(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5

ID   ASHGO_5; SV 2; linear; genomic DNA; GRV; FUN; 1519140 BP.
XX
AC   AE016818_GR;
XX
DT   01-SEP-2009 (Rel. 111, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 18)
XX
DE   Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-
DE   1056) chromosome V, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Eremothecium.
XX
RN   [1]
RX   PUBMED; 15001715.
RA   Dietrich F.S., Voegeli S., Brachat S., Lerch A., Gates K., Steiner S.,
RA   Mohr C., Poehlmann R., Luedi P., Choi S., Wing R.A., Flavier A., Gaffney
RA   T.D., Philippsen P.
RT   "The Ashbya gossypii genome as a tool for mapping the ancient
RT   Saccharomyces cerevisiae genome.";
RL   Science 304:304-307(2004).
XX
CC   This Genome Reviews entry was created from entry AE016818.2 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1519140
FT                   /culture_collection="ATCC:10895"
FT                   /organism="Ashbya gossypii"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /strain="ATCC 10895 = CBS 109.51 = FGSC 9923 = NRRL Y-1056"
FT                   /strain="ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome V"
FT                   /chromosome="V"
FT                   /db_xref="taxon:284811"
FT                   /db_xref="taxon:284811"
FT   source          48859..92111
FT                   /clone="BAC clone bAG1539"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          62602..126444
FT                   /clone="BAC clone bAG1581"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          102567..180841
FT                   /clone="BAC clone bAG1047"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          168565..223717
FT                   /clone="BAC clone bAG1442"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          209885..269862
FT                   /clone="BAC clone bAG1767"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          233180..294714
FT                   /clone="BAC clone bAG1771"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          294653..343542
FT                   /clone="BAC clone bAG1653"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          296827..378526
FT                   /clone="BAC clone bAG1722"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          371608..436193
FT                   /clone="BAC clone bAG1441"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          374022..441571
FT                   /clone="BAC clone bAG1662"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          479895..545835
FT                   /clone="BAC clone bAG1262"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          506880..571542
FT                   /clone="BAC clone bAG1720"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          668747..720871
FT                   /clone="BAC clone bAG1242"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          680470..747540
FT                   /clone="BAC clone bAG1318"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          722038..794830
FT                   /clone="BAC clone bAG1543"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          758101..818503
FT                   /clone="BAC clone bAG1180"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          828715..898210
FT                   /clone="BAC clone bAG1702"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          880616..928951
FT                   /clone="BAC clone bAG1578"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          916851..984111
FT                   /clone="BAC clone bAG1134"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          966873..1018621
FT                   /clone="BAC clone bAG1350"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1018507..1051617
FT                   /clone="BAC clone bAG1186"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1020719..1073725
FT                   /clone="BAC clone bAG1073"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1055917..1102834
FT                   /clone="BAC clone bAG1424"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1073651..1126289
FT                   /clone="BAC clone bAG1537"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1094137..1152805
FT                   /clone="BAC clone bAG1250"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1165404..1236932
FT                   /clone="BAC clone bAG1515"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1220381..1274323
FT                   /clone="BAC clone bAG1624"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1238302..1307320
FT                   /clone="BAC clone bAG1078"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1312695..1355042
FT                   /clone="BAC clone bAG1191"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1358114..1431418
FT                   /clone="BAC clone bAG1362"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1408764..1474572
FT                   /clone="BAC clone bAG1577"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          1448685..1516268
FT                   /clone="BAC clone bAG1474"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   CDS_pept        1960..3897
FT                   /codon_start=1
FT                   /gene_family="HOG000144404" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929432"
FT                   /locus_tag="AEL345W"
FT                   /orf_name="AGOS_AEL345W"
FT                   /product="AEL345Wp"
FT                   /protein_id="AAS52339.1"
FT                   /db_xref="HOGENOM:HBG024767"
FT                   /db_xref="HOGENOM:HBG058285"
FT                   /db_xref="InterPro:IPR022751"
FT                   /db_xref="UniParc:UPI0000252C13"
FT                   /db_xref="UniProtKB/TrEMBL:Q758U7"
FT                   /transl_table=1
FT                   /translation="MAFFRGRLRPILGLITLAIVVSTCFLGLSLLTEEFNQGIVSSIHQ
FT                   WSPPSWLVKPSNGAKSVNEAKPQSEDKPSSESKPQSEDNSSSEDKPDDAKSSLLDLLTQ
FT                   EGPDVVALWDLQERCKRYFELTYRKEPAWSNQVPFLSRDIISDASYSAKLMERWRIFAD
FT                   CFIEGNEPLSTTLDGRVDIFDFQQRMYPFLTKVRRWEEIWPMITDLNTGEQYQPGHLKD
FT                   GQRLTIDDNLSFWKNWQLFSKGRGITITAGAEHVEMLPRLLNVLDHIGNTLPIELINAA
FT                   DLPPTTIDKIAKYVQMKSNQTVRLVDCGKTLEHSYRSLITGFRHKWLAYIFNTFEEAVF
FT                   IDLDAVPFVDLEKLFEVEGYKSEGILMFRDRSYDGEKPDDCPKAMRIMMPSPKEHTMWQ
FT                   HGSNYDKQVAEDELTKKPRDAGAATFYIKYMEGKSFHMAESGLIVMHKNKKLPSLLISL
FT                   MLHMTFETHLCSHGDKEYLWLGQLVSGENYYVDPRPPAIIGVPQLVSNHGQVDEYKICS
FT                   AQIAHMDDDGSILWVNGGLKNCKFDAVERDFEDYTEYFSKKYINKENLQKFYDLEVDMQ
FT                   MAFIPDFVDSDWVKAPECRAFTWCSTIKADSMEGAEYQSYIIKKGDPRLREYNKIAEIW
FT                   SKAPYLSSIA"
FT   CDS_pept        5877..7499
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18080745"
FT                   /locus_tag="AGOS_AEL344W"
FT                   /product="AEL344Wp"
FT                   /function="structural molecule activity"
FT                   /protein_id="AAS52340.2"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="HOGENOM:HBG058964"
FT                   /db_xref="InterPro:IPR013907"
FT                   /db_xref="UniParc:UPI0001DB2931"
FT                   /db_xref="UniProtKB/TrEMBL:Q758U6"
FT                   /transl_table=1
FT                   /translation="MAVDSQGPTDEVDNTEGVTGFDAVRPNSNSDGKAQDLELSSRLTE
FT                   ANLALVDGRVRLKGRAVDITERHGFLGEDDKSSVLSKVTSQEGDLELSELYISSDAETE
FT                   KMENNTEESDVPNLSSLVEQMPPQQGSRTYIKDANSGADDAVRDLQDVDASLPNKGKKR
FT                   QLEEEGGYTGEETKVNSADGEDPQGDEQKFKKPRLPISSAAGQLPSLSGSEQHMATDIM
FT                   ETGLDPAQPEDENSEDNEVEEDDEEEDEDEEEDEEEEEEDIEGNANTKDTSIFKEKKKV
FT                   PAGDDEEEEEDDEEEEEEEEEEPSLIEREKLRQDALKDIIEIEYEFAELRQRLYENEMA
FT                   KLQTELQMCLEGSHPALQTYYQKIDSIRDFKLKRAYQRQKYELECIDKETRAVRTFIHQ
FT                   NFYRQVSDLKHKLLNQTTQKWYDMNKERRDMDMLVSEIGYHVPVKIANKSLSCITGYAA
FT                   PAQLKGDGDPLPEDLECEGINFRFRNNPVDKLEVIVDRMRFNNQLSDFEGLKKFFGGFP
FT                   GAPSLNGLKDSEIYEDMQSLREQ"
FT   CDS_pept        complement(7769..8197)
FT                   /codon_start=1
FT                   /gene_family="HOG000111561" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18080746"
FT                   /locus_tag="AEL343C"
FT                   /orf_name="AGOS_AEL343C"
FT                   /product="AEL343Cp"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="AAS52341.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="HOGENOM:HBG307515"
FT                   /db_xref="HOGENOM:HBG382195"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005713"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="UniParc:UPI0000252C15"
FT                   /db_xref="UniProtKB/TrEMBL:Q758U5"
FT                   /transl_table=1
FT                   /translation="MSEAATPRKRTFKTYSYKGVDLEKMLEMPTEEFVKLAPARVRRRF
FT                   ARGLSSKPAGLMKKLRAAKLATAENEKPAVVRTHLRNMIIVPEMIGSVVGVYNGKVFNQ
FT                   VEIKPEMVGHYLGEFSITYTPVRHGRAGATTSRFIPLR"
FT   CDS_pept        8703..9020
FT                   /codon_start=1
FT                   /gene_family="HOG000229897" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20623886"
FT                   /locus_tag="AEL342W"
FT                   /orf_name="AGOS_AEL342W"
FT                   /product="AEL342Wp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translational elongation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS52342.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006414"
FT                   /db_xref="HOGENOM:HBG351554"
FT                   /db_xref="HOGENOM:HBG744999"
FT                   /db_xref="InterPro:IPR001813"
FT                   /db_xref="InterPro:IPR001859"
FT                   /db_xref="UniParc:UPI0000252C16"
FT                   /db_xref="UniProtKB/TrEMBL:Q758U4"
FT                   /transl_table=1
FT                   /translation="MKYLAAYLLLNAAGAAPSADKVKAVLESVGIEVEDDKVQAVISAL
FT                   ENKSVEELIAEGTEKLSSVPTGGAGAAPAGGAAGAEEAAEEAVEEAAEESDDDMGFGLF
FT                   D"
FT   CDS_pept        9427..10608
FT                   /codon_start=1
FT                   /gene_family="HOG000246415" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15755763"
FT                   /locus_tag="AEL341W"
FT                   /orf_name="AGOS_AEL341W"
FT                   /product="AEL341Wp"
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="AAS52343.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG380413"
FT                   /db_xref="HOGENOM:HBG754729"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0000252C17"
FT                   /db_xref="UniProtKB/TrEMBL:Q758U3"
FT                   /transl_table=1
FT                   /translation="MGVLPTDKFATKAIHAGAHTDLHGSVIEPISLSTTFKQSSPGNPV
FT                   GAYEYSRGQNPNRQNLEEAIAALESAKYGLAFSSGSATTAVIVQSLPQGSHAISIGDVY
FT                   GGTHRYFTKVANAHGVETSFTNSLLEDLPKLVRDNTRLVWIESPTNPTLQVTDIQQVAD
FT                   TVKALNEDIILVVDNTFLSPYLSNPLNFGADIVIHSATKYINGHSDVVLGALATNSTSL
FT                   YERLAFLQNAIGAIPSPFDAWLTHRGLKTLHLRVRQAAQSAQKIAEYLEQSEHVVSVNY
FT                   PGLPSHRGYQIAQKQHRDGLGGGMISFRVKGGAQGAALLSQSTRLFTLAESLGGIESLL
FT                   EVPAVMTHAGIPKEAREASGVYDDLVRVSVGIEDTDDLLEDIKQALSVVAESI"
FT   CDS_pept        10760..11911
FT                   /codon_start=1
FT                   /gene_family="HOG000154325" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15755764"
FT                   /gene_name="SIL1"
FT                   /locus_tag="AEL340W"
FT                   /product="Nucleotide exchange factor SIL1 "
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="endoplasmic reticulum lumen "
FT                   /protein_id="AAS52344.1"
FT                   /db_xref="GO:0005788"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG059163"
FT                   /db_xref="HOGENOM:HBG202778"
FT                   /db_xref="UniParc:UPI0000252C18"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758U2"
FT                   /transl_table=1
FT                   /translation="MYWKKLLFAIASAAALAAVDPETEGSELQTICSGGECYPRLFKAL
FT                   QDWSTIKEGQQIPPGLDIRVDLSTGKKQARLPIPNEASNMENGIQVVDDSSDYEFTKEF
FT                   QLVRAQVASGAPDYNVVIKQLDDLVEYASDYTLGYKIITHEFTLLQELIFGQDVPISVK
FT                   ELSSRIIVACLRNNTPCLDFVNTRFPDFVRHLLQEAVDYGRQATDAVEARTQIKRYLSI
FT                   VEPLLINEPQPINEEALKQLYEVNDQTVQLKVLLIMARLYKGRSHNDDISKRSLESTDV
FT                   QRWTTELSKAIQSKHLDDFHVRELFHGLYALKKEHGRAVKTYPTFLGWLAEETEARKQR
FT                   MTQDKQPRDLEQMEFDRLLIESRHMVFGNPMAHRIKNMEYDEL"
FT   sig_peptide     10760..10810
FT                   /gene_name="SIL1"
FT                   /locus_tag="AEL340W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758U2 "
FT   mat_peptide     10811..11908
FT                   /gene_name="SIL1"
FT                   /locus_tag="AEL340W"
FT                   /product="Nucleotide exchange factor SIL1 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758U2 "
FT   CDS_pept        complement(11942..12643)
FT                   /codon_start=1
FT                   /gene_family="HOG000175561" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18080747"
FT                   /locus_tag="AEL339C"
FT                   /orf_name="AGOS_AEL339C"
FT                   /product="AEL339Cp"
FT                   /protein_id="AAS52345.1"
FT                   /db_xref="HOGENOM:HBG059213"
FT                   /db_xref="HOGENOM:HBG737086"
FT                   /db_xref="InterPro:IPR008493"
FT                   /db_xref="UniParc:UPI0000252C19"
FT                   /db_xref="UniProtKB/TrEMBL:Q758U1"
FT                   /transl_table=1
FT                   /translation="MFAAIASGNPLQLSAEVPNSNGLQHTIILSETKPKSYSHITLFIL
FT                   PTVALPPEYSAIVYFKLSPQEDFQLFGELKASKPSAIFKVKLPTTAGAQGSDVSNGLGE
FT                   IDMEDGDSVAGTAHNISELIIGISIEPQEQAAFKLEEAKQAHKSTAQSGALVVSRNQGG
FT                   NIATPGQLSRAYPLLTQQLASKIVQHAYNFLSGFLDERNSVPIKKFEAWWEKFQKRLQN
FT                   DATFIDEVTSE"
FT   CDS_pept        complement(12869..14470)
FT                   /codon_start=1
FT                   /gene_family="HOG000252720" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15755765"
FT                   /locus_tag="AEL338C"
FT                   /orf_name="AGOS_AEL338C"
FT                   /product="AEL338Cp"
FT                   /function="ATP binding"
FT                   /function="glutamate-tRNA ligase activity"
FT                   /biological_process="glutamyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS52346.1"
FT                   /db_xref="GO:0004818"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006424"
FT                   /db_xref="HOGENOM:HBG457900"
FT                   /db_xref="HOGENOM:HBG628189"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="UniParc:UPI0000252C1A"
FT                   /db_xref="UniProtKB/TrEMBL:Q758U0"
FT                   /transl_table=1
FT                   /translation="MVCTFAVRRYTASILRPRIGLLSGKQIAISRKPTRDVHPKTPART
FT                   RFAPSPTGYLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLVSDAEQNIYDTLQWL
FT                   GIQFDEGPGVNEVYGPYRQSDRSAIYKAHADKLLASGHAYRCFCSKERLENLRTSAMAL
FT                   QPPTNVSYDRECANLSQEHIDHKLDQNVPFTLRFKSPAVYEPFEDLLHGRVDLQPQTNP
FT                   NDIRYDDPVLMKSDGLPTYHFANVVDDHLMKITHVIRGEEWLPSTPKHISLYRAFGWTP
FT                   PKFVHIPLLTTAADKKLSKRKGDASVMALKAKGVLPEALLNFSVLFGWAPPRELATANH
FT                   ECFTLGEFERLFNLNNLTKGNAKVDEKKLWFFNKHYLSARLKDEHQVSIEARNLTQILS
FT                   KKYPGLDETKTKQLLKAVGGHLTVIDELESQFHYLLSKPVYENEFSDRFIKACEPSQVA
FT                   RVLSSIASLLDNSNLNDLVAEVSTRENVPKKAVFEAMRFALSGSVPGLKLPVLISTLGL
FT                   EETKARLNEAAQYLVT"
FT   CDS_pept        complement(14612..17905)
FT                   /codon_start=1
FT                   /gene_family="HOG000141775" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18080748"
FT                   /locus_tag="AGOS_AEL337C"
FT                   /product="AEL337Cp"
FT                   /function="ATP binding"
FT                   /cellular_component="chromosome"
FT                   /protein_id="AAS52347.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="HOGENOM:HBG059270"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="UniParc:UPI0001DB2932"
FT                   /db_xref="UniProtKB/TrEMBL:Q758T9"
FT                   /transl_table=1
FT                   /translation="MASTVDLGRSLRQRDDDQDGDLASLAGHKRLRRNTVQYAHFQEGA
FT                   IVSIRLTNFVTYSLAEFHMSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRAKRVE
FT                   DFIKNGTAESTIEIQLRNSRNVSGLPMISAEDEAINVRTVLMKARRKCAYYINGEPVSE
FT                   NQMRALVSMLNIQLDNLCQFLSQERVEEFARLKADKLLEQTVRSVDASLLGLLEQLKTS
FT                   QQEELSLNREVELGQKKLEKLMTHKESLENQVRALEEYERKKEEIDIHKRLLPYVRVKN
FT                   HKRQLKDLKSEYERVKQELKEFLKDKKPFKIASNALLSEVENSQRQKQGKESEYIQVKS
FT                   TQRSLIEELGKQRTEVEDLKKKVTYYRTRRENIRRKVEKAEQDIASRQQLLGSLVLPTQ
FT                   EEMDNYEQQRVDLYEQESAFEQKVEEMDSKVRALNRELTTIKSKLERRKKELASNDSLN
FT                   ALRGQTGRLEEVKKACEFVRIHPEMKGKVLEPPIVAIKAPNERIASYLTTCIDWHTSIS
FT                   LTMVDSASYREFNDTILKNFQVNLRELANTETSYPYPLEYIRQLGFDCYLSDFVTGDPA
FT                   VLQMLKEQQRIHTIPVSTRNLDTRIIDDLRTPDKQGRLKFRRVIAGDYVYDFKRSRYGN
FT                   KQIFSTDVQVKKAQFYIEGGMSDGMKQNIERELHELRERYRNIQKEVESTAQQKKQFHI
FT                   PLAEVQRKLQDLQKAIHEQNHKRIIQSRTMSEIQNIEQKLEEFRRDMNKDVSEAISNCE
FT                   AQIQSNLISQGEQLRLIVMNLSRLQEAQESVVRMGIKHIELRNRERSLNEVIGFFNAKE
FT                   EELRGKYDEAKKAYAEVKDTAEFQAWMKEIRSYTDTERDELSVWANKYEEQNTFTLENI
FT                   LETIAKLETEIQMINHDESSVTILRQTVTDIKGLQAKLPTQMERLGLLRRGMLDMRNNL
FT                   EPRLDELVENISQRFRKLFSNVGSAGEICLLKPDLYSEWKIEIRVKFRDVAELKKLDSH
FT                   TQSGGERAVSTVLYMIALQHFTNAPFRVVDEINQGMDTRNERIVHKAMVENACAENTSQ
FT                   YFLITPKLLTNLHYHERMRIHCVFAGSWIPDPAEREEMVHYGELTSYKL"
FT   CDS_pept        18240..20306
FT                   /codon_start=1
FT                   /gene_family="HOG000001103" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15755766"
FT                   /gene_name="SWC3"
FT                   /locus_tag="AEL336W"
FT                   /product="SWR1-complex protein 3 "
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52348.2"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG058914"
FT                   /db_xref="HOGENOM:HBG203633"
FT                   /db_xref="UniParc:UPI0001DB2933"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758T8"
FT                   /transl_table=1
FT                   /translation="MARLRSRTATTEKDATESSKVPVPRRRRGQHEDTEEPDTYGLEDD
FT                   EKSSGRPFRILEKLPCSAEPPRYDVLTHALSVRDSAVLYNSLLASRRTWIKAEMFELYW
FT                   SKQYMNMKERERMLKEGIDPDDIDQSAAREKMHKLCDGILTGGPHTLPVRLFILKNDEI
FT                   EQKWQFMQESRKKEKEVRRKREAEEKERRREERKRLQQLKKERKLKEVEHTKKEKIERK
FT                   RENDTERDQLRKGRKDNKGPSVLSRMGTTIKSKGLTTFSKAQQQEIDNQKMIANLNLLA
FT                   QRDPALNKLMIAVANGQAPPADVERFKVFIERARNMEPPPNWKPRLSSRPVIKRTEEPT
FT                   VEQQESASQTPSTPLPRKASPESSQVDNLSSPPHGSDPNSSFTEASMSDSRGELSETKS
FT                   GGSLVPDSTGSSGQALDKGPTDASGSANDLSRPGATLSSTDGAPPLKQETIPVRDMGDK
FT                   NADKPLEAHGAISEKGTTITIKAEEGTAPRQKRKYTKRKKEVEDEDKSMQLTTFQQKYL
FT                   NGADILFEYLENSNMRFLFPKDAILEQLENEESYLMSWIVVHNKKEIEQFKLKVLKGLN
FT                   KNKPNEEETEVQPCLFNVYEHPNCPEVLYTPMTVTLSNIPKKFTPIILNSVNPAESVRA
FT                   YMSTILARGRRLNGFNLWYQLDAYDDKDLAESLRCELKEYEQGFKSKRQKKQL"
FT   CDS_pept        complement(20342..21739)
FT                   /codon_start=1
FT                   /gene_family="HOG000177242" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15755767"
FT                   /gene_name="MDM10"
FT                   /locus_tag="AEL335C"
