                   VLRPNHNNVRVRFFGHSMGCILLLHLAFRYGVNNLNAEKIILLAPPPPRTLKSKLDIVE
FT                   PYLNLSLTFFKPFLIMLLKFIRTNFDQMKGLNSSGIKFFFSNMGNKYRKLNHFYDGVAV
FT                   STKSITEYLLGWQDLINGPPLLDSGCTGHVLVGSEDKVCPANATHYPDYSFRVVVNTGH
FT                   NMFYDGASEALFEVYKLIYQ"
FT   CDS_pept        791199..792320
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15753490"
FT                   /locus_tag="ADR047W"
FT                   /orf_name="AGOS_ADR047W"
FT                   /product="ADR047Wp"
FT                   /protein_id="AAS51967.1"
FT                   /db_xref="HOGENOM:HBG058718"
FT                   /db_xref="InterPro:IPR019436"
FT                   /db_xref="UniParc:UPI0000252AA3"
FT                   /db_xref="UniProtKB/TrEMBL:Q75A71"
FT                   /transl_table=1
FT                   /translation="MGSPNKTWSVLAFLLKFYGLGVPAALARLVYSVVRRAGRRTLLGL
FT                   LGVEAARHADPAAAAALRASVGTCVPWWHARRSFERGGEVLEETYVVQDSDLFELGGPA
FT                   AAAAERTARAVYVSRPDKRHPDDPVVLYVHGGAFCEGLTPVDYALAAKITAAYQCTFPQ
FT                   AAMLALDYAGAEDGGFPLAALDVVQLYRAVCREFPRGPIWLVGSEAGGHLMLGLLQYLA
FT                   CADEEGLRWPRRAFCMTPWLNLTAWSADDAEYAAADADRSAVHGFLQRMAAAYCESLGE
FT                   GAQKNPYVNIEANLNADRWRRVLENTEIHVAVDDCDVLAPQARRFAEQLGLPVTDYDHD
FT                   ELVAATLSIYGYSEDWLLDNGLAFAMAKFFYLH"
FT   CDS_pept        792458..793720
FT                   /codon_start=1
FT                   /gene_family="HOG000160667" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15753491"
FT                   /locus_tag="ADR048W"
FT                   /orf_name="AGOS_ADR048W"
FT                   /product="ADR048Wp"
FT                   /function="glycolipid 2-alpha-mannosyltransferase activity "
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS51968.1"
FT                   /db_xref="GO:0004377"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG192431"
FT                   /db_xref="HOGENOM:HBG396033"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="UniParc:UPI0000252AA4"
FT                   /db_xref="UniProtKB/TrEMBL:Q75A70"
FT                   /transl_table=1
FT                   /translation="MQPGFGEPALRHHCRRSALAVTMYKNTRKRLMPKSAVLVRRYERQ
FT                   IKTVFVAFLAALMIMFLAREPYLGIGSGTRSDAKLQPAAAERLQGVRVLEDAGEPVRAA
FT                   FVVLAREEDLWSLVTSIRHVEDRFNARYHYDWVFVGATPLSEKFQTVTRSLVSGRARFC
FT                   VAQAAAREYPPAVEKERAGKATTALAESGVSIEQVLLWRFHAGYLALLPEMQEYEYYWY
FT                   VEPDIELYCDINYDIFRFMKAHRKQFGFILATEDPSDYSALWTEATAFAKQRADLLAHD
FT                   NLRNFVSNDGDTFNGCVFRAGFQVSSLDFWRSDAFRAFFEALDASGGFFYNLWTDVAVQ
FT                   TLAVALLMDRRDVHFFDSIGLYHREMRSCPFEQTIRRQNKCICNPEQDLTWETGYVCTR
FT                   RFMQARGLQLPKGIRRAARAV"
FT   CDS_pept        793917..795098
FT                   /codon_start=1
FT                   /gene_family="HOG000248323" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18928870"
FT                   /gene_name="LPE10"
FT                   /locus_tag="ADR049W"
FT                   /product="Mitochondrial inner membrane magnesium