FT                   /product="Mitochondrial distribution and morphology protein
FT                   10"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="AAS52349.2"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG396255"
FT                   /db_xref="HOGENOM:HBG435083"
FT                   /db_xref="InterPro:IPR022197"
FT                   /db_xref="UniParc:UPI0001DB2934"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758T7"
FT                   /transl_table=1
FT                   /translation="MIEYMEYVLRQFERTTSWDRDYSYENITATSDNLLQFEIPDSLNL
FT                   QISNQSTPNTFNTFELSNRSIINGSLSYLYTDCGQLDKIVQNSLKVPLQQRVDTYQCLR
FT                   PGRTLGTSFRSQMLLYGRMYWPGSILEAMYCKRLTPQSQLVLKSLLSAAGESSILTLYW
FT                   QRNAPWGSQDIVFSTNELLLGYRFLHNLSPGRSHEGSPHGQSTLSLGAEFWLGISNLLP
FT                   GCSTALRYCTHATNTGKPITLTLSLNPLFGHISSSYSVKFSPGTTFCSKYDFNVYSIES
FT                   NLSFGCEFWKSSAAAHKQATNEEETSIEVATETPVSDPRYCGAVPGARSFDQIRPFAEL
FT                   PSDNQLYHQLMMPNSSNALIDNVNLPFPSPLLRYPPEKSVTDKFAAMIDATQFTSVLKM
FT                   SSSLRDKNLRLLWEGKYKGFLVSAGAELTTIPLEAPKTINEITAQQVPRPLWLRPAKFG
FT                   IQIQYST"
FT   CDS_pept        21873..22847
FT                   /codon_start=1
FT                   /gene_family="HOG000111152" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929433"
FT                   /locus_tag="AEL334W"
FT                   /orf_name="AGOS_AEL334W"
FT                   /product="AEL334Wp"
FT                   /protein_id="AAS52350.1"
FT                   /db_xref="HOGENOM:HBG058926"
FT                   /db_xref="HOGENOM:HBG203634"
FT                   /db_xref="InterPro:IPR005605"
FT                   /db_xref="UniParc:UPI0000252C1E"
FT                   /db_xref="UniProtKB/TrEMBL:Q758T6"
FT                   /transl_table=1
FT                   /translation="MILPSSRAAVLQTSGSSLPSGDSSPSRGHYRSTSETFKALLDRRL
FT                   WQDYGCDSTDMSESIWRDDDGAEAEAHLRRVRRTNRAGASVMRRRRSSSKTSSKNLKST
FT                   TDISPASKIFRNLLILEDDLRRQAKEQELLKWQFTLFLSTLMGVAGFAFYELYFSQDTV
FT                   QGLYRVMLQFLFVFIMITVVLFHLSGEYRRTIVIPRKFFTNTNKGIRQFNIKLVKVKSS
FT                   FGDRATDSARLAARRVAGAQLWLLHLLVPAAHLPRLALYHFWRGVAVRSQARIGAVDVK
FT                   LVLYPRAFSAEIREGWEIYRDEFWAREGARRRRLVNQLSPKAD"
FT   ncRNA           complement(22986..23002)
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR50"
FT                   /product="AgSNR50"
FT   CDS_pept        join(23514..23537,23606..25474)
FT                   /codon_start=1
FT                   /gene_family="HOG000067326" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20623887"
FT                   /locus_tag="AGOS_AEL333W"
FT                   /product="AEL333Wp"
FT                   /function="binding"
FT                   /function="protein phosphatase type 2A regulator activity "
FT                   /biological_process="signal transduction"
FT                   /cellular_component="protein phosphatase type 2A complex "
FT                   /protein_id="AAS52351.2"
FT                   /db_xref="GO:0000159"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0008601"
FT                   /db_xref="HOGENOM:HBG067378"
FT                   /db_xref="InterPro:IPR002554"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001DB2935"
FT                   /db_xref="UniProtKB/TrEMBL:Q758T5"
FT                   /transl_table=1
FT                   /translation="MMRGFKQKLIKKTTGSSSSTQKKKDKETGKKPGSANGAAGAVGGS
FT                   GGRATVDKKEQKGSGAKQPKAKDAGKSGAGAAPKVKVAAKKEERSYPTMIAAAVSPGST
FT                   SGPPSPKEAEAASPNGIDIPRSSHSFERLPTPTKLNPDTDLELIKTPQRHSSSRFEPSR
FT                   YTQISKLPGFDDVPPEEQISLFIAKVDQCNIMFDFSDPSFDIHGKEIKRITLQELIEFI
FT                   VTNRFTYTEEMYGHVVNMFKVNLFRPIPPPVNPIGDVYDPDEDEPVNELAWPHMQCVYE
FT                   FFLRFVESPDFNHQIAKQFIDQEFILKLLELFDSEDIRERDCLKTTLHRIYGKFLSLRS
FT                   FIRRSINNIFLQFVYETERFNGIAELLEILGSIINGFALPLKEEHKVFLVRILIPLHKV
FT                   RCLSLYHPQLAYCIVQFLEKEPMLTEEVIMGLLRYWPKVNSTKEIMFLNEIEDIFEVIE
FT                   PLEFIKVEVPLFVQLAKCISSPHFQVAEKVLSYWNNEYFLNLCIENAEVILPIIFPALY
FT                   ELTSQLDLDSQTDEEGNPNQDPYMLVEQAINSGSWNRAIHAMAFKALKIFLETNPVLYE
FT                   NCNSLYLSSLKESQKRREKREENWNKLQEYVRNLHISSVDNPVAVDRIGTGDLH"
FT   CDS_pept        25995..26612
FT                   /codon_start=1
FT                   /gene_family="HOG000141774" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18080749"
FT                   /locus_tag="AEL332W"
FT                   /orf_name="AGOS_AEL332W"
FT                   /product="AEL332Wp"
FT                   /protein_id="AAS52352.1"
FT                   /db_xref="HOGENOM:HBG058936"
FT                   /db_xref="InterPro:IPR007014"
FT                   /db_xref="UniParc:UPI0000252C20"
FT                   /db_xref="UniProtKB/TrEMBL:Q758T4"
FT                   /transl_table=1
FT                   /translation="MNTNLFIRNPCGTRLFFGNLCRLVAPSYRSQMMGSAIRARAVSLT
FT                   KNAGITSPRMMLFTSITATGLLMPLFKSPIIRNDAYMGVHDVKYPQVGYGAGVTSKEVR
FT                   RGRLNGKLDYRQLCLGSIAGVALGIVVGKISHALVFITGLGLLALQWLQSRGIVDKGTT
FT                   RGLSRYLISTGREKIDLNTLFWEKPSFKISFLLTFVLAALNV"
FT   CDS_pept        26839..27468
FT                   /codon_start=1
FT                   /gene_family="HOG000212457" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18080750"
FT                   /gene_name="YTH1"
FT                   /locus_tag="AEL331W"
FT                   /product="mRNA 3'-end-processing protein YTH1 "
FT                   /function="RNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52353.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG210860"
FT                   /db_xref="HOGENOM:HBG330017"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniParc:UPI0000252C21"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758T3"
FT                   /transl_table=1
FT                   /translation="MSLVHPDTSNYPFRFAPFLRQEYSFSLDPDRPVCQYYNSKEGASS
FT                   CPNGTLCPNKHVLPIFQNKIVCKHWLRGLCKKNDQCEYLHEYNLRKMPECVFFTKNGYC
FT                   TQSPECQYLHIDPTSKVQQCEDYRMGFCPLGTACPCKHVKKIICPKYVTGFCPLGRDCD
FT                   WEHPPFYVPNELSKIRIKRDDEINTKKLDEEKERRLNAIINGELVI"
FT   CDS_pept        complement(27520..28548)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15755768"
FT                   /gene_name="ISR1"
FT                   /locus_tag="AEL330C"
FT                   /product="Serine/threonine-protein kinase ISR1 "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS52354.2"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058943"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00005C9357"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758T2"
FT                   /transl_table=1
FT                   /translation="MSAWASQEAAKEEEAVGDFARMLERRDAGLLARVLSRAQTGPEAY
FT                   VRGLWRAEVGLERWRLTRVLGCGSVACVFELGDGALALKVPTSRRKAPVLLHEVLIYSH
FT                   LAQQAGGRLAERHVVPFHGVAAVTRREYRRLRGGEVVPALVLERMDTTLEAVHRRAAVS
FT                   KGQWWRYARDLVAALQFLRESCVVHGDIKTANVLVRGQDAFLADFTSAAVCDAAPEPLT
FT                   TTLEYCAPGLIGGGQPTHSTDVYAAGLCLLALITRFEPFRELSMMKSHSSAPTHSLHET
FT                   QWLMNAISKGDPIKYNVLSQDLYDRWAEELHFLRRFFVPAAQDALSRWLAESNARVAEH
FT                   AF"
FT   CDS_pept        29316..30224
FT                   /codon_start=1
FT                   /gene_family="HOG000214828" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19776425"
FT                   /locus_tag="AEL329W"
FT                   /orf_name="AGOS_AEL329W"
FT                   /product="AEL329Wp"
FT                   /protein_id="AAS52355.1"
FT                   /db_xref="HOGENOM:HBG056465"
FT                   /db_xref="HOGENOM:HBG332946"
FT                   /db_xref="UniParc:UPI0000252C23"
FT                   /db_xref="UniProtKB/TrEMBL:Q758T1"
FT                   /transl_table=1
FT                   /translation="MHRTYSLRNSRAPTASQLQNPPPPPSTTKNRFFGKGGLANTFRKN
FT                   TAGAFGPELSRKLSQLVKIEKNVLRAIEVAANERRDAAKQLSLWGLENDDDVSDITDKL
FT                   GVLIYETSELDDQFIDRYDQYRLTLKSIRDIEGSIQPSRDRKAKITDKIAYLKYKDPQS
FT                   PKIEVLEQELVRAEAESLVAEAQLSNITRSKLKAAFNYQFDSLIEHSEKLALIAGYGKA
FT                   LLELLDDSPVTPGETRPAYDGYEASKQIIIDAEAALNDWTLDTAAVKPSLSIRRDYDEE
FT                   FEEGDDGEQWEQDATEEQVAA"
FT   CDS_pept        30723..33212
FT                   /codon_start=1
FT                   /gene_family="HOG000074729" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15755769"
FT                   /locus_tag="AEL328W"
FT                   /orf_name="AGOS_AEL328W"
FT                   /product="AEL328Wp"
FT                   /protein_id="AAS52356.1"
FT                   /db_xref="HOGENOM:HBG058954"
FT                   /db_xref="HOGENOM:HBG203986"
FT                   /db_xref="InterPro:IPR013167"
FT                   /db_xref="UniParc:UPI0000252C24"
FT                   /db_xref="UniProtKB/TrEMBL:Q758T0"
FT                   /transl_table=1
FT                   /translation="MAADGDPIALHTISDDVLAAKLARYKKLMNNFATLSQATKLEKVI
FT                   NRDHRETEQELQEIIEESQTRDNQEIRKLELRRTNLTSSLGKFHATLEQLSGSSESARQ
FT                   ISARIRMIERERTLVHKTLQFIEQCRQLKYSISVVSSALEKNDHRLAANTIEKIRTLPP
FT                   EVVESEFANRVVPCSEIPEQPAQLLKDWTSRLSEVFTEQFQHAAKAQDVEQLTSYFELF
FT                   PKIGYAELGLEVYSKYVCDIIAGQSRKIMTGSTERRHMFYSKALLHLFKTVSTIINSHS
FT                   QVISGCYGAKYMVHIMDKVQKEADLQAGIIWDTFMDVRRIEYLLAEIREWHEAQAQANK
FT                   NHLHGAKPNSRPPPSSINELTMLISEYSAIFQHWSMYCRFFALKWDEFSQNTATELELP
FT                   SLISEGKFSAKVTDSMSGFEQLVRHQLYRSFANAVDLEELPSLNDYLGPTPYDHEDLSS
FT                   YPISSILEDLVLLIRVNLIATVNTGQKALLYKFSEALMRFIQTEFLIKVLQSRFKNIQP
FT                   RLNPSLVLKKYLPSSDPTSVGMRSLSPKPVTQDTGKLSQFGFNFKSAATSTLTNLQSNI
FT                   QSVYTDEESVLKLHHFLICVNTLSIGEVFFKRLLITEILEDQPQLLHSNFPFGRDATDV
FT                   ESVLRTLFGNIQTQGGKLLKWSLLQLFENMLKGKLKRLVAPMFVSGTDQEYICTAHDFE
FT                   NLSTLNLFLTQWKELILPFSNVLYKTAYIELISQMIDYLCEALEEKIWGIQCNELGGLK
FT                   LDRELSLMITSLCGQHYFLREKFTRLSQLVLVLGLDDDDFDPATGDIKEETLSSINWIL
FT                   SAPERVRARNMRVDKRS"
FT   CDS_pept        33827..37231
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15755770"
FT                   /locus_tag="AGOS_AEL327W"
FT                   /product="AEL327Wp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52357.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG124794"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="UniParc:UPI0001DB294F"
FT                   /db_xref="UniProtKB/TrEMBL:Q758S9"
FT                   /transl_table=1
FT                   /translation="MEFERQENTSLPRASIQAIGALSVATDDLPKKHIDYPTREPGKYP
FT                   LRADEESKIGYASYDSEKPSEGADVSCTNESSGDAEHASDRPAESNADKTASEVKSANA
FT                   GEGFASDRVPDSREGEKLKGKRLNSDLQPTTAVDSSHADGLTNFPLVQEQEVAKNEPPT
FT                   TPGPPKGTDSIGLAAREVSQASHGGEKEDLKPDGSAYMEVAGSGDAPITPTPNSTPLKN
FT                   IPKPAGSIGTDDTRLMASDMEQGQDQQELLNRLQRPSMSYGPNTRRRSSLILKEHDSKT
FT                   PDIRAASTLQTTELKLELPENLDHEDFSKLFKLDAKNDDDLFSAEDLLAHGIGSQRRSS
FT                   EDDAAATRHKLDIEQSPRGSVSLTPEILDNKHMCTKTEDTNTSNEEGLSPRQHVAAKKT
FT                   GDSSQQLSISNNSMANPHTVKSSTHDGSVKFNYTTHLENTPASIIQGKNHLFYARRHNS
FT                   LTPMVSQPTNKHSPATFKPSPESERQTSTDINAGNHTEHSDGHILPAGQFMTSSHGSNL
FT                   AEEQSKISAYACLDFQNFTFYVQTLQVIIGRRSENDFAHKVDVNLGPSKSISRRHAKIF
FT                   YNFGTERFELSIMGKNGAFVDDTFVERGITVPLRNKSKIQIGQIPFQFVLPEQEGKEKH
FT                   VIPSKIKDTPTVKTESVKDPLDSQIKAPDISVTSKKKEKKPSKPPKPPKKVYSLEEIPP
FT                   EYRTKPTCSYSNLITTCLRKYSSPKGMSLSEIYAGIRELYPYYKYCPDGWQSSVRHNLS
FT                   LNKSFRKVSKEGKGWLWGLDEEYIAEREKQRKKQAEAQAAKAKAAELKQLQLQARKQAT
FT                   VSNNLASFTKQPNISQTLAANRSEKRILQDDNQRTMKYLQQQLILLTKDRKGLEKPVMA
FT                   QILTQALAMTINQVTQAAKNKGITGNPLTALIDKNPQHLNLILTAAVNAATVKVTDGKV
FT                   KKLVNMSPVSQVSAQNPALIAKQGSSKRASPPALRNILQKPPTPSIANPTSSSTLKAGE
FT                   PFDPTSLSKFFQPKQPVRLSVAGTPGHAGSRSNNGNLLPRKRSASDTESSDDDSDTSVN
FT                   EDSSDEDSGDSSDDNTGSSDSGTAGDDTSSSSTSDNGDDDDDDDDDDDDDDDDDDDDDD
FT                   DDDDDDEDDDDDDEDDDDDDQSSNITD"
FT   CDS_pept        complement(37423..38280)
FT                   /codon_start=1
FT                   /gene_family="HOG000091082" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15755771"
FT                   /locus_tag="AGOS_AEL326C"
FT                   /product="AEL326Cp"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="AAS52358.2"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="HOGENOM:HBG434372"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="UniParc:UPI0001DB2950"
FT                   /db_xref="UniProtKB/TrEMBL:Q758S8"
FT                   /transl_table=1
FT                   /translation="MQSIVESLRRSPLEQELYEDQSELQEDFVVGRVPFQRLTPRISVA
FT                   PVDRPYEFLRAHTDDSKNPDCRIKIAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTV
FT                   KKVIEINPFLLGTMAGGAADCQYWETWLGAQCRLHELKEKERISVAAASKILSNLVYEY
FT                   KGAGLSMGTMICGYTKKEGPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDTNYRWDLS
FT                   VEDALYLGKRSILAAAHRDAYSGGSVNLYHVTENGWVYHGNHDVGALFWEIKEKEKSFN
FT                   NVLG"
FT   CDS_pept        38620..39144
FT                   /codon_start=1
FT                   /gene_family="HOG000231312" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18080751"
FT                   /gene_name="RPL11"
FT                   /locus_tag="AEL325W"
FT                   /product="60S ribosomal protein L11 "
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS52359.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="HOGENOM:HBG079273"
FT                   /db_xref="HOGENOM:HBG592167"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniParc:UPI0000252C27"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758S7"
FT                   /transl_table=1
FT                   /translation="MSAKAQNPMRELKIEKLVLNISVGESGDRLTRASKVLEQLSGQTP
FT                   VHSKARYTVRTFGIRRNEKIAVHVTIRGPKSEEILERGLKVKEYQLRTKNFSETGNFGF
FT                   GIQEHIDLGIKYDPSIGIYGMDFYVVMGRPGGRVSRRKRCRSTVGNSHKTSKEDTIAWF
FT                   KQRYDADVLDK"
FT   CDS_pept        complement(39212..39805)
FT                   /codon_start=1
FT                   /gene_family="HOG000154353" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15755772"
FT                   /gene_name="SNT309"
FT                   /locus_tag="AEL324C"
FT                   /product="Pre-mRNA-splicing factor SNT309 "
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="AAS52360.1"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG058974"
FT                   /db_xref="InterPro:IPR008409"
FT                   /db_xref="UniParc:UPI0000252C28"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758S6"
FT                   /transl_table=1
FT                   /translation="MADDVIDWLPYVDTLDQRYLNEVEKTVTAELAAIEQQELHPRIAE
FT                   LFPAVRHHWDEQYGLYKDNVVGLEGSNKRAAEDGVLSELKRRCPGIDISVYNDDSEDPV
FT                   LLATIAGYRYHQDLVVTQLLPQTLENQWAINNAYLEGAEAAVRRQLQEQEQQIAQLDRH
FT                   RQELQQREALRFRYLERQWRDRLHGNLERAAGNI"
FT   CDS_pept        39991..40905
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15755773"
FT                   /locus_tag="AEL323W"
FT                   /orf_name="AGOS_AEL323W"
FT                   /product="AEL323Wp"
FT                   /protein_id="AAS52361.1"
FT                   /db_xref="HOGENOM:HBG123817"
FT                   /db_xref="UniParc:UPI0000252C29"
FT                   /db_xref="UniProtKB/TrEMBL:Q758S5"
FT                   /transl_table=1
FT                   /translation="MHTVSVALSKRFIRSLATQVQSAPKDGGDFVRYLEYLKTSKDMRP
FT                   LLYRPRNAAKLLTMDLGGGEIPTPRDPIQLPSVLTYAQLLDQMESAEQLQKHFVELRQV
FT                   HKKALWEHLSAQHLQHILLRATFGLHCFGPTLTAVYQLKPLFARAKNTTAYDVDHLFNT
FT                   ILTCRLHTNSLLQEIDPVVATKKVAMSWENTNVRQTSTGLSAELLTALSKQVGGEIPVP
FT                   TELKVPVILPSIDVDACSMGKAAAFVSAHRIRYLQARTATTFGSTNEAVMAFVSCYRAA
FT                   LERTGRVDFYDLCVAALAPKQEP"
FT   CDS_pept        41234..43048
FT                   /codon_start=1
FT                   /gene_family="HOG000176924" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15755774"
FT                   /locus_tag="AEL322W"
FT                   /orf_name="AGOS_AEL322W"
FT                   /product="AEL322Wp"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="AAS52362.1"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="HOGENOM:HBG455568"
FT                   /db_xref="HOGENOM:HBG589457"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="UniParc:UPI0000252C2A"
FT                   /db_xref="UniProtKB/TrEMBL:Q758S4"
FT                   /transl_table=1
FT                   /translation="MSTDADVASTQRENAADANPRESSAEREATAPSVSEEHKLSNKEL
FT                   KELKKQEKAAKRAAKKQASGITIEQQQQQAQLKKEKKQHQREQQMSGAKKGRSGNPGIP
FT                   IADKKSTLFGHLETTEERRASLLAVISAISSNGASKITATGLMIPTVASAMASSAAPAL
FT                   AAGHTGAAGPANPEVSAQAMASMSLDEESSFVPGLLSVLPIAIEEDFKNPQLMSSVKEL
FT                   VANKDMLHPAVVLLTSEFGAYKIVGSIPRCLAMLEVFQIVIREYKTPEGTTLSRNLTHY
FT                   LSHQIDFLKKARPLSVTMGNAIRWLKQEISLIDPATSDVQAKELLCEKIAQFAREKVEL
FT                   ADQLILENASQHIDNDSTILTYGCSKVLTDLFIYNAVDLGKNFNIIIVDSRPLFEGRKM
FT                   AEVLRKRGLNITYVMITSLATIFSMDIDYVFLGAHSILSNGFLYSRVGTAMLAMSAKRR
FT                   NIPVIVACESLKFSQRVQLDSVTFNELADPNILVDINTDNPVKRRSNKGFLLQRFVKES
FT                   QALMKQKDEQDTKQNKNGKAKFITDDNKKSDSDKAILADWQDLPSLNIYNIMYDLTPPE
FT                   YIKKVVTEFGALPPSSVPVILREYKGSA"
FT   CDS_pept        complement(43119..43547)
FT                   /codon_start=1
FT                   /gene_family="HOG000177285" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20623888"
FT                   /gene_name="MRPL51"
FT                   /locus_tag="AEL321C"
FT                   /product="54S ribosomal protein L51, mitochondrial "
FT                   /cellular_component="mitochondrion"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS52363.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="HOGENOM:HBG055742"
FT                   /db_xref="HOGENOM:HBG327624"
FT                   /db_xref="InterPro:IPR007741"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI0000252C2B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758S3"
FT                   /transl_table=1
FT                   /translation="MVVKALRQISVGQNGVGAFIFPCKKITLQYCNWGGSSQGLRDFLT
FT                   SKRLAKWAEKYPQIQFEVVAKAGHPVLKAEYINGLNKAICVRNLNVDHVELKLKLLRES
FT                   SGAQLRHYPKNANVLSLNQSVRGVWSPLHVDPALRHRV"
FT   CDS_pept        44085..47045
FT                   /codon_start=1
FT                   /gene_family="HOG000141960" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18080752"
FT                   /locus_tag="AEL320W"
FT                   /orf_name="AGOS_AEL320W"
FT                   /product="AEL320Wp"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="AAS52364.1"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG191596"
FT                   /db_xref="HOGENOM:HBG203983"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniParc:UPI0000252C2C"
FT                   /db_xref="UniProtKB/TrEMBL:Q758V6"
FT                   /transl_table=1
FT                   /translation="MSTQLDPTEEHYLKRELLRLELNTEFGQFNDAEALRMFGAPFSAD
FT                   APRKHGGGGLKGSLPLSLKRRLGGKSGGHETAHVADTEFPLLRHFLHTVVMTCPLLSQD
FT                   LAASSHFWQSKVQAFFEHFMSMPFSSSYDREELTKRRKLAIKMSKLVLLFYNSGVGARQ
FT                   EQQYYAALEPLNLPTGDMQGGLGQFIMPTRESIQYAITQEPVYFNGIDINVIAVVDEEC
FT                   LLGDSLAHASSQQSWIKSAFNIPSRMLSRLAEAGMPRRKVFLIKVQREGSQGEFQYVAR
FT                   HYDDLKHLYASLRKEFPGKKIPALIEENRIPICISKQPFDTKFKSAGSGNQTDVDCILG
FT                   ADPLDQQPSPPSVSSLYRGYENSRGSVSNGDADEQTTSSDASSTSYIILEMEAMRTALR