FT                   transporter LPE10"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="ion transport"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS51969.2"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0006811"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG058873"
FT                   /db_xref="HOGENOM:HBG397594"
FT                   /db_xref="UniParc:UPI0001DB294D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75A69"
FT                   /transl_table=1
FT                   /translation="MLGLRLPVCRRAVMASPRACWRLWHSSTAAAAGMQDLSAVLQRNL
FT                   ALRNQSLYNQSSDTIRCSMFDSDGALIGGAAADIRREELIQKHGLLPRDLRKIEMARRH
FT                   DLVPIVLVRDRCIMVSLLTIRALVKSDTVLLFDPMGIGMDSVAHTRFVADLQTRLKNQG
FT                   APGLGKDPLPYEFRALESIFITALANLTAELRVHLAVTKGALHDLEYGIDKDKLKFLLV
FT                   QNKKLSVFHKKSLLMREMMDDLMDQDDVLSEMYLSEKMRGKPRDVADHSELEMVLETYY
FT                   TQVNEIVQSIEGAIANVRTTEEIINIILDSNRNELMLLGLRFAIGLLSLGSVMFVAALY
FT                   GMNLENFIEEGNVGFALVTATGLVLMVCLFRYSIKRLHKLQKMTLLGGQGRHS"
FT   transit_peptide 793917..793955
FT                   /gene_name="LPE10"
FT                   /locus_tag="ADR049W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75A69 "
FT   mat_peptide     793956..794906
FT                   /gene_name="LPE10"
FT                   /locus_tag="ADR049W"
FT                   /product="Mitochondrial inner membrane magnesium
FT                   transporter LPE10"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75A69 "
FT   CDS_pept        795307..796551
FT                   /codon_start=1
FT                   /gene_family="HOG000159782" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15753492"
FT                   /locus_tag="ADR050W"
FT                   /orf_name="AGOS_ADR050W"
FT                   /product="ADR050Wp"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS51970.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG055792"
FT                   /db_xref="HOGENOM:HBG325002"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniParc:UPI0000252AA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q75A68"
FT                   /transl_table=1
FT                   /translation="MQVEKYFSFQIFFIFLRESLEIVIIISILLTIVKQALLKPESASS
FT                   KYLGGGRLEAEEEVELNAALQEAGPLEAVENSQLYRRLKVQILSGGALGLLCCMLVGGL
FT                   FIVLFYYVGKDLWAASEHYYEGVLSIVASVIISFMGLFFLRMGRLRDKFRIKLASMLYA
FT                   QSSDPLAPSRRARKFSEKYALFILPFVTSLREGLEAVVFVGGIGIDQPLSSIPLSMLSA
FT                   AVVSYAFGRFFFASSGSFSLEVCLVTATCLLYLVAAGLFSKGVWQFELQHYVDLCNGQD
FT                   MSEVGSGPGSYDISNSVWHVNCCNGERDGLWMIFTAIFGWTNSATYGSVISYIIYWLAV
FT                   IGVLHVLKIEETLGYIPYVPIKWQARRIKKRLALIEKARALQSRPPSGSPPVYQTARLS
FT                   QESTNSNTLLLSSQE"
FT   CDS_pept        complement(796632..802091)
FT                   /codon_start=1
FT                   /gene_family="HOG000251581" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15753493"
FT                   /locus_tag="AGOS_ADR051C"
FT                   /product="ADR051Cp"
FT                   /function="ATP binding"
FT                   /function="biotin binding"
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="protein folding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="AAS51971.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0009374"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="HOGENOM:HBG304781"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR013817"
FT                   /db_xref="InterPro:IPR014084"
FT                   /db_xref="InterPro:IPR014085"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="UniParc:UPI0001DB294E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75A67"
FT                   /transl_table=1
FT                   /translation="MTDHSSTVGWTSQQWREFHRRASADASLARLLALAHAERDAGAAW
FT                   ISVASDEHIEHQWRVLQSRGDRQRLPLYGVPVAVKDNIDVRGLATTAACPSFAYTAAQD
FT                   ATAVRLLRDAGAVILGKTNMDQFATGLVGTRSPYGSVASAFSSAHAAGGSSSGSAVVVA
FT                   RGAVPLTLGTDTAGSGRVPAALNNLVGVKPTRGTVSCTGVVPACRSLDCVSVFARDVAD
FT                   AHRCLRILARPDGSDPYSRPSPADAPRRFGTCPVVGVPREAEWFGESQNAELFAAACQR
FT                   MRAAGARVVEVDPQPLLDLGRSLYEGPWVAERYAAMRAFYSGQPPRDTLDPTVTGIITS
FT                   AGGYSAADVFDHGLRRQKLVAAIEAELAGVDALLVPTCPLNPTLAAIAAEPLLVNARQG
FT                   MWTNFVNLADLAAVAIPAGFRRDGLPQGVTLVGRKFSDLALLELGSRLLRVEDAEPRRC
FT                   GALPAGQALCEDEVVSGSEERDSTVLLAVVGAHLRGLALHWQLDEVQAEFVREARTAPS
FT                   YRLYALPKTGPVLKPALRRVCAGKGAAIELEVYSVPEATFGRFVAMVPAPLAIGSVELE
FT                   SGEYIKSFVCEEDGYIQDGTVDITHFGGFRRYVEHLRRQRDVDKPFDTVLVANRGEIAV
FT                   RIIRTLKRLGIRSVAVYSDPDRHSQHVRDADVAVALGGSSAAETYLDIDKILAAAKKTD
FT                   TQAIIPGYGFLSENATFAERCGAEGIVFVGPSGDSIRKLGLKHWARELAASAGVPLTKG
FT                   TGLLQSASAALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAELAAAFEQVQRQGELYFT
FT                   DSGVFLESFIARARHVEVQIMGDGHGRTVALGERDCSLQRRNQKIIEETPAPNLPAHTR
FT                   QKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHPITEMVTGLDLVE
FT                   WMLRIAANTPPDFDAGVEIEGVSMEARVYAENPVKGFTPSPGLLTEVVFPSWARVDTWI
FT                   LKGTRVAAEYDPTLAKIIVHGKDREDAVSKLLLALSETRIAGCMTNLDYLKSIASSEEF
FT                   RKASVFTRLLNDFEYTPTAFEVKIPGAYTTIQDYPGRVGYWRIGVPPSGPMDSYSFRLA
FT                   NRVVGNDSKAAALEITLNGPELKFHSDAVIAVTGGAVPVTLNGKPVLQYVPLTLEKGDV
FT                   LKIGKLESGSRAYLAVRGGIDVPEFLGSRSTFAMGGIGGHNGRVLAPGDVLFINKDSSV
FT                   AVGDTVTIPSGLQPVIPRESWKIGLVCGPHGSPDFFKREALEEFFSSPWKVHYNSNRFG
FT                   IRLIGPKPKWARSDGGEAGLHPSNTHDYVYSVGAINFTGDEPVIIAAEGPSLGGFVCAA
FT                   VVPEAELWKVGQLKPGDTIKFVPISVDTARALKRSQDAAVDALDILSSIKLDDSMVLPS
FT                   YQDPVLLRLAKRSGLCPKVTFRQSGDRYILIEYGENEMDINISYRIKQLQEMVTKNKVT
FT                   GIVEMSQGIRSLLVEYNGYTISQEDLLSVLSAYELEINFDVDWKVKAKLFRLPMAFEDS
FT                   KTLEAVRRYQETIRSDAPWLPSNADFVANVNGITRADVRDLLYSATFMVLGLGDVFLGA
FT                   PCAVPLDPRQRLLGTKYNPSRTYTPNGVVGIGGMYMCIYCTDSPGGYQLMGRTIPIWNR
FT                   LQLGEAWKDHPWLLTPFDQVEFYPVSEERINELTEEVENGTFELEVKETVFDNGAYNRW
FT                   LEDNRESIQAFKEGQSGERAAEFARLIKVANSDLETAVRKEAEPVEYPEDAHMVYSEYA
FT                   GRFWKQVVSVGDKVKEGDKLVIIEAMKTEMVVSATADGEVINILHANGDMVDAGNLVVV
FT                   LKNC"
FT   CDS_pept        802514..804766
FT                   /codon_start=1
FT                   /gene_family="HOG000159459" [ FAMILY / ALN /