FT                   QYLRAICQDAEVSASLSLTKFLFKRTIDKRAFTPEILEDIESRELMDVYNLENQVKFQK
FT                   MAFDRTVKLQSSLKSLKDTILQDNDYIMRLFREFKEKEDPSDLSEPLRDFFEWCKIYIS
FT                   ATTYQVFLGNDNCYDFYYHVRRLHKLMPYTVMSKIMKYTNPMSIMKTMMDLFMARPFGG
FT                   QSLLQTIFSNILSDDLKVQEKMIEDLEMYVTSETIHGSEVARVLQKCIFDNEQGEYIDM
FT                   DAVYEFAKAKDLPLVLVILMQCHKTKLLSSTALEEVKNSFKYWKTMKSMELSMVSTNSS
FT                   ITDCPGLYFSHIKELLHIYIKERDIRVMKLLWQESELPALLKSIVSLFYEPLVKLFKVA
FT                   RVDVAMANFEKFMDELISLLDDVITGKHGLATRVNVVEKIHGLVDKHEDIFYKFIHEIY
FT                   VNDTENIFEGLITWISDVSAFLQNSKWGEVSERVDLMALLHAHSDIVDVPTLRKQLADM
FT                   VDQKRKAQEIYSKIVNLKAATADSKGDGSLQQRIDDGWKQMNNAVLPQDAINFGIDDRD
FT                   LVDLDIDVGDFDYLHNEEQELQDEYRTILNKQVDTSEIERFNKLVFRNTLKELLNV"
FT   CDS_pept        complement(47139..47705)
FT                   /codon_start=1
FT                   /gene_family="HOG000065990" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19776426"
FT                   /gene_name="SLX9"
FT                   /locus_tag="AEL319C"
FT                   /product="Ribosome biogenesis protein SLX9 "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="AAS52365.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG058995"
FT                   /db_xref="HOGENOM:HBG448444"
FT                   /db_xref="UniParc:UPI0000252C2D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758S2"
FT                   /transl_table=1
FT                   /translation="MVAKKRTQLRAKAMRQRRNSSEAMETEELPPDPKAFLHQLRESKR
FT                   EKQLNRSQSFLNRLRDQAGNGGISKSALRRRKKRMKEELKPRMEDLLTSLKEEGVLEED
FT                   ESGELAAVTGVTAITASNGYSGLHDTAEACGTVRIRKNEPSIRTQRGAKLLTTKEQERF
FT                   TKVISNERFRSSPFETLREIIKSRK"
FT   CDS_pept        48135..48680
FT                   /codon_start=1
FT                   /gene_family="HOG000216577" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20623889"
FT                   /locus_tag="AEL318W"
FT                   /orf_name="AGOS_AEL318W"
FT                   /product="AEL318Wp"
FT                   /biological_process="protein targeting"
FT                   /cellular_component="mitochondrial outer membrane
FT                   translocase complex"
FT                   /protein_id="AAS52366.1"
FT                   /db_xref="GO:0005742"
FT                   /db_xref="GO:0006605"
FT                   /db_xref="HOGENOM:HBG059002"
FT                   /db_xref="HOGENOM:HBG333608"
FT                   /db_xref="InterPro:IPR002056"
FT                   /db_xref="UniParc:UPI0000252C2E"
FT                   /db_xref="UniProtKB/TrEMBL:Q758S1"
FT                   /transl_table=1
FT                   /translation="MSQTVSRVFALTTATVVAVAAGYALYFDYQRRHNPGFRKNLKRSL
FT                   KKQRAQEHAEHEEAKQATMAHVGEYLTMELIKEPIPQDSNEKQASFKVNVEEGEMLAKV
FT                   PGKELESALKFYRALAMYPSPAELLGIYQRSIPEAVYEYIVLMIAILPPVNVSSFLSGS
FT                   ASTASVHAQPQEAVGIDE"
FT   CDS_pept        join(complement(49352..49398),complement(48857..49298))
FT                   /codon_start=1
FT                   /gene_family="HOG000160735" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19776427"
FT                   /locus_tag="AGOS_AEL317C"
FT                   /product="AEL317Cp"
FT                   /protein_id="AAS52367.2"
FT                   /db_xref="HOGENOM:HBG191472"
FT                   /db_xref="UniParc:UPI0001DB2951"
FT                   /db_xref="UniProtKB/TrEMBL:Q758S0"
FT                   /transl_table=1
FT                   /translation="MSLVKNSTHLLLYSFAFGGTAFYGYVFSPIAFKTLDRETFSSIQN
FT                   RMLELVFKVQTVAPIVIGLTAPFPLATPTLATLLPATATGAVNLFWLLPWTRRVKRERR
FT                   QAAKELSGDELEAVDAPLRKEFGRSHGLSLLFNMLHTASMLAYGVFLSKSLFKYVRRV"
FT   tRNA            49710..49783
FT                   /gene_name="tRNA-Val"
FT   tRNA            50062..50133
FT                   /gene_name="tRNA-Asp"
FT   CDS_pept        50307..51464
FT                   /codon_start=1
FT                   /gene_family="HOG000109569" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15755775"
FT                   /gene_name="KAE1"
FT                   /locus_tag="AEL316W"
FT                   /product="Putative glycoprotein endopeptidase KAE1 "
FT                   /EC_number="3.4.24.-"
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="chromosome, telomeric region "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52368.1"
FT                   /db_xref="GO:0000781"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG236550"
FT                   /db_xref="HOGENOM:HBG304663"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="UniParc:UPI0000252C30"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758R9"
FT                   /transl_table=1
FT                   /translation="MVNLNKVQPRSGGDHYLALGIEGSANKLGVGILKHPMLSQHKQGS
FT                   LSHDCQAEILSNIRDTYITPPGEGFLPRDTARHHRNWVVRLVRRALVEAGIEDPRLLDV
FT                   ICFTKGPGMGAPLHSVVVAARTMSMLWDVPLVAVNHCIGHIEMGREITKAENPVVLYVS
FT                   GGNTQVIAYSENRYRIFGETLDIAIGNCLDRFARTLKIPNDPSPGYNIEQLAKQCKNKD
FT                   RLVELPYTVKGMDLSMSGILAHIDSLAKDLFRRNTKNYKLFDRETGKQLVTVEDLCYSL
FT                   QEHLFAMLVEITERAMAHVNSNQVLIVGGVGCNVRLQQMMASMCQSRADGQVHATDERF
FT                   CIDNGVMIAQAGLLQYRMGDIVKDFSETVVTQRFRTDEVYVSWRD"
FT   CDS_pept        51726..52598
FT                   /codon_start=1
FT                   /gene_family="HOG000001093" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18080753"
FT                   /gene_name="SPC34"
FT                   /locus_tag="AEL315W"
FT                   /product="DASH complex subunit SPC34 "
FT                   /biological_process="cell division"
FT                   /biological_process="chromosome segregation"
FT                   /biological_process="mitosis"
FT                   /cellular_component="condensed chromosome kinetochore "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="microtubule"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="spindle"
FT                   /protein_id="AAS52369.1"
FT                   /db_xref="GO:0000777"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005819"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007059"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG059018"
FT                   /db_xref="HOGENOM:HBG202373"
FT                   /db_xref="InterPro:IPR013966"
FT                   /db_xref="UniParc:UPI0000252C31"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758R8"
FT                   /transl_table=1
FT                   /translation="MSESLSYCLDQIKESADSIATLYFKPPGIFQNALVHNSKTSYAEI
FT                   ITRLIRDADPVDEMSLYMTDKGGKLRRKDGKQGVYDHLTERAATLKRARLLGAPEETPI
FT                   VHVPKEFYLKQHDIITKKKQRQNRDFLFDEFSKESGGMFEVLIKKFAGDQQVRNLLLAL
FT                   QNGSVITGEDASSRRKTMFVEDFSVELILRLLREIVTQWPLNEHRTKYEHLLQTYHDIS
FT                   DATNKLRAQIADQEHRLQSQDALSEEPDADDDDVAHPTSGVSYLIQQELDEIDALEREL
FT                   EQLRRDSRT"
FT   CDS_pept        52979..55126
FT                   /codon_start=1
FT                   /gene_family="HOG000048466" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19776428"
FT                   /gene_name="MDV1"
FT                   /locus_tag="AEL314W"
FT                   /product="Mitochondrial division protein 1 "
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="AAS52370.1"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="HOGENOM:HBG059021"
FT                   /db_xref="HOGENOM:HBG327700"
FT                   /db_xref="HSSP:1ERJ"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI0000252C32"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758R7"
FT                   /transl_table=1
FT                   /translation="MSSGTSGDQISHFGKTLTTTASLVFGSQSMEDTILSYSSPYKKIL
FT                   HDTITSSGGTSSLMKVERSGRMFTPFRTRNSAFQDIFHASSGRGYFKNGFSDTRTSFQV
FT                   LSYLSDAMLADIPSSESAAATSGKLVTEKGEKGKKKRAETAHARGPSLYQGFEASLPTI
FT                   NQTITTHQKKQIMNRDIKSIRESDATPEDVGQDVDIEKGEEETTHDEFTLPKGIKPEHL
FT                   SNSYSIKNLKGAVQTITDNLDLLEIQKNLAASEIRELDLKMEKLKLMRDLVFRRVAKIE
FT                   QNELFLEKHLMNIRERIDMIEEYNLDNDTDAEKAYEEATSAPEDTKDQYSELPDANTAE
FT                   SGETVVQEPQVNLASAQKSLKKRSKQTGYSHKNHEKKVQQHEFRHLRKTYPTLQQYYEP
FT                   GANILSFDSAHEDNVTCLDFNLPFGTLCSAGKLDPTIKVWNLSKNKHVASITGHLATVS
FT                   CMQMDQYNTLITGGRDALLKMWDIQKAIDNDSIPSDEVCIYTFDSHIDEITALSFEANN
FT                   LVSGSQDRTIRQWDLNNGKCVQTLDINFATGGNLSRSMIGSGFLNTNNDHPIIGAIQCY
FT                   DAALATGTKDGIVRLWDLRSGRVVRTLEGHSDAVTSLQFDSLNLVTGSLDNSIRIWDLR
FT                   TGTLADTFSYEHPVTCLQFDLNKIVVANQEGTVKVYNRQEKKHWFCGGDEHSENAVEYV
FT                   RYKDGYLVEGRANGDINAWAI"
FT   tRNA            join(complement(55446..55483),complement(55373..55416))
FT                   /gene_name="tRNA-Leu"
FT   CDS_pept        complement(56360..56692)
FT                   /codon_start=1
FT                   /gene_family="HOG000196422" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15755776"
FT                   /locus_tag="AEL313C"
FT                   /orf_name="AGOS_AEL313C"
FT                   /product="AEL313Cp"
FT                   /function="cytochrome-c oxidase activity"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="AAS52371.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="HOGENOM:HBG059027"
FT                   /db_xref="HOGENOM:HBG324232"
FT                   /db_xref="InterPro:IPR003213"
FT                   /db_xref="UniParc:UPI0000252C33"
FT                   /db_xref="UniProtKB/TrEMBL:Q758R6"
FT                   /transl_table=1
FT                   /translation="MGWFNSSKAAEDQTRAPDKASRQRCWESRDAYFECLDSINVVNAL
FT                   DPTATPQVRRNCGKQEDSFHQNCVTSWIKYFKEKRVSDSKRDAMVAKLEEQGARRIELG
FT                   YVPPSK"
FT   CDS_pept        complement(57124..58110)
FT                   /codon_start=1
FT                   /gene_family="HOG000205347" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15755777"
FT                   /locus_tag="AEL312C"
FT                   /orf_name="AGOS_AEL312C"
FT                   /product="AEL312Cp"
FT                   /protein_id="AAS52372.1"
FT                   /db_xref="HOGENOM:HBG059032"
FT                   /db_xref="HOGENOM:HBG398646"
FT                   /db_xref="InterPro:IPR005556"
FT                   /db_xref="UniParc:UPI0000252C34"
FT                   /db_xref="UniProtKB/TrEMBL:Q758R5"
FT                   /transl_table=1
FT                   /translation="MKSTLLLSAAAAAVAQGATINQSKAQEVQTGTCAFPHGKGMVAVQ
FT                   TEGKNAGWAMHSDQECKPGTWCPYACPAGQLMGQWNPQVTAYTYPGSMEGGLFCDESGN
FT                   LQTPYPDKPYCYDGKGTVIAENKAGADVAFCQTVLPGNEEMLIPTLVGGGSSQTLAVPG
FT                   TDYWAGTAAHYYVNPPGVSVKDACIWGTKENARGNWAPYVTGANQDAEGNTFVTVGWNP
FT                   IYLEPETPFRNVKPSYGLRIVCDNEEDCVGLPCGIDPSVNGVNEIQGSGSTGAGGANFC
FT                   VVTAKKGAKARVEVFSTGGNAKRSLEHTHNRGNLSDIHRTVTTIAMN"
FT   tRNA            59814..59895
FT                   /gene_name="tRNA-Ser"
FT   tRNA            59901..59972
FT                   /gene_name="tRNA-Asp"
FT   CDS_pept        60023..60913
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18080754"
FT                   /locus_tag="AEL311W"
FT                   /orf_name="AGOS_AEL311W"
FT                   /product="AEL311Wp"
FT                   /protein_id="AAS52373.1"
FT                   /db_xref="HOGENOM:HBG398582"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="UniParc:UPI0000252C35"
FT                   /db_xref="UniProtKB/TrEMBL:Q758R4"
FT                   /transl_table=1
FT                   /translation="MCGRYALAWNQDQLYDQLKLQHVPVNQSRLEFSPSYNIAPTQMAP
FT                   VYHGQTLELMNWGVVPRRSHASETNQRYSTFNARSEKLLESQLWEPLCARTRCAVPITG
FT                   YYEWQSRTSGRQPYFVHRKDKQVLFLAGMYSRAESASGSGTLSYTIVTAPAPRELAWLH
FT                   DRMPVVLRPESPQWADWLDAGRVQWDAEDLVRVLTPQFDAMLAWHAVTPDVGRVANNSA
FT                   RLMRPLPPRPSVVDMLRASARGAAARPQDKASRKRQGLRRPGRQLPPAGRPAGPLPQTR
FT                   APCSDEPLPQRPRRP"
FT   CDS_pept        complement(60741..61961)
FT                   /codon_start=1
FT                   /gene_family="HOG000019981" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20623890"
FT                   /locus_tag="AEL310C"
FT                   /orf_name="AGOS_AEL310C"
FT                   /product="AEL310Cp"
FT                   /function="ATP binding"
FT                   /function="tetrahydrofolylpolyglutamate synthase activity "
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /protein_id="AAS52374.1"
FT                   /db_xref="GO:0004326"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="HOGENOM:HBG228659"
FT                   /db_xref="HOGENOM:HBG744947"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="UniParc:UPI0000252C36"
FT                   /db_xref="UniProtKB/TrEMBL:Q758R3"
FT                   /transl_table=1
FT                   /translation="MELGLGRITQVLRQLHSPHERMRVLHVAGTNGKGSVCAYLAAVLR
FT                   AGGERVGRFTSPHLVHPRDAITVDGEVIGAATYAALKAEVVAAGTCTEFEAQTAVALTH
FT                   FARLECTWCVVEVGVGGRLDATNVVPGGRKLCAITKVGLDHQALLGGTLAVVAREKAGI
FT                   VVPGVRFVAVDGTNAPSVLAEVRAAAAKVGAEVHETGGAPVCTVSWGAVAASALPLAGA
FT                   YQVQNAGVALALLDHLQQLGEISVSHAALERGLKAVEWPGRLQQVEYDLGGVHVPLLFD
FT                   GAHNPCAAEELARFLNERYRGPGGSPLIYVLAVTCGKEIDALLAPLLKPHDRVFATSFG
FT                   AVESMPWVAAMASEDVAAAARRYTAHVSAVADPLDALRAAAAARGDANLVVCGSLYLVG
FT                   ELLRREH"
FT   CDS_pept        62036..62377
FT                   /codon_start=1
FT                   /gene_family="HOG000000759" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20623891"
FT                   /gene_name="MED11"
FT                   /locus_tag="AEL309W"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 11"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="AAS52375.2"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG059042"
FT                   /db_xref="HOGENOM:HBG203430"
FT                   /db_xref="InterPro:IPR019404"
FT                   /db_xref="UniParc:UPI0001DB2952"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758R2"
FT                   /transl_table=1
FT                   /translation="MPQPDSVKARLAALDRIDDELCAVLQHAQATIGALAELKRGHAAL
FT                   QPQLEQHVRDYYRTLEHSTVALRNEIRELDAAVGTQLLPVNIGKRAVGQDQEKLSEQLA
FT                   QMDKYVGSM"
FT   CDS_pept        62529..63713
FT                   /codon_start=1
FT                   /gene_family="HOG000144403" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20623892"
FT                   /locus_tag="AEL308W"
FT                   /orf_name="AGOS_AEL308W"
FT                   /product="AEL308Wp"
FT                   /protein_id="AAS52376.1"
FT                   /db_xref="HOGENOM:HBG059046"
FT                   /db_xref="HOGENOM:HBG203429"
FT                   /db_xref="InterPro:IPR022210"
FT                   /db_xref="UniParc:UPI0000252C38"
FT                   /db_xref="UniProtKB/TrEMBL:Q758R1"
FT                   /transl_table=1
FT                   /translation="MYASGHGNGARAPAGGRRGSVDGAGELQGLVLDQITKIQERQQRL
FT                   DERLDKLAREQEEFYLNGYKKMDQGFKDVSKCLQEVRAMKEVFKEIIGVMTGERVRFVD
FT                   HSNESCDAAEAQGVNQSELLVDNMRRQLQQRQSDWIRDRLALETRPGYGVKNEFEGERS
FT                   VEQMLVQRQQELADVSDGRVPPDDFPTYRMNRAIRSVTDLAREYYEGLRGKPSVMSLER
FT                   RFGSTWRNSSKERTFFHKRMCIINKINDIKDNPVKYQLPQDITRKMAIRVVENMRLGNN
FT                   CFKGRRCCLTLSQLYVYLSKKMDTSSDYSLELRQVGKTTRELITQERIRSLEPPSRDSP
FT                   MESPPDGIPGRPVMIAVSSAPASLPPFEFTPVVASSVEDSNDLEENGEEEDVDY"
FT   CDS_pept        complement(63871..64710)
FT                   /codon_start=1
FT                   /gene_family="HOG000066092" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15755778"
FT                   /locus_tag="AEL307C"
FT                   /orf_name="AGOS_AEL307C"
FT                   /product="AEL307Cp"
FT                   /protein_id="AAS52377.1"
FT                   /db_xref="HOGENOM:HBG059052"
FT                   /db_xref="HOGENOM:HBG202414"
FT                   /db_xref="UniParc:UPI0000252C39"
FT                   /db_xref="UniProtKB/TrEMBL:Q758R0"
FT                   /transl_table=1
FT                   /translation="MPIPDMSSQYPHQQEDMSQEEEPRGRKPQSMVDQEKQDYLDFIVP
FT                   RLQITGKILQLTEEVIQEQANYISRYIDFLNKYINYQRKVSTLRFERATLIKYVKKLRF
FT                   LNDFLYTYNADVNMITEPLQKLVRPLGSFFIRYLEIIDLLNYYLTQSLRNETISKTLNQ
FT                   DLVLSQECIAMADKTYRVYVKFVQWFIESSSSVTTGDLTMEIVQFTRKCAVEDGIDLGE
FT                   TDDVLLQEVQLVTSSEEFEDLLEKWQQVLHFQCADLDDTFNDNIRHWSELFDKKKEK"
FT   CDS_pept        complement(65142..69020)
FT                   /codon_start=1
FT                   /gene_family="HOG000260265" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18080755"
FT                   /gene_name="MYO1"
FT                   /locus_tag="AEL306C"
FT                   /product="Myosin-1"
FT                   /function="ATP binding"
FT                   /function="actin binding"
FT                   /function="motor activity"
FT                   /cellular_component="actin cortical patch"
FT                   /cellular_component="myosin complex"
FT                   /protein_id="AAS52378.2"
FT                   /db_xref="GO:0003774"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016459"
FT                   /db_xref="GO:0030479"
FT                   /db_xref="HOGENOM:HBG501769"
FT                   /db_xref="HOGENOM:HBG717149"
FT                   /db_xref="HSSP:1YP5"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR010926"
FT                   /db_xref="UniParc:UPI0001DB2953"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758Q9"
FT                   /transl_table=1
FT                   /translation="MAIIKRGVRQKTQPPAKRTTNIKKATFDSGKKKEVGVSDLTLLSK
FT                   ISDEHINENLKRRFENGSIYTYIGHVLISVNPFRDLGIYTDQVLETYKGRNRLEVPPHV
FT                   FAIAEAMYYNLKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASSSHEASIGRIKDMV
FT                   LATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNAQFEPCAGQITNYLLEKQRVVGQIKN
FT                   ERNFHIFYQFSKGASDRYRKTYGVQLPEQYVYTSASGCTSVDTIDDLNDYEATLEAMNV
FT                   IGLSQAEQDEIFRLLSAILWIGNVTFMEDDEGNAKIADTSITDFVAYLLQVDAGLLVKS
FT                   LVERTIETTHGMRRGSIYNVPLNIVQATAVRDALAKAIYNNLFEWIVDRVNVSLQALPG
FT                   AEKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQEEYAKEQIQWTPI
FT                   KYFDNKVVCELIEAKRPPGIFAALNDSVATAHADSNAADQAFAQRLNLFTSNPHFELRS
FT                   SKFVIKHYAGDVTYDIGGMTDKNKDQLQRDLVELLNSTSNTFLATIFPDTGDKDSKRRP
FT                   PTAGDKIIRSANELVDTLSKAQPSYIRTIKPNQTKSPLDYDDRQVLHQVKYLGLQENVR
FT                   IRRAGFAYRQTFEKFVERFYLLSPQCSYAGDYTWQGNTLDAVNLILRDTSIPVTEYQLG
FT                   VTKVFIKTPETLFALENMRDKYWHNMASRIQRAWRRFLQRRIDSAIRIQRAIREMKHGN
FT                   QFEQLRDYGNKLLGGRKERRAMSLLGYRAFLGDYLSCNELKSKGAFVKRKAGINDHVVF
FT                   SINGQALHSKFGRSAQRLPKTFILTPSHFYIIGKTLVNNQLTYAVDYKIDVRQIVYVSL
FT                   TNLQDDWVGIFVSNSTQPDPLINTYFKTELITHLKKLNNRIEIKIGPTIEYQKKPGKIH
FT                   AVKSQINENAPPLGDIYKSSTIMVRRGRPGNCSQRKKPLSTRLPDTYTTRETGYKNAGH
FT                   PTNIRQVQEPTHISHSQQHTSSNLGFVYSLNPSAVNHPRPVPSGSVGTTSTPPKQAASA
FT                   AQAAYNPHKLGGNMDNSSAAYGNASALPNSAPSQAPKPASRPVPKPAPRPGPKPGPKPG
FT                   PKPGPKPAPKPMPRPAKSVENSVPRPNAIEQGKTAPPPPPPPPPPPAAVPSEPVYEAAF
FT                   DFPGSGSPNEFPLKKGDRIYVTRQEPSGWSLAKALDGSKEGWVPTAYIVESKAAFSQLE
FT                   QPVASSAPLGNSGVATREAGTTSAATAAASAATPTAFSAGLADALAARANKMRHEDSGS
FT                   DDNADDDW"
FT   CDS_pept        complement(69382..71388)
FT                   /codon_start=1
FT                   /gene_family="HOG000258448" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19776429"
FT                   /locus_tag="AEL305C"
FT                   /orf_name="AGOS_AEL305C"
FT                   /product="AEL305Cp"
FT                   /function="acetolactate synthase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="magnesium ion binding"
FT                   /function="thiamine pyrophosphate binding"
FT                   /biological_process="branched chain family amino acid
FT                   biosynthetic process"
FT                   /protein_id="AAS52379.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0003984"
FT                   /db_xref="GO:0009082"
FT                   /db_xref="GO:0030976"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG323037"
FT                   /db_xref="HOGENOM:HBG460149"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="UniParc:UPI0000252C3B"
FT                   /db_xref="UniProtKB/TrEMBL:Q758Q8"
FT                   /transl_table=1
FT                   /translation="MLRRVTVRQLANVRALARATRPLAVARAFSGAAGRLGAEAQEAPR
FT                   RRAPGPRGETEPQGAAGAHEMDHSMIGFSGGEIFHEMMRRHNVDTVFGYPGGAILPVYD
FT                   AIYNSDAFNFVLPKHEQGAGHMAEGYARASGKPGVVLVTSGPGATNVVTPMADALADGV
FT                   PMVVFTGQVPKAAIGTDAFQEADVVGISRSCTKWNVMVNHVEELPRRINEAFEIATSGR
FT                   PGPVLVDLPKDVTAAILRSPIPLASALPSTTLAQLTRQAADIDGVRSLADASRLINMAQ
FT                   KPVLYVGAGILNSTRGPEFLRELAEKAQIPVTTTLQALGAFDQEDSKSVDMLGMHGSAA
FT                   ANLTVQNADLIIALGARFDDRVTGNIAKFAPEAQRAAREQRGGIVHFEISPKNINKVVD
FT                   AQVAVEGDVTANLEKLLPLIKPVAERKEWLGQIASWKSEYPYDYSRETPGSRIKPQTVI
FT                   TRLSEIANATGKEVIVTTGVGQHQMWAAQHWTWKKPRTFITSGGLGTMGFGLPAAIGAQ
FT                   VAKPDAIVIDIDGDASLNMTLMEMSSAVQAGAPVKILLLNNEEQGMVTQWQSLFYEHRY
FT                   SHTHQLNPDFVKLADAMGFKAMRLEAQSDMEPMLQEFINCKEPVLLEVAVEKKVPVLPM
FT                   VPAGKALHEFIYFDPEVERQQAELRSRRTGGKH"
FT   CDS_pept        complement(71671..72582)
FT                   /codon_start=1
FT                   /gene_family="HOG000185073" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15755779"
FT                   /locus_tag="AEL304C"
FT                   /orf_name="AGOS_AEL304C"
FT                   /product="AEL304Cp"
FT                   /protein_id="AAS52380.1"
FT                   /db_xref="HOGENOM:HBG059067"
FT                   /db_xref="HOGENOM:HBG202415"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI0000252C3C"
FT                   /db_xref="UniProtKB/TrEMBL:Q758Q7"
FT                   /transl_table=1
FT                   /translation="MRFPSAMTVFALLDRALAAQDSSAKYTALPGYFQLFPHEGAGSVA
FT                   APPAADPVNFVHAQSWEELFASVPSDAKLLIFQRHAEGLHNAAEARYGHEAWDDYWSKI
FT                   DGDEYGTWVDAQLTPKGHQQASASSEHVGALVRALGMPERLYSSPLRRCLETFIEAWAP
FT                   VAQYISEPVLDLYVREGLRETLGVHTCDRRVPHSQAVAAYQGHRLANSTLQLHYEPYYT
FT                   EPDTLWTVAHRETTPEIRNRVTKALDRILDRPERYIFVTAHSEMMDAALHALHHPRVNH
FT                   VPNAGILYLVVGHIRTPAQASG"
FT   CDS_pept        complement(72783..73112)
FT                   /codon_start=1
FT                   /gene_family="HOG000000758" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15755780"
FT                   /locus_tag="AEL303C"
FT                   /orf_name="AGOS_AEL303C"
FT                   /product="AEL303Cp"
FT                   /protein_id="AAS52381.1"
FT                   /db_xref="HOGENOM:HBG059072"
FT                   /db_xref="HOGENOM:HBG398744"
FT                   /db_xref="InterPro:IPR020485"
FT                   /db_xref="UniParc:UPI0000252C3D"
FT                   /db_xref="UniProtKB/TrEMBL:Q758Q6"
FT                   /transl_table=1
FT                   /translation="MAGGIFEPFSVYNRSKHSKSGIVGGNHSNIGAGRTMLLFADEYRE
FT                   PKAQADAAHGAAVQAAGTGSEPASRKGSVGEGPNMVDLSTLSQAEFERLKATLRKGAPN
FT                   NRVNF"
FT   CDS_pept        73455..74783
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19776430"
FT                   /locus_tag="AEL302W"
FT                   /orf_name="AGOS_AEL302W"
FT                   /product="AEL302Wp"
FT                   /protein_id="AAS52382.1"
FT                   /db_xref="HOGENOM:HBG059078"
FT                   /db_xref="InterPro:IPR007567"
FT                   /db_xref="UniParc:UPI0000252C3E"
FT                   /db_xref="UniProtKB/TrEMBL:Q758Q5"
FT                   /transl_table=1
FT                   /translation="MCSGGCAVPATQAAVCWRMVIAFLKSQSTVSGFIRLHRVADRWIS
FT                   RAVAAPQTLQPRYWLSRQHKSIHEIGGHSSGTHMRTFRLLLVAGALNVVLAQMMNNSLS
FT                   SSGSRPTALTPLPSSAESRTSSSGRVSTLSSAASSSEESSSAASSSSEESSSATSSRAE
FT                   ESSSAESSSTSSSTSSESGSSESGSSSASVVSSTSANRMSSSSTSNSSETSSTEAEPTP
FT                   TSTSTSSSVTLPTSTTPPSTEATPTAIAPTSRMDTVTQTVQTEFMSDGSTFRTTSLKIV
FT                   TLLVDGSSTLTITASESQTTAPSRGLSKKDKNIIIGCVVGICVPLLIVIACVVFYTCVR
FT                   EDRTNFINSDGKVITAYSTSRLSKWWSTLLGRKIDKYESDTPLGSTPLHDDERIHLKSS
FT                   SAHHSSPLSMHGLDSRARSSHELMLDEERYYDNDGNELNGKKY"
FT   CDS_pept        75105..77978
FT                   /codon_start=1
FT                   /gene_family="HOG000265621" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19776431"
FT                   /locus_tag="AGOS_AEL301W"
FT                   /product="AEL301Wp"
FT                   /function="ATP binding"
FT                   /function="calcium-transporting ATPase activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS52383.2"
FT                   /db_xref="GO:0005388"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG491941"
FT                   /db_xref="InterPro:IPR000695"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006413"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001DB2954"
FT                   /db_xref="UniProtKB/TrEMBL:Q758Q4"
FT                   /transl_table=1
FT                   /translation="MGSVGKMSDNPFDSYLNRSKDDSSMETKSLASEAFLKPNASLEYC
FT                   TMTVDETLRQLNTDSAKGLCDQQQVRASEQEWGTNEVTVDGEDPVWKRFMSTFVEDPLI
FT                   LLLIGSAVLSFLMGNIDDAVSITLAVVIVVSVGFVQEYRSEKSLEALHKLVPASCHLIR
FT                   FGAETHVLASCLVPGDLVYFKVGDRIPADVRIIESTDLSLDESTLTGETEPVHKSCTPV
FT                   NSATYSDVPGGIIPIGERTSIAYMGTLVREGHGKGIVVATGKHTMFGAVFEMMNSIEKP
FT                   KTPLQMAMDRLGKDLSYVSFFLIGIIFLLGVIQGRSWLEMFQISVSLAVAAIPEGLPII
FT                   VTVTLALGVLRMANRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLGSMA
FT                   NKNNVLSLEAKSSGGLPGKLPNLKNYLSDDVKATLRIGSICNNASFSHEHGKYLGNPTD
FT                   IALLEVLQKFDLVDERPTTTRVDELTFNSKRKYMAVKVDSPANSGKHIIYVKGAFERIL
FT                   ERSASFIGGAGKVEKLSDSHKSLINDCAKSLASEGLRTLAFAQLECSTNKPMNDSTIQN
FT                   LTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINPEIS
FT                   VLTGDRLDQMTDDQLAGVIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPA
FT                   LKLADIGVAMGHMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTS
FT                   VAALSLVAIATAFKLQNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRSDK
FT                   ILTPQVMRRLLINAAFIIGGTIYVFIKEMTEDGQVTARDTTMTFTCFVFFDMFSALACR
FT                   HATKSIFEIGIFNNKMFNYAVGFSLLGQLCAIYIPFFQNIFKTERLSLGDLIYLIVISS
FT                   SVFIADEVRKYYAKKNTHQDAYYFSMV"
FT   CDS_pept        complement(78173..79429)
FT                   /codon_start=1
FT                   /gene_family="HOG000076160" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15755781"
FT                   /locus_tag="AEL300C"
FT                   /orf_name="AGOS_AEL300C"
FT                   /product="AEL300Cp"
FT                   /protein_id="AAS52384.1"
FT                   /db_xref="HOGENOM:HBG449144"
FT                   /db_xref="HOGENOM:HBG738264"
FT                   /db_xref="InterPro:IPR004388"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniParc:UPI0000252C40"
FT                   /db_xref="UniProtKB/TrEMBL:Q758Q3"
FT                   /transl_table=1
FT                   /translation="MQRSFSFLRRSGFHSAMSYNTKVLRVDPSAIHFSATAHIDGSLPR
FT                   ISDPETEKHLLEAARLIRDDGETVAFPTETVYGLGGSSLNDASVRNIYKAKNRPSDNPL
FT                   ISHVSSIAQLNRRIYQQDREGDVLRNIPVVYHELVRQLWPGPLTILLPINEETALSVLT
FT                   TAGQPTFAVRIPADPVARALIALSDTPIAAPSANVSTRPSPTAAEHVYHDLKGKIPLIL
FT                   DGGSCRVGVESTVIDGLVNPPMLLRPGGFTYEEIIELGGEQWSHCKVENRMTVGSGEKV
FT                   RTPGMKYKHYSPRASTVAFAPINDDLPTSERMKIVTSEIMKYMTSHGTDKRQKVGLLTS
FT                   IMFPNNLLESITDEVDVVVYSLGSSGKEVQSNLFAMLRRLDEEDEVDLIFVEGISDRNE
FT                   GLAVMNRLRKAAGGNVVSF"
FT   tRNA            80103..80173
FT                   /gene_name="tRNA-Gly"
FT   CDS_pept        80283..81032
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15755782"
FT                   /locus_tag="AEL299W"
FT                   /orf_name="AGOS_AEL299W"
FT                   /product="AEL299Wp"
FT                   /protein_id="AAS52385.1"
FT                   /db_xref="HOGENOM:HBG059093"
FT                   /db_xref="UniParc:UPI0000252C41"
FT                   /db_xref="UniProtKB/TrEMBL:Q758Q2"
FT                   /transl_table=1
FT                   /translation="MNSTRYDPVDSDDILFSADDDGFDAAEHVATGTSMSAGDPQLGGG
FT                   LFNTLAPYYAVTSEQLFHKTRSSLMLQKVQTLEMGNAATEIYSTVWIILSASIALYVSR
FT                   GLRTVLSEILRGQEDGGSHGQYQILVHVLWLFATYVVAVPLVFKLVVQYAFSEALHGLE
FT                   LVQWYGFGCLVWIPLTPISLVLGLLPEGWAGLAHLILAIAGGAYSFMVIYIQLKDDLSE
FT                   LSRGRAVMAMMAVMHLVFVLLIKLLIL"
FT   CDS_pept        complement(81183..82196)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929434"
FT                   /locus_tag="AGOS_AEL298C"
FT                   /product="AEL298Cp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52386.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059097"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001DB296E"
FT                   /db_xref="UniProtKB/TrEMBL:Q758Q1"
FT                   /transl_table=1
FT                   /translation="MLSSIAIDNQHADKTLPPLLLLPPVIHTEAQAAGGTGATTPVSSY
FT                   DAGLAGYGAGYEEGEADAAAEHKPVSPYSETSTTSSSLERLAFLATRKGDGSGQYGAAP
FT                   DAYYVGRQAPAYQTPFYGGTVAPGAARSLTPNGAPRLQYEATYNTPRSPESARGVSMSP
FT                   LMSESASGFQRGDVQRTGSPPNSLLQEPTVITASKYKRQRTGPSCDICRSKKIKCDATI
FT                   TILFQDASVTGSFNEMLHAPVNVSELANEWLSQIPDEVRQALLTKELTLLKHVDKLIAF
FT                   KPCTSCSKRKNCFCTFSKGFTRADINVYTNLCVKFGKRSSIDQFSLNDYRNCGYQV"
FT   CDS_pept        83369..86056
FT                   /codon_start=1
FT                   /gene_family="HOG000204521" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19776432"
FT                   /locus_tag="AGOS_AEL297W"
FT                   /product="AEL297Wp"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="AAS52387.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG522470"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR013967"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001DB296F"
FT                   /db_xref="UniProtKB/TrEMBL:Q758Q0"
FT                   /transl_table=1
FT                   /translation="MAKRKLPDRPPNGSGAGERPSVRPRRLDSGRAYSTLTQPFRVPLN
FT                   SERTRHGERYGVRATRRAVTTYAEEGGARSEENDVGGKRIDALSAQRLSKDAQRLAGIE
FT                   RTLRRSFSVPIKGYVPRHNIPLALGMKMRVVAPPRPLHDPTEEFAIVLYDPTVDGEIPD
FT                   ETPREEPAQKENDGGNEEQARPTRRTATHPEKLSNGLRNKTLRELLGTVTETPKFPSVP
FT                   VVIDPRLARILRPHQVEGVRFLYRCVTGLAMKDFLDTQAVLAAGEVQDDGTGKDPGSKD
FT                   SEPIVVEVLEETPTPTPTPTPTPSPEILDANAAMTRESNRGAYGCIMADEMGLGKTLQC
FT                   IALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDALSPLAIDGRKSSLS
FT                   NGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLMLADEGHRLKNGDS
FT                   LTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFRKNFEIPILRGR
FT                   DADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHILFVNLSPMQKAIY
FT                   EHFVRSREVAKLMKGTGSQPLKAIGLLKKLCNHPDLLDLPDEIAGSTNLIPDDYQSAMT
FT                   HNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLISNYTQTLDLIEKMCRYNH
FT                   YGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWN
FT                   PAADQQALARVWRDGQKKDCFIYRFITTGSIEEKIYQRQSMKMSLSSCVVDEKEDVERL
FT                   FSSDNLRQLFQFDSNTICDTHATYHCKRCRDGKQMIKAPAMLYGDATTWNHLNHDALLK
FT                   TNDHLLRNEHQFNDISYVFQYISH"
FT   CDS_pept        86308..87627
FT                   /codon_start=1
FT                   /gene_family="HOG000246830" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15755783"
FT                   /locus_tag="AEL296W"
FT                   /orf_name="AGOS_AEL296W"
FT                   /product="AEL296Wp"
FT                   /protein_id="AAS52388.1"
FT                   /db_xref="HOGENOM:HBG059109"
FT                   /db_xref="HOGENOM:HBG395984"
FT                   /db_xref="InterPro:IPR008812"
FT                   /db_xref="UniParc:UPI0000252C44"
FT                   /db_xref="UniProtKB/TrEMBL:Q758P9"
FT                   /transl_table=1
FT                   /translation="MDELLSRAGSQAVSFAIKSSVSLASTYAIKQFTKFLTGVPQQDAS
FT                   RLQKLRRQLETRIDIINNAIVLIKLCVVRGNTNLKSTLSLILDLKDELAEFNGDMEMLS
FT                   SASVAGKLPASKNGKAGVDAVSLMEAKMSELIHRIELVIPLINLSMTTSGVSSSMKLPS
FT                   NVSPSLLLQASNYVVKSNEQALADNYEKDVQVGPLFSVTVYDIFDKSSKIIWKETMARC
FT                   DLRIVRISSNIPDRGVEYNYHLELKENFDDDRYHDIKEDKPRKLHWNVEQITRLFFTMS
FT                   GKLLNLEERDSPVLVLKLVKSLGGESGESNESLHWLAVGEYEPASDLRDSDDDIPSPAN
FT                   ADAEAPGQDSDNEDSYDSAQEDGTELEISSSLSLLEYIIKLTSLQNHDQASILDVKDER
FT                   LSLYLNDENPNSVKRQPVVEDVTAKFSKISMKDELPVNKA"
FT   CDS_pept        complement(88055..89689)
FT                   /codon_start=1
FT                   /gene_family="HOG000142074" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15755784"
FT                   /locus_tag="AEL295C"
FT                   /orf_name="AGOS_AEL295C"
FT                   /product="AEL295Cp"
FT                   /function="DNA binding"
FT                   /function="copper ion binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52389.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG059113"
FT                   /db_xref="HOGENOM:HBG103378"
FT                   /db_xref="InterPro:IPR001083"
FT                   /db_xref="InterPro:IPR018373"
FT                   /db_xref="UniParc:UPI0000252C45"
FT                   /db_xref="UniProtKB/TrEMBL:Q758P8"
FT                   /transl_table=1
FT                   /translation="MVLLNGVKYACERCIRGHRVTTCNHTDQPLMMIKPKGRPSTTCAH
FT                   CKELKKNRNAHPSGVCTCGREEKRRQLRAAKEEARVRGRRCRCADREACVCHKTRRRRD
FT                   DGEAGSASEQSSVDGHVMGSPHEPWDAASAASSLPPELSLESATPLGLEPLHAMKPITP
FT                   LTRTHVGEVSIPLHEYVPAELDNSVQSANPLLNLNDRICLQDGAGREERLSFFADTSKA
FT                   RPNYSELKQRRLARAVDGTYAQSMRSASSTELASPAASASSASLLHTLNSSDSLSSYLT
FT                   AGGSAYYSTHYQDMLHHSFSHLGSMPLAPSPQSSATATHLTGGDQPPTSQFLDSPDPAY
FT                   RHPAYRHPASILHPPTGQAGDATAPAQCQVAPAMVQPVRQRSVSIHRNHRYEKFPTSNP
FT                   SQPKDSPLGPVAVLAAHSFQDLSSVGQSTRQDAFAYSNHSVVANDRQPSLPRNPAPDST
FT                   FTAEFNQLLSESSNCLELDSIFSGNSVLWNGETLTSEARATLEGDVPSVSEDARDDSQA
FT                   NSAQNGPEVLSLADTEYADLDSLITNL"
FT   CDS_pept        complement(89998..91098)
FT                   /codon_start=1
FT                   /gene_family="HOG000159782" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15755785"
FT                   /locus_tag="AEL294C"
FT                   /orf_name="AGOS_AEL294C"
FT                   /product="AEL294Cp"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS52390.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG055792"
FT                   /db_xref="HOGENOM:HBG325002"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="InterPro:IPR005217"
FT                   /db_xref="UniParc:UPI0000252C46"
FT                   /db_xref="UniProtKB/TrEMBL:Q758P7"
FT                   /transl_table=1
FT                   /translation="MSEKVFNVAVFFVVFRECLEAAVIVSVLLSFVNQSLGTNSPALRK
FT                   KLWWQVWLGVALGFLVCLIIGGAMIGVYYRYNSDIYGKSEDLWEAIFCFIATIMISVMG
FT                   LPMLRISKLQTKWRVKLAQALLEVPERKRDRFRFGALMKRYAMFLLPCITVLREGLEAI
FT                   VFVAGVGATSQGAAASSYPLPVIVGLIAGAAVGTLLYYGASRSSMQIFLIFSTCLLYLI
FT                   AAGLCSRGAWYAETYRFNMATGGDASESGSGNGSYNILQTVYHINCCNPSLDKGWDIFN
FT                   ALLGWQNTGYLASILAYNLYWLVIIAIVSLMIYDERRGHLPFTRHRLRDLNPLRRRRKE
FT                   LSAAEQDELFERAGRLGFEPDGRVAN"
FT   tRNA            complement(91402..91472)
FT                   /gene_name="tRNA-Gly"
FT   CDS_pept        complement(91553..92110)
FT                   /codon_start=1
FT                   /gene_family="HOG000112502" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15755786"
FT                   /locus_tag="AGOS_AEL293C"
FT                   /product="AEL293Cp"
FT                   /protein_id="AAS52391.2"
FT                   /db_xref="HOGENOM:HBG059125"
FT                   /db_xref="UniParc:UPI0001DB2970"
FT                   /db_xref="UniProtKB/TrEMBL:Q758P6"
FT                   /transl_table=1
FT                   /translation="MEQEPHVIFMNPQTENLQNLYELVEKLARQLNKNKEQRQRLLREV
FT                   DVLASKAQRGLGTSDFRKDARVVEEFLKRRGAGTGGGDGVESLRAQNSRLRALLAEKQC
FT                   NNDATLGLLAHHENSLALVVRLLREDVFQHHAALVARCRRAFNERLCAAEDSEFRAYLE
FT                   NATSLQALIDISRVYQALLRLP"
FT   CDS_pept        92361..94250
FT                   /codon_start=1
FT                   /gene_family="HOG000066029" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20623893"
FT                   /locus_tag="AGOS_AEL292W"
FT                   /product="AEL292Wp"
FT                   /protein_id="AAS52392.2"
FT                   /db_xref="HOGENOM:HBG059130"
FT                   /db_xref="InterPro:IPR006910"
FT                   /db_xref="UniParc:UPI0001DB2971"
FT                   /db_xref="UniProtKB/TrEMBL:Q758P5"
FT                   /transl_table=1
FT                   /translation="MANYPSILLQYEDTEGTGHSGVSIAWLLSNFGTGSVTLASSGGTG
FT                   GSMKCKRRDILNVSIPETCKVISENGAELPLRFSSNLLYGVTVCYSKKTDFILSDVVQM
FT                   KGQLQRKLFGLESALRQGRIPEGAKDTVSAQEFLADDPLFDVAQWGNVRLELDGPDGTR
FT                   SLEIRQQDFLQELNNQDGSFVEAQAGRRGRLGSVDEELASIDMDLNFEIDDLVSEDGRR
FT                   RDELASERSEDEARFELNFNDPFEESQNQLPDVIEGSLLQEDEDMAPDAKHPREEDQAA
FT                   DAEQSPEPETKKRKIAGGAVGLGRLVCDEKISLATETLRDNHNKYAENMEMGRKSGGVS
FT                   VKGSAPGWHQLLAVQEQPVFLQKAFCDLLGSRNEDERMAHMERGRALARSSVPSSRSSS
FT                   VMSTEQGRRMGPGFDTMRRGSSQSDTQSNLLPVFLEDDQMQHDTQLDADDEALRGTDFM
FT                   NADLLPSSIGRTTSRYGTADSGEHMDILRNTMQIQARNIASKRTDTASSQQSNVKHSSI
FT                   DSEMKVAHSAGLDDQTRKFYEYIKERADFVGKTTRSHEPYHKKLLFEDLIPSKVSQEDP
FT                   ENPHDYKAVSKRIAATAFLSLLNLASKELVRLETFDLEDKCEVMKGDDLIIYC"
FT   CDS_pept        complement(94484..96139)
FT                   /codon_start=1
FT                   /gene_family="HOG000142075" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18080756"
FT                   /locus_tag="AEL291C"
FT                   /orf_name="AGOS_AEL291C"
FT                   /product="AEL291Cp"
FT                   /protein_id="AAS52393.1"
FT                   /db_xref="HOGENOM:HBG059139"
FT                   /db_xref="HOGENOM:HBG202356"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="UniParc:UPI0000252C49"
FT                   /db_xref="UniProtKB/TrEMBL:Q758P4"
FT                   /transl_table=1
FT                   /translation="MPPRKRKISEAADSAAEQVAVQRRYVAGKQPRAQEPLPKVDNRAP
FT                   LDPEEELFRDEDWSIPKLNLYITYTLDDLVEAYKPIFKDFIKLPSRKFHPGYFYKIEQP
FT                   ISINEIKNRDYEYKDGEKQFLLDVELIRKNCYAYNETDSLIVKNSMQAVNYIKNEVLKA
FT                   KNITKNYLINDLIKERLLKVLEQLLESTELFIAQAMGNPTEGLDGELKLCHPFLELVSQ
FT                   EDFPDYYEVIHKPISLEMIKNNLQLGYYTKIYDFYVDVQLLFQNAQVFNDPETLIYQDS
FT                   QRLLRVFHKLMSDSFFPELKDSSERGEIKLEYDKVEYEQYLANTGQEDDNGSDDDNNDD
FT                   YDFNHYEGLGNGYNRSLLPSDYLLGPSKTEEKGKNAKAEEQEQPGVLKFNVIKIAAAQC
FT                   PNENSAIKVDAAEPFKMIDNIQLCSSTAIYEQSTRPLQGTLPAIDQSWVDFYFDGKVLK
FT                   ENNNKFVITLPPIQTAITFKVRLNSRISEQIQALFMVNKEKVNPTPTMSMEDNERRPRY
FT                   DVRLAEGLNCLEFSMQDLKKSKVEAVKFWINVLP"
FT   CDS_pept        complement(96325..96744)
FT                   /codon_start=1
FT                   /gene_family="HOG000113555" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15755787"
FT                   /locus_tag="AGOS_AEL290C"
FT                   /product="AEL290Cp"
FT                   /protein_id="AAS52394.2"
FT                   /db_xref="HOGENOM:HBG059146"
FT                   /db_xref="UniParc:UPI0001DB2972"
FT                   /db_xref="UniProtKB/TrEMBL:Q758P3"
FT                   /transl_table=1
FT                   /translation="MGIVFSCCSEAQDGEHDPLLDNQVAYGSQGNLDEDRQALELELQQ
FT                   KLLEREQELTVIVNNTNDKLIDISMMSNSGIVIQSHDMDEQDADSMPASVFVALDAARI
FT                   PPEVKAQLAQLHKGVFHAAGTEVDTKDHEPLVVTL"
FT   CDS_pept        97074..97817
FT                   /codon_start=1
FT                   /gene_family="HOG000001090" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19776433"
FT                   /locus_tag="AEL289W"
FT                   /orf_name="AGOS_AEL289W"
FT                   /product="AEL289Wp"
FT                   /protein_id="AAS52395.1"
FT                   /db_xref="HOGENOM:HBG059150"
FT                   /db_xref="HOGENOM:HBG202354"
FT                   /db_xref="InterPro:IPR018305"
FT                   /db_xref="UniParc:UPI0000252C4B"
FT                   /db_xref="UniProtKB/TrEMBL:Q758P2"
FT                   /transl_table=1
FT                   /translation="MLCARAPAVARFRALHTGPVTKDLFSWLKRGKSKEEAVEKPADTK
FT                   ELIGKIESGSSGTQSVARKVLKLKLEPSDFVGMDEAQLARQLHRERLEKVQFRRWLSQE
FT                   KLSKPEELRTLVAAAYETTFGAPGDAAALEQRFPDLRSMFIFAKHMQASTGYIMPDAQL
FT                   TRLHTPAAVAQWYERNVLTGKLQKFREELPNAIDLSDADLPVNVVVREHVLPKVQRKTL
FT                   NAVLREVSALETSKAKAALERAKAT"
FT   CDS_pept        98045..98974
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059086"
FT                   /locus_tag="AGOS_AEL289WA"
FT                   /product="AEL289W-Ap"
FT                   /protein_id="ADJ41767.1"
FT                   /db_xref="UniParc:UPI0001DB2973"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGC4"
FT                   /transl_table=1
FT                   /translation="MYVLVLLFFLAAGRQAFGQLVDVLDDCPLVYSKLLKLQPNIGGCA
FT                   RGLEECLFGRIMGNTRLCATCLGILDGGEREARCECFQCLLDNFVYGCTRQPCVREAVR
FT                   GAQRPDAPTSHLRPQRLLPRALLADETLHRQLYSDKYRSVVSVLVDAINSNRGRGNVRC
FT                   GGSTDGTAGYAMGNWSDAGDDRSSNHSTLDRAATAAEAMNTTYVSRSPSSKGGHAFVVS
FT                   VAAATLAVFSIFGFSGANSFLRRTTQPHEAPASASSGALTLFGDVDLDYLGDSDIEGEQ
FT                   LEALSVPIPLSGQSSLDMFDALNEARIF"
FT   CDS_pept        99089..100180
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19776434"
FT                   /locus_tag="AEL288W"
FT                   /orf_name="AGOS_AEL288W"
FT                   /product="AEL288Wp"
FT                   /protein_id="AAS52396.1"
FT                   /db_xref="HOGENOM:HBG059155"
FT                   /db_xref="InterPro:IPR008940"
FT                   /db_xref="UniParc:UPI0000252C4C"
FT                   /db_xref="UniProtKB/TrEMBL:Q758V5"
FT                   /transl_table=1
FT                   /translation="MTLDLTKQLYETITTGEHPNVQLRLQPPQPGYEGIVAIPNDGSTE
FT                   VVCFQEAFCEIFLECHKIIANCLGDRGGPLPRETFMATVGLLFTSYENRSALNLHERLF
FT                   LEKMDSSGGTETLDREIRYVEALLTSNIGKLNKSSSLWLWYRKLVLLQREKCSSVGTRV
FT                   IEVCKRSAELHFANYYCWNTLRWYYDVLEWSHEDVAPVREMVRKFAFSHLRDVSAWDAL
FT                   SYLYSDGGAYTSSDYTRIAQSFGLDAQLKTPLETAVQIRCEKATEVARELIRFIDTCEV
FT                   CEWNAYRCLYLLLQYSNCNIAELVTQWQQELDSFERNVILVRGYPKLPQLAPGDDILEQ
FT                   KRQKQMMNKKRLLHMVHKAQDGE"
FT   CDS_pept        complement(100320..101669)
FT                   /codon_start=1
FT                   /gene_family="HOG000233871" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20623894"
FT                   /locus_tag="AGOS_AEL287C"
FT                   /product="AEL287Cp"
FT                   /biological_process="steroid metabolic process "
FT                   /protein_id="AAS52397.2"
FT                   /db_xref="GO:0008202"
FT                   /db_xref="HOGENOM:HBG052619"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="UniParc:UPI0001DB2974"
FT                   /db_xref="UniProtKB/TrEMBL:Q758V4"
FT                   /transl_table=1
FT                   /translation="MVISKALKNLGGYAGLTAGPEVERGVSSAANAQAPASSQGGQVLD
FT                   TDDIDENDESGQNILMSIISQLKPGSDLTRITLPTFILEKKSMLERITNQLQYPNILLD
FT                   AHAEKDELLRFVKVVKWYLSAWHIAPKAVKKPLNPVLGEYFTAYWDLPNKQQAFYIAEQ
FT                   TSHHPPKSLYFYMIPESNIRVDGATIPRSKFLGNSTAAVMEGLSVLQFLDIIDPRTGKP
FT                   EKYTLTQPNMYARGILFGKMRLELGDHMLIKGPRFHVDIEFKTKGFISGTYDAIEGVVK
FT                   DYNDKSYYEITGKWNDVMHIRDLRVKGAPVEVFFDVHSSVPLKPKVRPIEEQGEYESRR
FT                   LWKPVTDALAIRDHKVATDEKFKIEDYQRTLAKRRAEEGVEFHPKLFRPVKPGSDLEFY
FT                   IYKNIPEGDDPEQQIKSILEIAPILPGQAFTEKFSIPAYEKHELQKRESL"
FT   tRNA            join(102290..102326,102349..102383)
FT                   /gene_name="tRNA-Gln"
FT   CDS_pept        complement(102552..104429)
FT                   /codon_start=1
FT                   /gene_family="HOG000193775" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20623895"
FT                   /locus_tag="AGOS_AEL286C"
FT                   /product="AEL286Cp"
FT                   /protein_id="AAS52398.2"
FT                   /db_xref="HOGENOM:HBG063743"
FT                   /db_xref="InterPro:IPR011387"
FT                   /db_xref="InterPro:IPR013979"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI0001DB2975"
FT                   /db_xref="UniProtKB/TrEMBL:Q758P1"
FT                   /transl_table=1
FT                   /translation="MSFQLFARTPAGPQIFEAYPSFQQVESPEVSGFITSKTSPCGRFL
FT                   AVSSENGVRVFKNERFQELLLELALKDVYDLEFSPGGSYLSTWERPHVDNEQHDNVKIW
FT                   FLNEDEPSAEQPKFQYQAKTQNAWSLQFSKLDNYALKRFGKELRIAKLDHSSPEFNFNQ
FT                   PYARLVPEGHLSTYLISPAEHPTICTFSAEKEGKPAQLTIYPITEGNIQKKIASKMFFK
FT                   ADSCQLKWNDLGNAVLCLAITDFDASNKSYYGENTLYLLSFQGVNGSLGGDSVRVPLGK
FT                   EGPIHDFTWSPTSRQFGVIYGYMPATITFFDLKGNAVHSLAEQRKNTMIFSPSGRYILI
FT                   AGFGNLQGAVEILDRHDKFKCFSKFDAANTSTCKWSPGGEFILTATTSPRLRVDNGLKV
FT                   WHVTGKLCFVNEYTELLEASWRNACKYRPKRPDSHVILNWDSSKVEAAKDPAIVPSQLE
FT                   VHPSVSAYSLKNPNKKNGGSSVSKPVGAYKPPHARRAAASNTSSPKSSVPGMTFKPTKS
FT                   VVPGMAPKETKSAAKNRKKRENTGIRKGPDSDGGSSNGTTPEPKEPPKVNKETSPEEKK
FT                   IRSLLKKLRAIESLKMRQADGDKLEDTQILKIQTEQAVLQELDYLGWKP"
FT   CDS_pept        104700..105572
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15755788"
FT                   /locus_tag="AEL285W"
FT                   /orf_name="AGOS_AEL285W"
FT                   /product="AEL285Wp"
FT                   /protein_id="AAS52399.1"
FT                   /db_xref="HOGENOM:HBG059169"
FT                   /db_xref="UniParc:UPI0000252C4F"
FT                   /db_xref="UniProtKB/TrEMBL:Q758P0"
FT                   /transl_table=1
FT                   /translation="METPAGDAHGKGCGGSNERLCPSLAGRFRRAGQEPWERANPYTSQ
FT                   AGSYIEYWTQGRSQHRADETKRRRLDMLNRVVLQRQMLGPLRGHWRSMGGGPSAEELRR
FT                   RANMGEMLTYLQEKVPLLLSETIEDARLAPDVVLRLMPLSRPYLPEFHGHAQYKTVWKG
FT                   LQMVVNTFVVRQPCAIGVRNLHVDEANRLIRISWATTEGPEGEAAPSAQAGGTDHEELR
FT                   RHLGHRLDEQWVRSLARGTHVKTRVVSGVFLFELDPTNERICSHIVDNVTMIDETEEDQ
FT                   GAKKGAFAV"
FT   CDS_pept        complement(105716..107155)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15755789"
FT                   /locus_tag="AGOS_AEL284C"
FT                   /product="AEL284Cp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS52400.2"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG059173"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI0001DB2976"
FT                   /db_xref="UniProtKB/TrEMBL:Q758N9"
FT                   /transl_table=1
FT                   /translation="MHGNHRYKVGRLIQSGSFSVVHHAQDCQTGQDVALKYVRKPHDNP
FT                   EQLQKVAALVHNEYAILRRLGTHRNICQLLDFYEDADTYVFVLEYCAYGDLYDFIKAIR
FT                   ERPTMRINFHSFLFQLCSAISYCHSKDVSHRDIKPENVLMDDRGQVKLTDFGLSQIGSV
FT                   SKDYCIGTEKYLAPETFLREYHNTFATDYWSLGITIFCLMFGSCPFESASTAAPKRSAN
FT                   FQRFLRDPHRFVESYYLDAMFAELAPPASLGSLVGLCNADCAPSYWLELPKDRILFLCA
FT                   IANLVITHLVNVDPAARDMHAFWEKVNALFLENGSGRMLQKEALVPQPKSCENDGGEAN
FT                   VPASPISRSQTQYTSDQGSNYMNPHAFGTAAHAAGTGASSVALTATPSLCDWLHTTPAA
FT                   PRSVGADPYQDLLDAAVEDAIRQGSLAGFDQKGLEQDSRDGHGTGSCDGDLWSLSELRP
FT                   YSTMATATSHETENKCRGWIF"
FT   CDS_pept        complement(107858..108463)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20623896"
FT                   /locus_tag="AEL283C"
FT                   /orf_name="AGOS_AEL283C"
FT                   /product="AEL283Cp"
FT                   /protein_id="AAS52401.1"
FT                   /db_xref="HOGENOM:HBG059178"
FT                   /db_xref="UniParc:UPI0000252C51"
FT                   /db_xref="UniProtKB/TrEMBL:Q758N8"
FT                   /transl_table=1
FT                   /translation="MSVCLVVTKSVATATLGIYTGMVVTRQLVLSPQEWIGVRKSAQKN
FT                   AFGGSELYSLASGALASVSTLFFGVSYFGAPVHWRHPYLLYCALGIPLTWALATVGNCE
FT                   RTHLLAKLLGCGAGAGHTSAAEEEDTTSAGEEHDDIISEDSIVDLSRHTSSEDHSAAKD
FT                   ATACAAAAPGCAFARYTSALVAVLVFAANVVGCLGEAL"
FT   CDS_pept        108796..110706
FT                   /codon_start=1
FT                   /gene_family="HOG000066017" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15755790"
FT                   /gene_name="RPC82"
FT                   /gene_synonym="RPC3"
FT                   /locus_tag="AEL282W"
FT                   /product="DNA-directed RNA polymerase III subunit RPC3 "
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52402.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG059183"
FT                   /db_xref="HOGENOM:HBG397909"
FT                   /db_xref="InterPro:IPR008806"
FT                   /db_xref="InterPro:IPR013197"
FT                   /db_xref="UniParc:UPI0000252C52"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758N7"
FT                   /transl_table=1
FT                   /translation="MNGSMGAAGGQVENERAAEVPVSTLEMRTLSPETFLYTEVARSHL
FT                   GERAGRVIELLLNKGRLSVSELVHLAPELGSKSVRTVLVSLIQLRCVQYLEETTVSGRK
FT                   ITYYYFNEDGFQLMLYAGDIVAAVESQFEADDAKEIAAQIVQNVLALGSLTTKDYMQSL
FT                   ASDVSVNDVASMFVKLVELGFLVPLSNVHYMPLADLWDVLYKKEYNAIPKNSTLSDAKK
FT                   RAETKAKTKVQFNTLLKNVEMSNVLMTDMQTSMRRVQDNLPLTFNFGRYMKHRRSRQLV
FT                   QFARSRVGSVPAMIYKVALKITEQCARALSDPLCETGLMQELEEQLAIQEDMALDDEKL
FT                   PGVTFNAVDISRNLPNNIDLRGTLTSMQRRSQERSTHQGQSHKRLKAEDGMAVAVNHLA
FT                   TVEEEAEGDELLHGSDDDMDMFFDEGDSDPKSVSLINGHLKLLSTGSVPFLIESRPGLF
FT                   YVPYSKLMPILKEAVYDAIIASTLGPSAHRILRCVRDNSLVSEKVINNTALMREKDIRS
FT                   VIATLVKYNAVDILEVPRTADRAASRAVFLFKINEKHAYDFMKQNLAWNIANSIHKTEI
FT                   LKEENFTLLSKAQRDDVKGREAELLLPSELNQLKMVNERELNGHARKIRLLSMWEVFKM
FT                   L"
FT   CDS_pept        complement(110771..114943)
FT                   /codon_start=1
FT                   /gene_family="HOG000247860" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15755791"
FT                   /locus_tag="AGOS_AEL281C"
FT                   /product="AEL281Cp"
FT                   /function="binding"
FT                   /protein_id="AAS52403.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059189"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001DB2977"
FT                   /db_xref="UniProtKB/TrEMBL:Q758N6"
FT                   /transl_table=1
FT                   /translation="MAPNVKQCLKGAKQALAAQDWATAVEYSLQVLDVDARSYYAHVFL
FT                   GKAYSMEGNWKESLKHYDCAIEENPRELVAWKGLFVLLRDANGMLSHEEYFQRCSEYAE
FT                   VLVTLQLPQIELIDQLRDYVRQHPDAEEAYLWQLRPGMPLAEQLGRNLLEPQEALKRLL
FT                   SKVNAREEREVARLVSRERLKLSKNDTDYTFKLNSVAWQVYESSPVDELYEQLVNVIYD
FT                   DAERRQMEHQWLEHRIKLLSAMPSGDKPAFYLQVKTMVDDMVLVDHDSSLAWRLHLEWQ
FT                   DCVSVYDLDLERISMFIRKFPTEPLGVLLLAWICSKFSNYDAKLFYKMTFGEKEEINTV
FT                   SGELEEPGENLHPEFANAVDTGSQERLSETDVVQVLRDLQHLQKSILAHRIVSQYFVNL
FT                   EEYEFVLPYIKNGITLVAQAIRDLGARLINAKRDLSLDYATVYTYLESPKYHSIALSLF
FT                   DKVLADDPQNYRAKLKKSHILIERKQWDEAYALLKGVVDRHPHLYDAHSAFGWCQLQLG
FT                   DTESALETFQLIINNVKSSDGTSSQFISSVHWRTAQALITKQQHEDPSGNEFIKIAFQH
FT                   LVQSLKITDLFAPGYSLLGHIYEVYFQDLTRAFRCYVKAFELDAGDLVAAKYMVEYYSD
FT                   LCNWQAAANICDRVIKNDMHLNSVNWPYRVLGVYYLELQQEAESIEWFQSALRIDSSDV
FT                   EAWIGLGQAYAACGRIEASIKVFERALELSPEHKYAGLFLAISLCQLSEFEKSLEALRK
FT                   LVNKYPQEAIFKERLSATLVEHALQFFDQGYLIKAATCAAEVISIIEGIVSEQVEYTTN
FT                   MWITLSKALNIFISTRSQFDNLPLAKLTSILDKCPLKNTEEVDLIDMTSFENLLNGDSD
FT                   LNISVALQFLILSSKCCIATSDYENLSRTVRASLWYNLALAELTAYLILKEMRYCDAAT
FT                   YCFKRSIKYQSNFFASWVGLGISSMNLNYRVSQHCFIKANALAPKEPTIWFNMSLLALK
FT                   CHDVEFAKLVLNQLHGLAPQMPHSWFAKALTLEKEGDINESTRMFAYAFLISNGRYKPV
FT                   QLLYAKAALNRHIANNEDERDIEPNLELSTIAYGLGQYLKKCPDDLLALQCAILTYERL
FT                   CKFTAASHLINDVALILENRFEKSQDERELINYGIIKTQLARTQLGLAKFENAIEDASL
FT                   ALGILEGNDTPDAKRALLSNYIVLGLGHYFSGDFDQALEFFKILLSDYGNSSEVTLMIS
FT                   RTIYNFGGEEAIDIALQELSEYRTTHGLDLLVVITMAVICLMENKVDQLSILMKDLANL
FT                   PLKGILSDKYKDVPLVMDEISRALNLRAPSKILWQRSAFFTPNNADVWKQLDYTTSNRI
FT                   THSGQCKVTANHLSNTCFKLGTLSKTQLGIYLCPWNKEGVKLLHDHF"
FT   CDS_pept        115074..115550
FT                   /codon_start=1
FT                   /gene_family="HOG000066016" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19776704"
FT                   /locus_tag="AEL280W"
FT                   /orf_name="AGOS_AEL280W"
FT                   /product="AEL280Wp"
FT                   /function="calcium ion binding"
FT                   /protein_id="AAS52404.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG204016"
FT                   /db_xref="HOGENOM:HBG483331"
FT                   /db_xref="HSSP:1AK8"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI0000252C54"
FT                   /db_xref="UniProtKB/TrEMBL:Q758N5"
FT                   /transl_table=1
FT                   /translation="MSLTNNQPVNLSQYTQEQIKTLKDAFQLLDEDGDGVISAQDLDKI
FT                   WQSLGKKMSSSEIAEMLGRSELDQVTFPVFLSLMSGSLGALPDEGDIRDALELFSKPGD
FT                   PDLNCDAGELREYLRISGFAVDEAFERLLRSFVAQSVTGQQLFKGKRFLDAVSE"
FT   CDS_pept        join(complement(116096..116115),complement(115594..116038))
FT                   /codon_start=1
FT                   /gene_family="HOG000225272" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756842"
FT                   /locus_tag="AEL279C"
FT                   /orf_name="AGOS_AEL279C"
FT                   /product="AEL279Cp"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /cellular_component="RNA polymerase complex"
FT                   /protein_id="AAS52405.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0030880"
FT                   /db_xref="HOGENOM:HBG410941"
FT                   /db_xref="HOGENOM:HBG646526"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR006111"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR020708"
FT                   /db_xref="UniParc:UPI0000252C55"
FT                   /db_xref="UniProtKB/TrEMBL:Q758N4"
FT                   /transl_table=1
FT                   /translation="MSDYEEAFNDGPEHFEDFEQEHFSDDGFEQEAEFQDGETKDINGT
FT                   TVVTGGTGVEDFQQQEQHRRRTLKEKAIPKEERTTTPYMTKYERARILGTRALQISMNA
FT                   PVFVDLEGETDPMRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL"
FT   CDS_pept        116279..117709
FT                   /codon_start=1
FT                   /gene_family="HOG000248089" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756843"
FT                   /locus_tag="AGOS_AEL278W"
FT                   /product="AEL278Wp"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS52406.2"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059203"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001DB2978"
FT                   /db_xref="UniProtKB/TrEMBL:Q758N3"
FT                   /transl_table=1
FT                   /translation="MCSCQAIWSWIDQSDQSGCVLFASVAQPLGRHRNLGAPSLEQVKI
FT                   GGKSSPDRAHLTIIGCAARSRGKGMEAHKLVHGLEELPVDEVTDYALSRTTSAGSTVSL
FT                   SSVESTASSTRRKTHYCDYEGCYKAFTRPSLLTEHQQTAHQGIRAYQCEQCGRGFTKKS
FT                   HLERHLFSHSETKPFSCTVCGKGVTTRQQLRRHEITHTKSFKCPHEGCGEAFYKHPQLR
FT                   SHVLAVHEQKLTCTHCDKRFQRPYRLKTHIAKHHGPASQFRYQCTNAGCVQCFETWSAL
FT                   QQHLHTDHPKLPCGVCGKLCVGETGLQMHMTVHDESRVIKNWKCSVCSDTTYAKMADLL
FT                   AHYMETHGDAIPKELIEHVNAESPAVVHVDEQQREDPEIVRPQKRRKNSDNTIMGSLQT
FT                   EEKIRKLIESGRTGLSLLLNTAGRKKRCPYLGCSRVFKTEDKYDLHISKHKINDLKVKL
FT                   LEDKLKTEAAAGKDPACG"
FT   CDS_pept        complement(117929..119908)
FT                   /codon_start=1
FT                   /gene_family="HOG000034130" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081014"
FT                   /gene_name="ATG13"
FT                   /locus_tag="AEL277C"
FT                   /product="Autophagy-related protein 13 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS52407.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG059207"
FT                   /db_xref="HOGENOM:HBG204015"
FT                   /db_xref="InterPro:IPR018731"
FT                   /db_xref="UniParc:UPI0000252C57"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758N2"
FT                   /transl_table=1
FT                   /translation="MAMESECNVVELIGGFFLKATLLVCQPRTGAIEGDGEEDRTFNIS
FT                   SAADAGVAEAVRAWTAYDGAQELPPLVIEMFLDLRRLGPQHTVVLKDQDGNPWNVCKGG
FT                   KKSEIMLERWLVELDVGNEEARPEEPPNAAEIYKQLVLLFRYLYTLTQLLPANELYARL
FT                   HGPSNQGEAAMPLINIGTRILDGSKPILSKGRVGLSRSIIATYTNVINETNVASHLEQK
FT                   KITPISTGYGSLRITVSYRRDCNFDVNEVLDYEGNNCSSSSVVDTHTKPGVGPLSSLRR
FT                   VSIHSNRSMSISPQTVYSGTVIPDPSPQRKSSSSRIQPFKAGSVGSGSLAIARNPSGSS
FT                   AVATLRAQRSGSASISTHVADQAVGEPSSVGSGGSKYSSSFGKIRRQSSMRRSGSLELP
FT                   AAKQAKPGERGSDELLDFVKMLEEKQELNVKKLYGTTTDISSSLVRFQSMKSNNDTLSE
FT                   DLSMSYSLEPTHAPQVRYRSNSHSPIPSISPSVQYTSIPMRLSQSRNVSQTELASRKNS
FT                   AERLKTLISSRTGSFSESRRQSNAGQEDILEDEDDEAEEILLSKSHLSNPTGTRLQSMS
FT                   PQSLKSISSYNRAAVPFKPVSNFSCPTTMATPAHAKLHKASISSSPDNQSGLVKKDHEH
FT                   STMTGGDDDDDLLFFMSDMNLSSQ"
FT   CDS_pept        complement(120334..124890)
FT                   /codon_start=1
FT                   /gene_family="HOG000212981" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756844"
FT                   /locus_tag="AEL276C"
FT                   /orf_name="AGOS_AEL276C"
FT                   /product="AEL276Cp"
FT                   /function="4-alpha-glucanotransferase activity "
FT                   /function="amylo-alpha-1,6-glucosidase activity "
FT                   /function="cation binding"
FT                   /biological_process="glycogen biosynthetic process "
FT                   /protein_id="AAS52408.1"
FT                   /db_xref="GO:0004134"
FT                   /db_xref="GO:0004135"
FT                   /db_xref="GO:0005978"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG028245"
FT                   /db_xref="HOGENOM:HBG447348"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006421"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010401"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000252C58"
FT                   /db_xref="UniProtKB/TrEMBL:Q758N1"
FT                   /transl_table=1
FT                   /translation="MAVPKASSCMTSEASFRSQQRAQTAMKTVLLRLDDNGEPVRGEVG
FT                   KGVLTLPCLPVGRDAGEDSGLRVRLVVAAGSPVTRDGLVWTNCPPERNTKFQRNKFYKH
FT                   LLSAGFLEDSCVDVDVYVPGSYCYYVSFRNEREQLETTRRFYFVVPPVLSLGEQLVPMN
FT                   TLAVQSVVSKWMGTDWEPIFRKISGKGYNMVHFTPLQARGESNSPYSIYDQLQFDLAHF
FT                   HSAEDVSRMVGKLHRDYRMLAMTDVVFNHTANNSAWLLEHPEAGYNGETAPHLLAAIEL
FT                   DRQLLQFSRDLAALGYPTNLRTVDDLLRVLDGIKTHVLSELKLWEYYVVDVQSTLTELA
FT                   HMWEKVDAIDEGVPNQYREDLHWIATYTCQRAAQPGFGSLAGRFSNKIDADKFISILKG
FT                   LYGASWRPGHLDSAHKILDEINLPLYKEYDADIGEILEQLYNRIRYLRLDSNGPQLGPI
FT                   TEQDPLTEPYFTWVEAKDGKQYALANNGWIWNGNPLVDFASEKSKSYLRREVIVWSDCV
FT                   KLRYGASPHDSPYLWSRMTQYIEMNAKIFDGFRIDNCHSTPLHVGEYFLDLAREINPNL
FT                   YVAAELFSGDEALDCLYVERLAISSLIREAMQAWSEEELSRIVHRHGGRPIGSYKYMPL
FT                   TYFSSPKEGENYNGVTKSIDNEYTLPVVCTATAPHALFMDCTHDNETPYQKRTLQDTLP
FT                   TAALVAFCSSAIGSVYGYDEIFPRLLDVVTEDRTYSVVEGDGISMVKAQLSNIRKLVAS
FT                   SMGDIEDSEMHVHHDGQYITFHRTNSKTVEGWFLVARSKFREGDPEQRLPDITLAGVKC
FT                   ELEFSYALEQTGDVPDDNGKVILGIPTRLSELSGFEVKYEPDSNVSTISMPGYFPQGSI
FT                   AVFKTSMVGMDDELEGFISAGITRATQNLNLYSLNSVLYRCKAEEMDRTGNKNSVYNIP
FT                   GYGDLVYCGLQGWVSVLKDIIPENNLAHPLSEHLRNGTWAPDYIVNSLDWYNNEPGVKD
FT                   IQNWFRTKFERIKSLPYYLIPRYFALVVGIAYVACHRKAMSLMTNTIGTSTMFIQQLAM
FT                   VSVQMVSNISSASLLPDRTVPSMAAGLPHFSTHYMRCWGRDVFISLRGLLLVTGRFEDA
FT                   KMHILAFAKTLKHGLIPNLLAAGKDPRYNARDAAWFFIQSIQDYISIVPNGEQILEERV
FT                   TRRFPLDDTYIPYDDPAAFSYSSSIRDIIFEILSRHALGIKYREANAGPRLDSVMSDRG
FT                   FNVEIHVDWSTGLIHGGSQYNCGTWMDKMGESKLAGTYGVPGTPRDGAAVEINGLLKSA
FT                   LRFVLELHSRGLFPHTAVPRADGSLISFVAWNDLLQANFERKFYVPEDPSEDSSFDIDP
FT                   SLVNRRGIYKDLCHSGKPYEDYQLRPNFTIAMTVAPELFSPQRAQRALAIADRVIRGPV
FT                   GMRTLDPSDYNYYPDYNNGQDSTNPHTARGRNYHQGPEWIWCYGYFLRAYARFSAAPAS
FT                   ALHQRLQQRLRNHRTWLVTSPWAGLTELTNRDGAYCHDSSPTQAWSASCLLDLLYDV"
FT   CDS_pept        complement(125220..126017)
FT                   /codon_start=1
FT                   /gene_family="HOG000283250" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756845"
FT                   /locus_tag="AEL275C"
FT                   /orf_name="AGOS_AEL275C"
FT                   /product="AEL275Cp"
FT                   /protein_id="AAS52409.1"
FT                   /db_xref="HOGENOM:HBG534149"
FT                   /db_xref="HOGENOM:HBG752660"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="UniParc:UPI0000252C59"
FT                   /db_xref="UniProtKB/TrEMBL:Q758N0"
FT                   /transl_table=1
FT                   /translation="MSIENSVVVPAYHERPNIKPLATRLFAALGNADSKKTELIFVDDN
FT                   SQDGSVEEVEALAKQGYNVRIIVRTDERGLSSAVLKGFYEAKGEYLVCMDADLQHPPES
FT                   VPLLLDSLRTHPFVLGTRYAPGVGIDKDWPLYRRVISSSARMMARPLTTASDPMSGFFG
FT                   LQRRYLVNDDAKGINSEGFKIALDLLVKLPLPADRPIGEVPFSFGLRTEGESKLSGKVI
FT                   VQYLKQLRELYAFKFGTSNLFLFLFFWAILAVYLFIQLASALA"
FT   CDS_pept        join(complement(126562..126570),complement(126262..126513))
FT                   /codon_start=1
FT                   /gene_family="HOG000223542" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081015"
FT                   /locus_tag="AEL274C"
FT                   /orf_name="AGOS_AEL274C"
FT                   /product="AEL274Cp"
FT                   /protein_id="AAS52410.1"
FT                   /db_xref="HOGENOM:HBG353275"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR016487"
FT                   /db_xref="UniParc:UPI0000252C5A"
FT                   /db_xref="UniProtKB/TrEMBL:Q758M9"
FT                   /transl_table=1
FT                   /translation="MPDLNPTNPKPFLRQLVDQYIVVTLKFNNTRYRGKLMSTDNYFNI
FT                   RLTEAEEFIGDVSKGMVGDLFIRCNNVLWIGEDLTRAEQQH"
FT   CDS_pept        complement(126705..127877)
FT                   /codon_start=1
FT                   /gene_family="HOG000189223" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756846"
FT                   /locus_tag="AEL273C"
FT                   /orf_name="AGOS_AEL273C"
FT                   /product="AEL273Cp"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS52411.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG060667"
FT                   /db_xref="HOGENOM:HBG747640"
FT                   /db_xref="InterPro:IPR009600"
FT                   /db_xref="UniParc:UPI0000252C5B"
FT                   /db_xref="UniProtKB/TrEMBL:Q758M8"
FT                   /transl_table=1
FT                   /translation="MNRREKQVVIACVGSRLLISLAFPSLQQQLDNAVEFSTPVTSFRS
FT                   LQEGVFLLQNNLPVYDGGVVHHLPLLVTLMSVVTADVAYSVLYAVMDALVAYQLMAISR
FT                   QFKQLSTPSWVPGALYVVNPLVLLSCVSRSTVLFSNLALTTALLAALRDEALLAAVAIA
FT                   AAGYLSFYAGFLVVPLLAVLQRGRLLTAVVAALCLALFQLASYRLSDNSWVYLRSSYGV
FT                   IITFSKLMPNLGLWWYFFIEMFDFFIPFFKAVFNIFAVAFITPFSIRFWQQPFYAFVLC
FT                   LGWITLTKSYPTLGEGGFFLSFVPFFQPLFIYLRHSVVSTLLFMHAIILSPTFYHLWVD
FT                   LGSGNSNFFYAISLLYALALASVIIDLCWSMLRIEYDRGNPVINVKLTQL"
FT   CDS_pept        128350..130620
FT                   /codon_start=1
FT                   /gene_family="HOG000231690" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081016"
FT                   /gene_name="SEC23"
FT                   /locus_tag="AEL272W"
FT                   /product="Protein transport protein SEC23 "
FT                   /function="zinc ion binding"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="COPII vesicle coat"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="AAS52412.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030127"
FT                   /db_xref="HOGENOM:HBG021213"
FT                   /db_xref="HOGENOM:HBG520631"
FT                   /db_xref="HSSP:1M2V"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="UniParc:UPI0000252C5C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758M7"
FT                   /transl_table=1
FT                   /translation="MDFEQNEDINGVRFSWNVFPASRTDANKNVVPVGCLYTPLKEIEE
FT                   LAVVSYNPVVCGGPHCKAVLNPYCEIDVRSNVWACPLCGTRNHLPQHYANMSQEAMPAE
FT                   LNSTTVEYITNRPVQVAPIFFYVVDVTAEEENLQALKDSIITSLSLLPPNALVGLITYG
FT                   NVVQLHDLSCTAIDKCNVFRGDREYQLQQLVEMLTGEKSGGNLSAGPQMKITPFSLNRF
FT                   FLPLEHVEFKLTQLLENLRPDQWTIPPGHRPLRATGSALNIATLLLQGCYRHVAARICL
FT                   FASGPGTVAPGMIVSSELKDPLRSHHDIDSDNAKHHKKACKFYNQLAERAAENGHTIDI
FT                   FAGCYDQVGMSEMKKLTDSTGGVLLLTDAFSTAIFKQSFIRLFSKDEEGYLTMAFNASM
FT                   CIKTSADLKLQGLIGHASPVNVDAQNVSDSEIGIGGTSTWKMASLSPHHSYAIFFEIAN
FT                   TAATASLMGDRPKLAYTQFITAYQHASGTNRVRVTTVANQMLPFGNPAIAASFDQEAAA
FT                   VLMARVAVDKADSDDGADVIRWIDRTLIKLCQKYADYNKGDPRSFRLAPNFSLYPQFIY
FT                   YLRRSQFLSVFNNSPDETAFYRHIFTREDTTNSLIMIQPTLTSFSMEEEPQPVLLDSVS
FT                   VKPNTILLLDTFFYILIYHGEQIAQWRKAGYQDDPQYADFKSLLEEPKLEAAELLVDRF
FT                   PLPRFIDTEAGGSQARFLLSKLNPSDSYQNQSAAGSTIVLTDDVSLQNFMIHLQDVCVN
FT                   GQN"
FT   CDS_pept        complement(130780..131871)
FT                   /codon_start=1
FT                   /gene_family="HOG000172217" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081017"
FT                   /locus_tag="AGOS_AEL271C"
FT                   /product="AEL271Cp"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS52413.2"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059236"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001DB298F"
FT                   /db_xref="UniProtKB/TrEMBL:Q758M6"
FT                   /transl_table=1
FT                   /translation="MEEHTSTAGDANRPAKAYEQMEGEQKLDNDEIALYDRQIRLWGMA
FT                   AQARMRNTRVLLVNFGALGGEVAKNLVLSGIGSLTILDNRVAAAEDLGSQFLLAEEDLG
FT                   RLRAEVGAARLRDMNPRVSLAVDARNVTEQPAEYFAGHDLVVATDCSRADLEKINAACR
FT                   ARGVPFYAGGLHGLWGYVFVDLVQFDSTEEKAVTVDAPITALGSVSERREVVTVRREHE
FT                   EDPRSAREIVTTRNYYRPFSEVLAQGTLAGRLTPRQLRRLLPALPLTLAAFLHGHGNDD
FT                   VASFEAEVKKMCHQLGSSPSNVPAECTELFLRQIGVELPPVAAVIGGAMAQDIINTMGK
FT                   RQSPLNNFVVLDGITLDMQIFEL"
FT   CDS_pept        132026..133939
FT                   /codon_start=1
FT                   /gene_family="HOG000094536" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20624150"
FT                   /gene_name="HDA3"
FT                   /locus_tag="AEL270W"
FT                   /product="HDA1 complex subunit 3 "
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52414.2"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG059243"
FT                   /db_xref="HOGENOM:HBG204014"
FT                   /db_xref="InterPro:IPR021006"
FT                   /db_xref="UniParc:UPI0001DB2990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758V8"
FT                   /transl_table=1
FT                   /translation="MDLLKILDTAPEPAIVDARTMGVSGDTSGDYWLPAPMCLYQKELT
FT                   DQIVSLHYSDILKYFETSDYKEDIVLQSMKTMCLNSQLVATHPYLLIDHFMPKSLLTKD
FT                   IPGHLSETSGKFCVLRDLMNLVQEYAMETLLVCRPGRTMDLLEALLLGNKVNIRRHDGQ
FT                   SIKTKQKKTRYACTCHLVPSEAAKAIALERDTRLGLVICVDPTVDTRAPHIQSILAQQQ
FT                   RKYGRTVPTIRVAVINSIEHCELFFGKTLDRNTRDYLVNVSAAMVVLRDVVGTLPPDLR
FT                   PIYSQNLRYLIDWLDTPERPWPLPDVYPVKVYTAMDVERSLLTEVKYSQNNDSLEDAFT
FT                   NGKKRNHRSHGQGNGGNAPISYYQIKRLKNDYIGNPLKQDMEQLTGISNNKCKDGLLDY
FT                   HLSSGTLTHKLLQAIGSVYENLQLQDVELSHFAAVEQNQTAIFESHKEALSTIKKQLED
FT                   AISKKQRNNTLVDEYLKNSQNERDQLEVLEADISDLLGQLDGRHQGFKQLWDDLNQTEN
FT                   TLALYRTNANAKRSEASYMEEELIRAEKSVAESENEQTQLLRDVEHLEALIQDCREKDK
FT                   QQQQVIKNKSKDMEDDITQKKEAVLALQNQLGTIMEYLKQLQTPRVRSPSNGHRSKHRG
FT                   YV"
FT   CDS_pept        complement(133996..135363)
FT                   /codon_start=1
FT                   /gene_family="HOG000157615" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19776705"
FT                   /locus_tag="AEL269C"
FT                   /orf_name="AGOS_AEL269C"
FT                   /product="AEL269Cp"
FT                   /protein_id="AAS52415.1"
FT                   /db_xref="HOGENOM:HBG066306"
FT                   /db_xref="HOGENOM:HBG435054"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI0000252C5F"
FT                   /db_xref="UniProtKB/TrEMBL:Q758V7"
FT                   /transl_table=1
FT                   /translation="MVELHEIRVDHDHLIGDKGETVADVLNRQEFSKERFVPTLDEDVR
FT                   AALRLLDKPEEIPEEDNHDRRERLAELLSSDKQLQKRIEESGFLKRASPGEVSDGDELD
FT                   EEFYTPASRELVEVRKFLVGYSLDCAARRLAAQRARQGLGVKAYLQQRRAEGKRLATFE
FT                   LVGSQLVADKHVSQVAVHRDGQQLATGCWGGSIKVVSCETLGIAKSIDAAHEGKIGGLD
FT                   WHPDGNHLLSGGGDNLVKLWDMTSNSFEELRGHAGRVSRVKVHPSGRLAASASFDLTWI
FT                   LWDLERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGHA
FT                   GAISGVDWSPNGYQLATAGADGTVRVWDIRNVGTESALLAHQVAALDVKFKKNNGTFLV
FT                   SCGHDRLVNIFNADNWQKLASLEGHTDRVFTVDITEDGSTIYSGGKDRSLKQWCAK"
FT   CDS_pept        135460..136428
FT                   /codon_start=1
FT                   /gene_family="HOG000180334" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624151"
FT                   /locus_tag="AEL268W"
FT                   /orf_name="AGOS_AEL268W"
FT                   /product="AEL268Wp"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS52416.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG192245"
FT                   /db_xref="HOGENOM:HBG716455"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniParc:UPI0000252C60"
FT                   /db_xref="UniProtKB/TrEMBL:Q758V2"
FT                   /transl_table=1
FT                   /translation="MKLLKEKHISFIKSLDKKHEDFEYWVTEHLRLNGIYWGLTALCCL
FT                   GAKDAFDREDIIAFVKRCWDKRTGGFAAYEGHDAHLLTTLSGIQVLATYDALDTLTPQE
FT                   VEQCVNFIEGNQMADGSFQGDRFGEVDTRFVYTALSSLSILGRLSAKVVDPAVEFIKRC
FT                   YNFDGGFGLCPGAESHAAQAFTCIGALAIVGRLGDLSARQLEDIGWWLCERQVPEGGLN
FT                   GRPSKLPDVCYSWWVLSTLAILGKADWIDHEKLGDFILASQDPKSGGISDRPENQVDVF
FT                   HTLFGIAGLSLMKHDGLVPIDPIYCMPYDITEKFKKYPYET"
FT   CDS_pept        complement(136477..138510)
FT                   /codon_start=1
FT                   /gene_family="HOG000246706" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756847"
FT                   /gene_name="DPB2"
FT                   /locus_tag="AEL267C"
FT                   /product="DNA polymerase epsilon subunit B "
FT                   /EC_number="2.7.7.7"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52417.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG059259"
FT                   /db_xref="HOGENOM:HBG398250"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="UniParc:UPI0000252C61"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758V1"
FT                   /transl_table=1
FT                   /translation="MDRGSALPAEISPQLLRPLAYRVLSKKYGLHIKSDGLAQLAKFIG
FT                   NAFGVDWRRSAETMQFLERFAAIWREQERGLFVDALGVDAVTQELRERNKTAKQRRPAR
FT                   ARETTLDALVRPTEAYSAVESSGGDVTATEPMDEDTVREEPLDWTHYFKVIDTFSQQQF
FT                   TYDVTKRRYRLVQQRESAAGPLSTLLRIPSLEANLAQFPTRYHLVRDRVLRNASFQNDD
FT                   VYNPLSSMQQLQQQLDAGGAPLASTAYMSITQIKNLLGRDGKNFLLLGLIRKDSKGFWS
FT                   LEDPSGSIEIDISETYPTKGTYYVPGCIVLAEGIYSSAGNRFRVSSITHPPGERREAFL
FT                   EAIGNLDLLGIHGPSNESYISRLDKELKIRLHYLEKELTDHRFVFLGGNIFLDDTMTET
FT                   ALAKLFDVLEHDPPTVLVLPGSFTSTPIYPSSDSKSSSSTAAYRANFDALAKLLSKYER
FT                   LINETTFVFIPGDNDPWGSMAYLGVAGTLPQHPIPGDFVTKVNRICKHVVWGSNPTRIA
FT                   YLSQELVIMRDDMCNRFKRNSIIFPTVEEEQKQEYMLLQQELQDDERSSDLSISQLIKS
FT                   RDQLPASVQESRKIVKTILDQQHLSPFTSQVRPITWDYDYTLHLSPIPSTMIICDPTAP
FT                   KYDVTYNGCKSINPGSFLHKRSVNYTEYTPSLRKATEEEIVV"
FT   CDS_pept        138834..139820
FT                   /codon_start=1
FT                   /gene_family="HOG000113740" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756848"
FT                   /locus_tag="AEL266W"
FT                   /orf_name="AGOS_AEL266W"
FT                   /product="AEL266Wp"
FT                   /protein_id="AAS52418.1"
FT                   /db_xref="HOGENOM:HBG059262"
FT                   /db_xref="HOGENOM:HBG104052"
FT                   /db_xref="InterPro:IPR013743"
FT                   /db_xref="UniParc:UPI0000252C62"
FT                   /db_xref="UniProtKB/TrEMBL:Q758V0"
FT                   /transl_table=1
FT                   /translation="MLEPLKNIVSDFWLKTDTRKREYGSLDEWKQQRGQERIGRPRRRA
FT                   STRYKVTKPSAVHQSALPLPVERPGAAAVRRNERTWWDRLCGVFSAEQRDLHGMRDAFA
FT                   NYRLPPTEELEGRRRRGTASQRIARSETFKKRVLEKMYDDRMLEQLRAGSRGRRPERPA
FT                   LPGSDADQVVLLQNRLHKLERQLFETQKELELAKKKLMFAHEKTKLFESLLDDANVDDD
FT                   YVKSRRRITNLRATTDNQPALRSLSPSPQRPYPVNPLFTSSPIRQVNDSPRKQINKPDD
FT                   FYAKYPTIPKTELLNKQPSENAAAGRAKESLSPVRIDYSKYSSPRRK"
FT   CDS_pept        140033..141328
FT                   /codon_start=1
FT                   /gene_family="HOG000225146" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756849"
FT                   /locus_tag="AEL265W"
FT                   /orf_name="AGOS_AEL265W"
FT                   /product="AEL265Wp"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="AAS52419.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR007330"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="UniParc:UPI0000252C63"
FT                   /db_xref="UniProtKB/TrEMBL:Q758U9"
FT                   /transl_table=1
FT                   /translation="MSTGDFLGKGIELIQKAIDLDTATQYQDAYTAYYNGLDYLMLALK
FT                   YEKNPKSKDLIRAKFTEYLSRAEQLKEHLDSEQQKAQDQPRRAAASQDGGAGGGGHEED
FT                   GEEKKLRGALSGAILTEKPNVRWEDIAGLEGAKEALKEAVILPVKFPHLFKGNRKPTSG
FT                   ILLYGPPGTGKSYLAKAVATEANSTFFSISSSDLVSKWMGESERLVKQLFNMARENKPS
FT                   IIFIDEVDALTGSRGEGESEASRRIKTELLVQMNGVGNDSTGVLVLGATNIPWQLDSAI
FT                   RRRFEKRIYIPLPDFAARTRMFELNVGETPCALTKEDYRTLGKYTEGYSGSDIAVVVKD
FT                   ALMQPIRKIQMATHFKNVSDDPSVRKLTPCSPGDEDAIEMSWVDIEAEELQEPALTIKD
FT                   FLKAIKTSRPTVNEVDLQKQEEFTRDFGQEGN"
FT   CDS_pept        complement(141450..142025)
FT                   /codon_start=1
FT                   /gene_family="HOG000248348" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756850"
FT                   /locus_tag="AGOS_AEL264C"
FT                   /product="AEL264Cp"
FT                   /function="FMN binding"
FT                   /protein_id="AAS52420.2"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="HOGENOM:HBG059263"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniParc:UPI0001DB2991"
FT                   /db_xref="UniProtKB/TrEMBL:Q758U8"
FT                   /transl_table=1
FT                   /translation="MNSLPDHILHLLKTSKYVHLATASSDGVPSVSLMNYAYLAPESSE
FT                   TEGDTHYIVFATSAVTEKYKNITTNPNVSLLIHDWVTAKKLSLRKNSTSASLSGGAGSE
FT                   AEEAPSRLLNILQELNQSELSQMSATLKGLAEVIDSSSPDFVLYRDALLKANPDAKCFV
FT                   LGDDVVIVKAQITGAKVSDTSNNTAIYY"
FT   CDS_pept        complement(142263..143264)
FT                   /codon_start=1
FT                   /gene_family="HOG000142010" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756851"
FT                   /locus_tag="AEL263C"
FT                   /orf_name="AGOS_AEL263C"
FT                   /product="AEL263Cp"
FT                   /protein_id="AAS52421.1"
FT                   /db_xref="HOGENOM:HBG059264"
FT                   /db_xref="HOGENOM:HBG202602"
FT                   /db_xref="InterPro:IPR000313"
FT                   /db_xref="UniParc:UPI0000252C65"
FT                   /db_xref="UniProtKB/TrEMBL:Q758M5"
FT                   /transl_table=1
FT                   /translation="MNSKDIRTGDRVLCKVGDFPPWPAVVVPQRFLSKLVYSGKRSKSY
FT                   VCVAFFNDDSYYWKEPRHLTLLTDKMCTDWMKNSKSKDEALIGAYQQAIEYKRLFDFMK
FT                   ERLVQEEREEILEDVKDIPAGEDPFEPKPTTRRTGSTKSSVSRKRARSVSAPGNSAPLS
FT                   HTDGLGPAGDTKAAHPILASASSPSFSKTSSLSKRRKLDYDNRVSIAQLLRNKLQRNLV
FT                   QRNEPPSEKEYKESDRMFRTIINKLSNDPPFFDYKALRVSKLYKLLKVIAQDENLARYH
FT                   DDCNKILATWAPLIVQIKQEKQMAQQLDTSTTDDISLVSDVKVGEQSSKSLN"
FT   CDS_pept        complement(144491..146908)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929687"
FT                   /locus_tag="AGOS_AEL262C"
FT                   /product="AEL262Cp"
FT                   /protein_id="AAS52422.2"
FT                   /db_xref="HOGENOM:HBG059265"
FT                   /db_xref="UniParc:UPI0001DB2992"
FT                   /db_xref="UniProtKB/TrEMBL:Q758M4"
FT                   /transl_table=1
FT                   /translation="MPGIRDTPGRDPDLDVYLSRVEQLDLERSRSLNRGTASVPEERFT
FT                   STIGTERYDPADRKKAHLLLEGHYDTRRYEFTGSDKVSEIAYESAYNYEKTFSPKKGSA
FT                   YHTARGISPIRTPGRSSNYSIPPPKESYVSSEKKYLVTEEEYDLLQRLKREHGHMDYLS
FT                   LKETYPPKYSGYYSGSSYGYDYIPRSSSPVNYEENRYPSMLSSIYNSEMPYNSRIKPHY
FT                   ESRSHGYYRPAPLYSTDYSHTLSERSLLVPTPSTATSSIFSRDHAPTLFDKQVTPQSPI
FT                   AYGDKQPFPNTPPAEPNMTSFQAGSSPTDNILPSSGKEVDGTASNSPVESMSAAPGKAM
FT                   NNSTPTLAGLSTPSPSESVSPIKQKPRASESGSPIKKEPQESSSQVPKKRISVSYLESL
FT                   EKSRVTTNNLSGGVRSQPNIIPGRSEGMISSMMKKNSGTPVQPRTPSMSLASLRKGSEN
FT                   VVSSFLKKTAPMQPAPSTRPQRSPTRTTRDITETLIESALKITGTPTKQSRCGAPPIPV
FT                   KPKKLTQIPKVEEEPDLEDTLKSIQLNKTDATREKSKLSEQKGEIHIPKLRSVKRDSSQ
FT                   LPEQKISLPELKPVKLEPKREPSLPEALNAINNLKPALEPSRSPSPNSVAISKLPALAP
FT                   HSKVGNPTALPEALTKRSQLTKSHPSPERKPSIPEALTKMSMLNKPPAAAAKASDVPEA
FT                   LAKVAKLNKAPPVPKRKISMPEALKKAQELRNNKTNLLLEANLKRKHTPPLGQLSEAGS
FT                   VPTPKAFPDRSDSTLSVVRLLKGEQSQGDKLQHVTKARDRGPRRRLPSGTSK"
FT   CDS_pept        join(complement(147501..147518),complement(147312..147442),
FT                   complement(147147..147255))
FT                   /codon_start=1
FT                   /gene_family="HOG000172240" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756852"
FT                   /locus_tag="AEL262C-A"
FT                   /orf_name="AGOS_AEL262CA"
FT                   /product="AEL262C-Ap"
FT                   /protein_id="AAS52423.1"
FT                   /db_xref="HOGENOM:HBG059266"
FT                   /db_xref="HOGENOM:HBG398820"
FT                   /db_xref="UniParc:UPI0000252C67"
FT                   /db_xref="UniProtKB/TrEMBL:Q758M3"
FT                   /transl_table=1
FT                   /translation="MKPVVSKGKAWFCTVLSAFGVIILSVIGHLFNIKHEAFVGSINDP
FT                   KDGPAVAHTVFLAAAVYLVFFVFCGSQIYMGRKSSSIELR"
FT   tRNA            147668..147741
FT                   /gene_name="tRNA-Ile"
FT   CDS_pept        complement(147826..149352)
FT                   /codon_start=1
FT                   /gene_family="HOG000093386" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081018"
FT                   /gene_name="JIP5"
FT                   /locus_tag="AEL261C"
FT                   /product="WD repeat-containing protein JIP5 "
FT                   /cellular_component="nucleolus"
FT                   /protein_id="AAS52424.2"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="HOGENOM:HBG059267"
FT                   /db_xref="HOGENOM:HBG395775"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI0001DB2993"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758M2"
FT                   /transl_table=1
FT                   /translation="MGKKKNSKAYSEELTDTTRPLLEFRYGNPLFAIACHPEQSVIVSG
FT                   LATGHMFCHKYNAAELKEAQLKRLRKHDAGSKDDRKKLWEVVEVPGVETSGVSLLWTTK
FT                   RHKGSVRCICFDADGTHIYSVGTDNVLKKADTLTGKVVKKCVLDPGQNVKYTKLVKSAT
FT                   HPLVLLGDENGNVTVLNSESLEQTNLIKSIHNGDAINDIFHFAKKSVYRYISLGQTTLA
FT                   HWDSRESNEGDFAIAADDKQAKRKVILSDDQEDEILCGTFVDPEDGEVLVCGMGEGVLT
FT                   VWRPKKNGLADQLTRIKVKKNESIDCIVPTLEDDGCVWCGCSDGNIYKVHVNRGTIIEV
FT                   RKHSKLDEVTFLDLDSEYRLLSGGLDKAKLWDSEKSEQLTPGSDADDRVSNSSPSAGKS
FT                   SESDSNDSENDATSSGGSSDEDSSSDESEHSDASDVEEELVGLTREQIIAELDKDLVEE
FT                   SEDVEDVRSQRKRKHGADLPTNANGKKQKGKNIKPERSMKTHGIRRFEGL"
FT   CDS_pept        complement(149467..149922)
FT                   /codon_start=1
FT                   /gene_family="HOG000001009" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18929688"
FT                   /gene_name="NUT2"
FT                   /gene_synonym="MED10"
FT                   /locus_tag="AEL260C"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 10"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="AAS52425.2"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG059268"
FT                   /db_xref="HOGENOM:HBG395603"
FT                   /db_xref="InterPro:IPR019145"
FT                   /db_xref="UniParc:UPI0001DB2994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758M1"
FT                   /transl_table=1
FT                   /translation="MDQQDLNKLQTNLSDAEIRLASIIESFIELGVSVYDFPGTQESTQ
FT                   GMVTNLKRNVERIKLLNQHANDPDSQLRNMNIPLEVLQYIEDGRNPDVYTREFVEAIRR
FT                   SNQYQRAKMHALKKLRDSLAEKIGEEFPDLVPQVQGIIERANGSRDK"
FT   CDS_pept        150321..151118
FT                   /codon_start=1
FT                   /gene_family="HOG000249397" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929689"
FT                   /locus_tag="AEL259W"
FT                   /orf_name="AGOS_AEL259W"
FT                   /product="AEL259Wp"
FT                   /function="phosphoadenylyl-sulfate reductase (thioredoxin)
FT                   activity"
FT                   /function="transferase activity"
FT                   /biological_process="cysteine biosynthetic process "
FT                   /biological_process="sulfate assimilation, phosphoadenylyl
FT                   sulfate reduction by phosphoadenylyl-sulfate reductase
FT                   (thioredoxin)"
FT                   /protein_id="AAS52426.1"
FT                   /db_xref="GO:0004604"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0019344"
FT                   /db_xref="GO:0019379"
FT                   /db_xref="HOGENOM:HBG180265"
FT                   /db_xref="HOGENOM:HBG758022"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR011800"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI0000252C6A"
FT                   /db_xref="UniProtKB/TrEMBL:Q758M0"
FT                   /transl_table=1
FT                   /translation="MLRNNKYELNDGLVVTDSQLDCWNMTAAKLTSPAEVLHWAVTTFP
FT                   HLYQMTAFGLTGLATIDMLSKLPALEEQMVPLIFIDTLHLFPQTLSLLHQVEDRYYKPL
FT                   SQSIHIFRPAGVSTEKEFAEKYGSCLWETDEDKYDFIAKVEPAHRAFRSLGVGAVLTGR
FT                   RRSQGGSREQLNFVEVDEVNAVLKINPFVTWSFDQVWSYILDNRIPYNELLNYGYKSIG
FT                   DYHSTLPVVDGAGERSGRWKGKAKTECGLHTASKYARYLLEQK"
FT   tRNA            complement(151141..151212)
FT                   /gene_name="tRNA-Glu"
FT   CDS_pept        join(151679..153139,153195..153314)
FT                   /codon_start=1
FT                   /gene_family="HOG000115471" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756853"
FT                   /locus_tag="AGOS_AEL258W"
FT                   /product="AEL258Wp"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="AAS52427.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG059269"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="UniParc:UPI0001DB2995"
FT                   /db_xref="UniProtKB/TrEMBL:Q758L9"
FT                   /transl_table=1
FT                   /translation="MVRYTVDCCLKEDVLALIIPMLHEIGDEGNMDPTATFQEILVRTV
FT                   TRRLQKLEEDELLDREHCAYDFLLNGQGAVSLASTPTKAQESFIRSLVKVVMHDFATGG
FT                   NNQVIDYQGNLLISFCIEKLYIEKATGAPSFGVEADDLVWMVADALGKGQKLQTMIDHA
FT                   RGKEFDINFYATPERFSISFASAISDEFDKIDLKDDESGHERTLTPLDPSISWLPFSPE
FT                   TFQLVRVHFLPSREYEGAWEALYFDDDIKGQLFNYATIALKMSHFIPEETLSVNTGGNR
FT                   LLLVHGPPGTGKTTICKALCHKLAIRLHSGLLPKNKSVPSVILVELACSKVFSRWFGES
FT                   SKNIDTIFKDLEKLIKDGINDNQFVCLLIDEVETIAFSRSSLINKNETTDAIRVVNTLL
FT                   TQLDNMKKYKNFLTLATSNLLDSMDPAFIDRADGIFNVPTPSTQGCQNILELNISKLLT
FT                   AGVIHASKEHMLYSPVVQAALQPIVSRCADLRLSGRTMGKLPLKALSENFTNLPVDLKD
FT                   FIVALASVI"
FT   CDS_pept        153596..154429
FT                   /codon_start=1
FT                   /gene_family="HOG000224541" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756854"
FT                   /locus_tag="AEL257W"
FT                   /orf_name="AGOS_AEL257W"
FT                   /product="AEL257Wp"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS52428.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG340553"
FT                   /db_xref="HOGENOM:HBG489944"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniParc:UPI0000252C6C"
FT                   /db_xref="UniProtKB/TrEMBL:Q758L8"
FT                   /transl_table=1
FT                   /translation="MKTINRVLIAALFISVVSAAATREQEVDDLHSSSTLKDLLMAVSM
FT                   VGVSEIGDKTFLIAALMAMRHPRLLVFSAASTSLALMTVLAGIIGGTFTSLVPQRYTQF
FT                   AAGILFFIFGYKLALESLETPKDAGVEGELAEVEEEIAIHDMNTNLNETESGGVIKDKR
FT                   TLVNNRYLNDMLLKVGDRLALYFSPVWIQTFVMVFLGEFGDRSQISTIAMASSSQYWIV
FT                   ILGATIGHLICTAVAVIGGKLLAKRISMRTVNLGGAISFIIFGIVYTYESFHNPN"
FT   CDS_pept        complement(154535..155050)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059088"
FT                   /locus_tag="AGOS_AEL256CA"
FT                   /product="AEL256C-Ap"
FT                   /protein_id="ADJ41768.1"
FT                   /db_xref="UniParc:UPI0001DB2996"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGC5"
FT                   /transl_table=1
FT                   /translation="MSSLEAQLEDRRQRLILLKEKYGSTVEHPIDGTIKRRTPATGADN
FT                   EIPGSLEDDTDAGDGARRTGGVKYENVTVRSLAHSFEREILAKHGEMNDYNPDEDPRSR
FT                   EKQLGNRVVRAHRRSIQQALDELQQSTDRTLKRIVRKRYFQDAGKDSHEGDSYNEGNDE
FT                   SSGYDRSS"
FT   CDS_pept        complement(155337..160937)
FT                   /codon_start=1
FT                   /gene_family="HOG000210415" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081019"
FT                   /locus_tag="AGOS_AEL256C"
FT                   /product="AEL256Cp"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="AAS52429.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG015252"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR022707"
FT                   /db_xref="UniParc:UPI0001DB2997"
FT                   /db_xref="UniProtKB/TrEMBL:Q758L7"
FT                   /transl_table=1
FT                   /translation="MASQASRLDRHVILLESGSTQVVRNVAADQLGDLARQHPDEILVL
FT                   LSRVYPYLLSRRWETRVTAARAVGAIVAHARLWDPNGEGGELAGEETRQLEALGRYEWR
FT                   GLQDDSALYSLAQWELGKIFKAGRTLLAARSDAYAAEESKKQAVLAEYVLEPAVKREGV
FT                   EAPMSPAESKKSARMLAMAKRRRKIQAKTTSKKPLDLSQSSVARNLMNQDAAADGSNED
FT                   EDSGNNNNSSNHNNNDNNDSSHSNTASPQQVPVQLNNPRLEITEQPDSNKIMIESMVAP
FT                   LLEKQQRVSGLVWQFQGIFELLLDNLMNDSWEIRHGAALGIREIVKRHATGVGRIKGKT
FT                   RQENDLRNKRALEDLATRLLTIFALDRFGDFVNDTVVAPVRESAAQALAALLIHLEDDL
FT                   SVKIFSVLEQLVLQDPRYVGSPTKIWEATHGGLLGIRYFVSIKTDFLFTNNLLDNVVNI
FT                   VLYGLNERDDDVQSVAAAILTPITSEFIKLEPSTIDLVVSAIWNSLSQLEDDLSSSVAS
FT                   VMDLLAKLCQHQEVLDVLHHKASTHPMEWSFKSLVPKLYPFLRNTITNVRRSVLNLLQA
FT                   FLSIEDETSKQWINSKIFRLIYQNILLEQHDDILEQSFHVYRTMLEIYKSKNPDKSLDH
FT                   IFSKHLAPILHLLITPIGEQGKNYSMEAQYLLKPSQSYQFNTERKRSSMTALNKSDIPM
FT                   PLHTEHVNIDAPMIAGDVTLLGADVIFKTRVLAAKALGYTLAAFQESTVKSFFETALLS
FT                   CLDLPYATPRMLVSITVAEYCSRWTFLHPETAFPPSFVADYFGPIFMEYLFDPSKLPVF
FT                   RELVPSLKALRTQCQSLMTTFVEVGMLSPQRLPQLAIIVKGEAEAGPEAFYIETAEKVC
FT                   DEHYEKLYQYMSNSCKILAKKPLEDARYRIQQAIDVAKEVRRSRNSNILASYASATLLF
FT                   DGLPKKLNPFIRSLMDSIKEEQCEILQKRSGDSVIYLIMELVKNGKVNVANKVVKNLCG
FT                   FLCVDTAEVPEFSPNMHYTDSILTLIREANSLAVQDNASIKLMTKEAQIKRRGAMHTLS
FT                   CLLLQLGPNALTQVPQLKASIFDPLLSFGDLDSDSDSIEPEVGQQLVDALGVLRALFTY
FT                   MDPVIHLEHVFTRLHDLLKYLTSRYSVVRYSAARTLAELAVANPTQVIPFIIKEVLPLM
FT                   NNAGSVIARQSGTELVYHLCQSMGSDILPYIVFLVVPLLGRMSDPAPDVRSLATTTFAS
FT                   IIKLVPLEAGIADPEGLPEELLRGRERERDFIQQMMDPSKAKPFSLPVAIKATLRKYQQ
FT                   EGINWLAFLNHYHLHGILCDDMGLGKTLQTICIIASDQYLRQEDYKTTKSVETRPLPSL
FT                   IVCPPSLTGHWEQEFEQYAPFLTVLVYAGGPSTRYPLRGKLGDADIVVTSYDVARNDID
FT                   IISKHDYNYCVLDEGHIIKNSQSKLAKAVKSIRANHRLILTGTPIQNNVVELWSLFDFL
FT                   MPGFLGSEKAFQERFAKPIAASRNSKTSSKEQEAGALALEALHKQVLPFMLRRLKEDVL
FT                   SDLPPKIIQDYYCELSDLQRQLYKDFAKKQKNIVERDIENTMELESKNHIFQALQYMRK
FT                   LCNHPSLVLSKDHPQYNQVQDYLSQTGMDIHDIAHAPKLGALRNLLLECGIGVQDVDQN
FT                   SISLPSSENVISQHRALIFCQLKDMLDMIENDLFKKYLPSVTYMRLDGSVESRDRQKVV
FT                   RKFNEDPSIDCLLLTTKVGGLGLNLTGADTVIFIEHDWNPMNDLQAMDRAHRLGQKKVV
FT                   NVYRIITKGSLEEKIMGLQKFKMNIASTVVNQQNAGLASMDTHQLLDLFDTDNSLAQVK
FT                   EEKAGAISDDVTNETGLTGKAKEAVSELKELWDSSQYEEEYNLDNFIKTLR"
FT   CDS_pept        join(161376..161382,161584..162143)
FT                   /codon_start=1
FT                   /gene_family="HOG000194525" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081020"
FT                   /locus_tag="AEL255W"
FT                   /orf_name="AGOS_AEL255W"
FT                   /product="AEL255Wp"
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="AAS52430.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="HOGENOM:HBG053230"
FT                   /db_xref="HOGENOM:HBG588353"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005710"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="UniParc:UPI0000252C6E"
FT                   /db_xref="UniProtKB/TrEMBL:Q758L6"
FT                   /transl_table=1
FT                   /translation="MPRAPRTYSKTYSTPKRPYESARLDAELKLAGEYGLKNKREIYRI
FT                   SFQLSKIRRAARDLLTRDEKDPKRLFEGNALIRRLVRIGVLSEDKKKLDYVLALKIEDF
FT                   LERRLQTQVYKLGLAKSVHHARVLITQRHIAVGKQIVNVPSFMVRLDSEKHIDFAVTSP
FT                   FGGGRPGRVARKRAAAAAGGAEDEE"
FT   CDS_pept        join(162786..162796,162969..163440)
FT                   /codon_start=1
FT                   /gene_family="HOG000194513" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624152"
FT                   /locus_tag="AEL254W"
FT                   /orf_name="AGOS_AEL254W"
FT                   /product="AEL254Wp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS52431.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG008055"
FT                   /db_xref="HOGENOM:HBG497499"
FT                   /db_xref="InterPro:IPR001147"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018259"
FT                   /db_xref="UniParc:UPI0000252C6F"
FT                   /db_xref="UniProtKB/TrEMBL:Q758L5"
FT                   /transl_table=1
FT                   /translation="MGKSHGYRSRTRYMFQRDFRKSGTIPLSTYLKVYKVGDIVDIKAN
FT                   GAIHKGMPHKFYQGKTGVVYNVTKSSVGVIIYKMVGNRYIEKRLNLRVEHIKHSKCRQE
FT                   FLERVKANAAKKAEAKAQGVAVQLKRQPAQPRESRVVSTEGNIPQTLSPVPYETFI"
FT   CDS_pept        163893..164990
FT                   /codon_start=1
FT                   /gene_family="HOG000188210" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756855"
FT                   /locus_tag="AEL253W"
FT                   /orf_name="AGOS_AEL253W"
FT                   /product="AEL253Wp"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS52432.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0000252C70"
FT                   /db_xref="UniProtKB/TrEMBL:Q758L4"
FT                   /transl_table=1
FT                   /translation="MTKRDLSKLESEALESIPYLASDEKGSNLKDATSLILENKKENHP
FT                   HVAPWVHFVAGGIGGMAGAIITCPFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHF
FT                   RETVGIIQNVYTQEGFRSLFKGLGPNLVGVIPARSINFFTYGVTKDTASRLLNDGQEAP
FT                   WIHFLAGATAGWATSTATNPIWLVKTRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILG
FT                   LYKGLSASYLGSVESILQWVLYEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSG
FT                   SAGAAKLFASILTYPHEVVRTRLRQAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLT
FT                   PHLMRTVPNSIIMFGTWELVIKLLA"
FT   CDS_pept        complement(165107..165778)
FT                   /codon_start=1
FT                   /gene_family="HOG000111183" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756856"
FT                   /gene_name="MED8"
FT                   /locus_tag="AEL252C"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 8"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52433.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG191925"
FT                   /db_xref="HOGENOM:HBG204194"
FT                   /db_xref="InterPro:IPR019364"
FT                   /db_xref="InterPro:IPR020178"
FT                   /db_xref="UniParc:UPI0000252C71"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758L3"
FT                   /transl_table=1
FT                   /translation="MSQTSPLSEQADSSLKYDYSNVPAQALDAIRMRLAQLTHSLSKIR
FT                   DDMSKADLPQWYSLQAQLSVTLTQLSSLTSTLQHFEDTLECTVPYPLPSFPTTAHEGLL
FT                   TTLMRKKQIPEVENWIKDAIDHSGLDLEGRNWDEIESAIQRDKSTTARALDFINQEYSN
FT                   YSFQGLYTAEELSKNVGDPQSMIYRSATSNAKPKAPFSVDSILTFMYQGTMKTEETSIA
FT                   K"
FT   CDS_pept        join(complement(166901..166971),complement(166113..166752))
FT                   /codon_start=1
FT                   /gene_family="HOG000158315" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20624153"
FT                   /gene_name="ATP4"
FT                   /locus_tag="AEL251C"
FT                   /product="ATP synthase subunit 4, mitochondrial "
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="mitochondrial proton-transporting ATP
FT                   synthase complex, coupling factor F(o)"
FT                   /protein_id="AAS52434.2"
FT                   /db_xref="GO:0000276"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="HOGENOM:HBG057729"
FT                   /db_xref="HOGENOM:HBG328743"
FT                   /db_xref="InterPro:IPR008688"
FT                   /db_xref="InterPro:IPR013837"
FT                   /db_xref="UniParc:UPI0001DB29A9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758L2"
FT                   /transl_table=1
FT                   /translation="MAFRALTTKAAARPLLALGPRSVAMGARYMSTPAPQDPKSKAAAI
FT                   LDSLPGSTALSKTGILATSAAAAIYAISNELYVLNAETILLCTFTGFSFLIAKLVAPAY
FT                   KEYADKRMQHVSGILNSSRNKHVAAVKERIESVSELKNVTETTKVLFEVSKETLELEAK
FT                   AFELKQKVDLATEAKAVLDSWVRYEASVRQLQQKQIAESVIGKVQAELANPKFQDKVLQ
FT                   QSVADVEKLFASLK"
FT   CDS_pept        complement(167239..168492)
FT                   /codon_start=1
FT                   /gene_family="HOG000160330" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756857"
FT                   /locus_tag="AEL250C"
FT                   /orf_name="AGOS_AEL250C"
FT                   /product="AEL250Cp"
FT                   /protein_id="AAS52435.1"
FT                   /db_xref="HOGENOM:HBG021032"
FT                   /db_xref="HOGENOM:HBG396292"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR022052"
FT                   /db_xref="UniParc:UPI0000252C73"
FT                   /db_xref="UniProtKB/TrEMBL:Q758L1"
FT                   /transl_table=1
FT                   /translation="MSVKFSAEEVPQVSSEISDELQQRYTNWKKNTKLLYDYLNTNSTK
FT                   WPSLTCQFMPDLEVPTDKHRLLLSSFTSSQLPEDEAVYISELSTMRHVPWSSLNNFDMD
FT                   EMEFKVDNQAKLPNKNLVETVRIQFPSGDCNRACYMPQNPDIIGAIASTGAVNIFDRTK
FT                   HGTNRPKLLGSAASYEIQLNEPESLGDADSAEALSLAWNWQKAGIIASSYSNGLIKVWD
FT                   ITRYQKSQPTISNPELRILQDKAGTNDVSWMVHHSSILAACGESNTIGLLDTRAPDAFK
FT                   PTKASPHTGGINALQFNYANDMLLCAADSNGGIALWDCRAFSKPLSVFNHGDSVSALQW
FT                   NPNLPTIVATAGQGDGLIKIWDTSREPEDSLLFVHGGHMLGVNDIAWNYHDPWLMCSVA
FT                   NDNSVHVWKPAANLVQAK"
FT   CDS_pept        complement(168790..170457)
FT                   /codon_start=1
FT                   /gene_family="HOG000261371" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18929690"
FT                   /gene_name="PGI1"
FT                   /locus_tag="AEL249C"
FT                   /product="Glucose-6-phosphate isomerase "
FT                   /EC_number="5.3.1.9"
FT                   /function="glucose-6-phosphate isomerase activity "
FT                   /biological_process="gluconeogenesis"
FT                   /biological_process="glycolysis"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS52436.1"
FT                   /db_xref="GO:0004347"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006094"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="HOGENOM:HBG001533"
FT                   /db_xref="HOGENOM:HBG352954"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="UniParc:UPI0000252C74"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758L0"
FT                   /transl_table=1
FT                   /translation="MATTNTFSDFKLASELPAWAKLQELYEKKGKTLSLKEAFATDEQR
FT                   FQKYSRTFSNHDGSKILFDFSKNLVDDEILGALAQLAREANVTQLRDQMFNGEHINSTE
FT                   DRAVYHVALRNRANKPMYVDGKNVAPEVDAVLQHMKEFSEQVRSGAWKGYTGKSIKDVV
FT                   NIGIGGSDLGPVMVTEALKHYAGPLKVHFVSNIDGTHLAETLKEVDPETTLFLVASKTF
FT                   TTAETITNATSAKNWFLSKTGNNPAHISKHFAALSTNETEVAKFGIDTKNMFGFESWVG
FT                   GRYSVWSAIGLSVALYIGFDQFEDFLKGAEAVDKHFTSTPIEDNIPLLGGLLSVWYNNF
FT                   FDAQTHLVVPFDQYLHRFPAYLQQLSMESNGKSVTRGNVFANYSTGSILFGEPATNAQH
FT                   SFFQLVHQGTKVIPSDFILAAQSHNPIENNLHQKMLASNFFAQAEALMVGKDEAQVKAE
FT                   GATGGLVPHKVFSGNRPTTSILVQKITPANLGALIAYYEHVTFTEGAIWNINSFDQWGV
FT                   ELGKVLAKVIGKDLDTTGETTSHDASTNGLINQFKAWL"
FT   CDS_pept        complement(170668..171039)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756858"
FT                   /locus_tag="AEL248C"
FT                   /orf_name="AGOS_AEL248C"
FT                   /product="AEL248Cp"
FT                   /protein_id="AAS52437.1"
FT                   /db_xref="HOGENOM:HBG059271"
FT                   /db_xref="UniParc:UPI0000252C75"
FT                   /db_xref="UniProtKB/TrEMBL:Q758K9"
FT                   /transl_table=1
FT                   /translation="MDPGNTSPSAESISSGRGAPRRDVRTLPTPAAGTGVATPQVDRKD
FT                   RLWTEIDVLDDVKRMAAMDTAERGFPDDFEARLQHLRRSQAALLDATRMPAANIDAQRQ
FT                   RILDIMRKLEGLRDLDEGT"
FT   CDS_pept        171150..171992
FT                   /codon_start=1
FT                   /gene_family="HOG000194668" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624154"
FT                   /locus_tag="AEL247W"
FT                   /orf_name="AGOS_AEL247W"
FT                   /product="AEL247Wp"
FT                   /function="phosphatidylinositol N-
FT                   acetylglucosaminyltransferase activity"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS52438.1"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0017176"
FT                   /db_xref="HOGENOM:HBG141903"
FT                   /db_xref="HOGENOM:HBG714597"
FT                   /db_xref="InterPro:IPR009450"
FT                   /db_xref="UniParc:UPI0000252C76"
FT                   /db_xref="UniProtKB/TrEMBL:Q758K8"
FT                   /transl_table=1
FT                   /translation="MKRQKVRGAEVWPEWRRLLWLRQPYPDNFTDPRFLTTLQEITAGQ
FT                   LRSQEFSRYLDVVLDFLTFHHRLTNTLLIYVVFTLLYRYHYSPIALAALTTLCASLSFR
FT                   VLEHLKSSMIVTFTMLTLAPVLKTLSRTTSSDSIWNLSCWLTIIYVLSYSWTQSSLVPT
FT                   NILLSNVTVLASRLNTTPEVFCFLLICIELNILLPSYERNLRLQGRYATYGCIVMFTHA
FT                   IVYTFVTMTLGWTYTAPLLVLSVAFIFIAPGYFIYWQRHHYKGHEVLATWDAKKPIFD"
FT   CDS_pept        complement(172078..174525)
FT                   /codon_start=1
FT                   /gene_family="HOG000212424" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756859"
FT                   /locus_tag="AEL246C"
FT                   /orf_name="AGOS_AEL246C"
FT                   /product="AEL246Cp"
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52439.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG027600"
FT                   /db_xref="HOGENOM:HBG559818"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR007582"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013720"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI0000252C77"
FT                   /db_xref="UniProtKB/TrEMBL:Q758K7"
FT                   /transl_table=1
FT                   /translation="MNSKLNNRSTRPAHRQEAHMSQKGQKQPTKPAPSSIRPGQQQGSS
FT                   SSQAAKPSSGFSASDLNRIVLEYLNKKGYHRTEQMLRAESSRTLTPSNKSSVASSTLPA
FT                   PATSATQEVTTNGKPASNPPMPLKRDANGNLVQQAQVTPQHYFRAYAMLKNWVDSSLDM
FT                   YKPELSRIIYPIFIYVFLTLVSKAPVQARRFFDKYSEDYKALHGTEINKLFSVNSVDHI
FT                   KENELAQGFQSNKYRVTISRTTLNLLLYFLNENESVGGSLLISIINQNLEPNAVDNIIS
FT                   QDTLTDGIKDISAGAIDVDNHNSVPVKLGPFPRDQEFTKEVEVELMRKDEQEIEENPDE
FT                   NRKTLVEEYKSMTGATAAVAPVGAQPEAPATQKGDESDDASEKKEHDEKAGEKGTAPSS
FT                   SGQPAVPIPAGTLPLNAPVGLPLSTTATDLINPMMESPLPGALPLPPKTALDLKLEIQK
FT                   VRESRDAIKMDNLQTSAPSVCMYTFHNTNREMTCLRFSDDSRLVAAGFQDSYIKLWSLD
FT                   GTPLESQLPSKAKDASNTVTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTC
FT                   LVSYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWSCDHIYPLRIFAGHLNDVDCVTFH
FT                   PNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIV
FT                   WDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDLKKFTNEPSLEPEQ
FT                   PYSGYLGDMEASVNQDVKEYGRRRTVFPTQDLMASFHTKKTPIYTVKFTRTNLVLAGGA
FT                   FTE"
FT   CDS_pept        175276..177414
FT                   /codon_start=1
FT                   /gene_family="HOG000112706" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756860"
FT                   /locus_tag="AEL245W"
FT                   /orf_name="AGOS_AEL245W"
FT                   /product="AEL245Wp"
FT                   /protein_id="AAS52440.1"
FT                   /db_xref="HOGENOM:HBG058915"
FT                   /db_xref="HOGENOM:HBG104007"
FT                   /db_xref="InterPro:IPR022210"
FT                   /db_xref="UniParc:UPI0000252C78"
FT                   /db_xref="UniProtKB/TrEMBL:Q758V3"
FT                   /transl_table=1
FT                   /translation="MDTINLSTNLHDWLEDPMLQVSDSRGAGSVGASTTLSPPGMKHLE
FT                   LSQSNPTPSPRSSVSMNRGSHCRSGLYELVQRVPLDENSLLAYVLQQYFHVHEKKEAEL
FT                   LTLVDIILDQTYPHSLTLRKLRYDSTYFRYFGTISRENDITRCPVFYVSLYFYMTWGLP
FT                   ARKQISWDTFSTIPLLSNPPGDEYGPGASCSKPESQNHSMSNKITRSVSVPAQLKQSVY
FT                   PWLAQLKEDMNQKDRVNYKLYSLIELFQYLSECIVQDIAFLECTGQLPAVRELLREGNQ
FT                   KLFGSAMFAKYKEEMRQQLDGEVVNKDWHNSILLRMEEKFNQLTAKTAQDNTKLNSEIS
FT                   DLKGKLNSMSSMISQLLESQRQLISRSSSHVPALSGTAVSALDKALQQPLSLNDTASAL
FT                   APISVLPSLSQQHLADGKRKLPLPSAPSPLDHSAGATLKKFRFEDRVLEGTAGTPNNLG
FT                   SPLEPLLSRAISSPRIPITSLTTQIPPTLAAATPPLHVRPQNTRILQEPRQAADPTTAA
FT                   MTLTQDCINTVMADELELQKAPLDESVHNLAVNNTASSNGGPNESIKYKLSRDNKTIWD
FT                   LYTEWYKGFDGKPSIKSLIERYGWRRWKVSDDSHFFPTRRIIINYIEKECDRGVAMGKY
FT                   PSTLDREAVRKLVAKDLENFRVTNSLTLNSLSLYFRNLTREQREICIYNNFTDWSLLIL
FT                   PEEEKTKYCKRKQGSSSE"
FT   CDS_pept        177892..179964
FT                   /codon_start=1
FT                   /gene_family="HOG000066024" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19776706"
FT                   /locus_tag="AEL244W"
FT                   /orf_name="AGOS_AEL244W"
FT                   /product="AEL244Wp"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="AAS52441.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG058916"
FT                   /db_xref="HOGENOM:HBG203907"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI0000252C79"
FT                   /db_xref="UniProtKB/TrEMBL:Q758K6"
FT                   /transl_table=1
FT                   /translation="MGQEKFVIPGNITLLQALTLLHSIVSAQFENTSKDMRASLASAAR
FT                   KDDTLLECQRALEETRGYLIDGSSRIKTHYRIDLVAGSLPEDVQGRIDDLRILEQDIKT
FT                   SQQALNDMLGDTKKRVPQVHRHAFSSIFRKTRFGSDRRLQRTQAAEDAEAHEVAELKRQ
FT                   RELQEDRKRQEELEREKRAKEEEDKRLEEAIKKHLEMELAQRFDRPRSEGTTQHNRCNG
FT                   KFPPRLSLDMRGSPKVELPVMRRSLDLGASYSTKLEGSSINKAALLAWYKDKEKNVKTD
FT                   PSKKENKERRVPPPPAKYEYTKPVIRRPQLKFSQPQGSRNKVKAKVLETVPPDGLRSPS
FT                   PKRGSNSDKSPVIESSPNPTTDSNSPQEISLLEKNIKDVMRSLKGVDTHSCEQIINEIL
FT                   VVDYDVRWEDIAGLTIAKKCLKETVVYPFLRPDLFRGLREPISGMLLFGPPGTGKTMIA
FT                   RAVATESNSTFFCISASSLLSKYLGESEKLVKALFYLAKRLSPSIIFIDEIDSLLTSRS
FT                   DNENESSRRIKTELLVQWSSLTSATAKETREGEEARRVLVLAATNLPWAIDDAAIRRFS
FT                   RRLYIPLPEYETRLYHLKKLMALQKNELSESDFQLIARMTEGYSGSDITALAKEAAMEP
FT                   IRELGDNLINVNFDTIRSVLPVDFHRAMVTIKKSVSPDSLIKFDNWATEYGSIGS"
FT   CDS_pept        180186..181547
FT                   /codon_start=1
FT                   /gene_family="HOG000160667" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756861"
FT                   /locus_tag="AEL243W"
FT                   /orf_name="AGOS_AEL243W"
FT                   /product="AEL243Wp"
FT                   /function="glycolipid 2-alpha-mannosyltransferase activity "
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS52442.1"
FT                   /db_xref="GO:0004377"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG192431"
FT                   /db_xref="HOGENOM:HBG396033"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="UniParc:UPI0000252C7A"
FT                   /db_xref="UniProtKB/TrEMBL:Q758K5"
FT                   /transl_table=1
FT                   /translation="MLCLRKCLRRPILLLAIALTGIVCFLIYRINHILEVRAYFANTVE
FT                   SVGATLSDIASKTTHADRASEFDALIEKLTTPLHSGAELSGATREEGLRAYARFMDQPI
FT                   DEPKGTPLVRPGTDAAGKAPATILCLVRNKDLEGIRSSITELEKAFNGKFKYPYTFLND
FT                   EPFTPEFKEAIQKLIPEHESEFATIDKEFWSIPEAINREKYDVQKLKLLTLKVGHAEED
FT                   SYHLMCRFYSRYFYKVPELAKYRYVWRLEPNVNFHSELNYDVFQFMKAANKIYGFTISL
FT                   YDNPWSVESLWDHTMDFVRAHPHYLNQAGATDWLRENIQKSENFKITRGYSTCHFWSNF
FT                   EIIDLEFLRSEAYEQFVEYLDQTGGFFYERWGDAPVRSLALALFANASDIHWFRDIAYN
FT                   HLPYFNCPTFLPDSRRSFGTCKSGKFSNWDELNVENCAGNWILHAMTDADRAAY"
FT   CDS_pept        181838..183679
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929691"
FT                   /locus_tag="AEL242W"
FT                   /orf_name="AGOS_AEL242W"
FT                   /product="AEL242Wp"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="AAS52443.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG058917"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI0000252C7B"
FT                   /db_xref="UniProtKB/TrEMBL:Q758K4"
FT                   /transl_table=1
FT                   /translation="MLHRVTYPSSVYDGTLSINKVGSFLYGTDNIPQRLLLCGTLALSY
FT                   YILGPTIYTWLFPGSSAMFQSSTRKDKHTTGLANNRNDCFANSSIQAWASLPAVSVYLN
FT                   EIMEIRKEVLRRMVRSSDGAHDGAAADEWGEVKAPSPEHKSEAHDMHDSGDHVGQMNLS
FT                   NGVDVRMHAALADILYQLQQPVAKSTFISLQPLLHTLELIYSAKLSRGQNDAHEFTQLL
FT                   LETLEKEHTELSLMLKGDKRLEGLAVPAFPIRGSLADNLVCLRCGGSSKVNVHQFSMHT
FT                   LPVPNATSADLRDMLFDNQTETIDDYTCVSCQIRAILATEKNRGRQGVDSTELAIIEEL
FT                   ARLAPSISINEDMPPHLAAYVSAYNKDHCITAALKSTIVKRTVSVDSPRVLILHLSRSV
FT                   FNGVSYAKNTCNVTFPEELVINEQLLENNKCVGVRAVRYKLCAMIKHIGTHSQGHYACF
FT                   RHKPDFRKDPRTGEIIIRSDVISSDAVPQPAPRMPVPYASSKPSALGRLAALLKTVTGE
FT                   PPSTVTTNEEPVSKPDASAEQDSSGASSASSSGVSSAATKVLPRPQGRPRKLKALRRTT
FT                   THPWWCISDSYVSECKTSFLLSETKLVYMLYYQRIEP"
FT   CDS_pept        join(183867..183875,184064..185704)
FT                   /codon_start=1
FT                   /gene_family="HOG000246638" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624155"
FT                   /locus_tag="AEL241W"
FT                   /orf_name="AGOS_AEL241W"
FT                   /product="AEL241Wp"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="AAS52444.1"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG174475"
FT                   /db_xref="HOGENOM:HBG397148"
FT                   /db_xref="HSSP:1A0N"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniParc:UPI0000252C7C"
FT                   /db_xref="UniProtKB/TrEMBL:Q758K3"
FT                   /transl_table=1
FT                   /translation="MLKGFKLKKDSSQATKGRITSADISAPTQDGSNIAFHMNRLRSLS
FT                   NTSNRGGKNGAVAGAVDVPIILKALYTYHAQSPGELSFNKGELFQVNGEDGEWYEVTST
FT                   EGGRKGMVPKSYFEQVSKSRVVSTHSILTSPQQVQMPVKTGSLYAIVLYDFKAEKSDEL
FT                   SAFAGENLFICAHHNFEWFIAKPIGRLGGPGLVPVGFVSIIDINSGYATGNNVKDDIAS
FT                   VNLPTVQEWKNNIAKYKASNISLGSVEQHQQQQQQQQQQQRVSVVPSVQPFQYTQAQSF
FT                   DNIVPVGAAVESFLLEGEKYWFHVVCDLEDGSSHSLKRYYEDFYDLQVQLLDAYPAEAG
FT                   KLRDSNGQWTKRIMPYIPGPVPYVTDSITKKRKDDLNIYVKELIALPPHISHSPLVKSL
FT                   FAIRNNGFDRVLLKDYGNSTVVRSDDPVALTGAKLAQQEESTLTGSDLKERMGELSLND
FT                   KTPPIGSPQAAGSQLKSNKIKFYYKDDIFALLLSPTITLVELKTKIAPRIDSETFQLFV
FT                   KAGDDVGTEITSNEDLSGVIQEKQKIMVLDVQ"
FT   CDS_pept        complement(185853..186323)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624156"
FT                   /locus_tag="AEL240C"
FT                   /orf_name="AGOS_AEL240C"
FT                   /product="AEL240Cp"
FT                   /protein_id="AAS52445.1"
FT                   /db_xref="HOGENOM:HBG058918"
FT                   /db_xref="UniParc:UPI0000252C7D"
FT                   /db_xref="UniProtKB/TrEMBL:Q758K2"
FT                   /transl_table=1
FT                   /translation="MGAAQAGGAFKMKRPAVDPAGIATYKRQRLVADLENLRISEVPAA
FT                   RAAVVDSAGRGHGNALLADRIRDQVWEVLQRPRGEAALQQRMCRQIWQDTYNSHMQVVR
FT                   WVDWPARMFQIWLRWWQSQGTESSDVEMATDYESYEEEETPMDVDEDGDWKY"
FT   CDS_pept        186675..188330
FT                   /codon_start=1
FT                   /gene_family="HOG000000992" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756862"
FT                   /locus_tag="AGOS_AEL239W"
FT                   /product="AEL239Wp"
FT                   /protein_id="AAS52446.2"
FT                   /db_xref="HOGENOM:HBG058919"
FT                   /db_xref="InterPro:IPR003123"
FT                   /db_xref="InterPro:IPR013995"
FT                   /db_xref="UniParc:UPI0001DB29AA"
FT                   /db_xref="UniProtKB/TrEMBL:Q758K1"
FT                   /transl_table=1
FT                   /translation="MAVAAMSDSPPLNAAVYESKHPNKKQYTQAGETYEDASSSTSLAS
FT                   KQSSTASGSQRDEMEKEVAQIEVLPMELSRLVDMFVDDLKQPKYVKPLSIFLLSGLFQQ
FT                   FYTRFDASCGQYLAKQGRQLGTSASVENVGFSSARETLSTGLGGIFGRSRSGSGPHKKR
FT                   SSSLFGNDAANSQPLSPEEVQRHLKLQELNSMKIERYMDICERDVFQKIMEVGTSVPGT
FT                   GQETERRPVHAVDLFRNSPEFLEYDSLLTAKIRNLRVLVERGVLDLPAFLGMPRSEGID
FT                   CTEFGIHLQTLVEERLSPMEKLAQLLAIHDKMTFLKDASSNDDYLSMLLYVIILTPVHT
FT                   LYLNVQFIKLFRYSRKLMGSEQYAVTNMTAALYFLENLTINDLPGTAKGHAKPSDIFVL
FT                   SHRVKLPDISRQAKPELPRTNSYKSLMGTTLDNSLRNIFGKIKSYTPPAPAQTVFSSPT
FT                   NQSNMHNNQLNCCCHAGKPCQGQIGSAQLSSTAELACCNDSHDSFKGGENSKRPLHIPE
FT                   CWRQLQNRDFDDLKVSELKQVFDAFQKLLHTLEH"
FT   CDS_pept        complement(188371..189333)
FT                   /codon_start=1
FT                   /gene_family="HOG000169461" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18929692"
FT                   /gene_name="BTS1"
FT                   /locus_tag="AEL238C"
FT                   /product="Geranylgeranyl pyrophosphate synthase "
FT                   /EC_number="2.5.1.10"
FT                   /EC_number="2.5.1.1"
FT                   /EC_number="2.5.1.29"
FT                   /function="dimethylallyltranstransferase activity "
FT                   /function="farnesyltranstransferase activity"
FT                   /function="geranyltranstransferase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="carotenoid biosynthetic process "
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS52447.1"
FT                   /db_xref="GO:0004161"
FT                   /db_xref="GO:0004311"
FT                   /db_xref="GO:0004337"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016117"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG029802"
FT                   /db_xref="HOGENOM:HBG397395"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR017446"
FT                   /db_xref="UniParc:UPI0000252C7F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758K0"
FT                   /transl_table=1
FT                   /translation="MDSVEGLALGPVIWTASQEELLRQPYNHLVTQPGKNFRNTLIRVF
FT                   NGFYGLSERQVAAVTELVEMLHVASLLIDDIEDNSAWRRGVAAAHVVYGSPMTINTANY
FT                   MYFVSMSLLGQLAAQRPAGPLQDLLKVFNEEMMNLHRGQGLDIYWRDTFTVPSEHDYLR
FT                   MVMHKTGGLFRLTVRIMEALREGPDGPGSTLVPLSNLLGVLYQVRDDYLNLTDSRMSEN
FT                   KGFADDITEGKFSYPIIHGLQYARVHDPAGYDFLVSVLRQRTTDITTKRRVVRYLADVS
FT                   GSLAYTKQRIIELATLIKTKYIPASGTELCNVIDSLTSF"
FT   CDS_pept        189550..190152
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756863"
FT                   /locus_tag="AGOS_AEL237W"
FT                   /product="AEL237Wp"
FT                   /protein_id="AAS52448.2"
FT                   /db_xref="HOGENOM:HBG058920"
FT                   /db_xref="InterPro:IPR007599"
FT                   /db_xref="UniParc:UPI0001DB29AB"
FT                   /db_xref="UniProtKB/TrEMBL:Q758J9"
FT                   /transl_table=1
FT                   /translation="MDVLFVQIMQGVQPVTRVYVLSMIGCIIAHNIGWIESTKYDFSLI
FT                   FHRRQYHKLLLSCFDVGSQFNAMDLAITMFQLSYDEQIIGNSKRFIWFIAVVAVLTTSF
FT                   AYIWDVKGEVLMVDMIKWNLTYYAARTNVAAAGQIGFIRVPSLLALLRIPIFLRVNQCS
FT                   FAMCSLSVLPGYVLYLMADAAERLYQIDLMRPPDEWF"
FT   CDS_pept        complement(190213..191040)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929693"
FT                   /locus_tag="AGOS_AEL236C"
FT                   /product="AEL236Cp"
FT                   /protein_id="AAS52449.2"
FT                   /db_xref="HOGENOM:HBG058921"
FT                   /db_xref="UniParc:UPI0001DB29AC"
FT                   /db_xref="UniProtKB/TrEMBL:Q758J8"
FT                   /transl_table=1
FT                   /translation="MELRRSNRLRKTNKEAVAEEQSSSEEEGDGFRRSGERMKRRVRPR
FT                   RADATAGSGLRRDVEEALGVLPRPRYYFADGARARGAVRWGVESGAVDRTAGMLDGWLS
FT                   KHGENAVGPETAAAVARIARQLRQLGREVAAAPAEEDTASLLERVVADGTRQDEVCQQL
FT                   TGLIDGLAEAADEEWIAALARIHELDLQDIADMPAPRPPKRGAAAQAGPCSRRADLQFV
FT                   INKWNKLLTRERNLALYWPSKAPRKDSGHMSPAAQALSQEDPRDKFRDVPLFS"
FT   CDS_pept        191225..191539
FT                   /codon_start=1
FT                   /gene_family="HOG000133897" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19776707"
FT                   /locus_tag="AGOS_AEL235W"
FT                   /product="AEL235Wp"
FT                   /function="ATP binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS52450.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG279789"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="UniParc:UPI0001DB29AD"
FT                   /db_xref="UniProtKB/TrEMBL:Q758J7"
FT                   /transl_table=1
FT                   /translation="MSFLKSAKSIVPLMDRVLVQRIKAEAKTASGLYLPEKNVEKLNQA
FT                   TVLAVGPGYTDAQGRQVSPSVQVGDKVLIPQFGGSSIKLGKDDEVLLFRDSEILAKIQE
FT                   "
FT   CDS_pept        complement(191568..192773)
FT                   /codon_start=1
FT                   /gene_family="HOG000205412" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19776708"
FT                   /locus_tag="AGOS_AEL234C"
FT                   /product="AEL234Cp"
FT                   /protein_id="AAS52451.2"
FT                   /db_xref="HOGENOM:HBG058922"
FT                   /db_xref="InterPro:IPR010541"
FT                   /db_xref="InterPro:IPR013881"
FT                   /db_xref="UniParc:UPI0001DB29AE"
FT                   /db_xref="UniProtKB/TrEMBL:Q758J6"
FT                   /transl_table=1
FT                   /translation="MAEKEKKGLATEIHPALRSSNLNLLRSKRENPYLSSDAPRQRQPK
FT                   RRQPLAFYKPGEISQRAEEERQRRARELEEQQLLLRKQEEEEHIRREKIAAAELPDDDE
FT                   TCYFDAISALPSIEWWDTKFCDGSQPAAHAKYTASYADLEDDSDCSDDEQEDERPSIRF
FT                   VKHPLPFQPSVTAAATIVPKIYLTKHEQRKVRRNQRKTARQMAEERIRLGLEPRPPPKV
FT                   RLNNMMHVYDSNTKIQDPTAWEHTVREQIEQRRQQHLRTNEERRLEARAQRAAQPAPAP
FT                   DPGQDICRVYSLPPLADPKARYKLVTNARQLHLRGCCLHVPDGPALVVAIGPPRACTFY
FT                   DRLLTRRLAWHASAPALLWTGAAAGHTFRGWFMKQCAEPADLRRILLAAGGPLFAHTPL
FT                   PS"
FT   CDS_pept        complement(192980..195361)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756864"
FT                   /locus_tag="AGOS_AEL233C"
FT                   /product="AEL233Cp"
FT                   /protein_id="AAS52452.2"
FT                   /db_xref="HOGENOM:HBG058923"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI0001DB29AF"
FT                   /db_xref="UniProtKB/TrEMBL:Q758J5"
FT                   /transl_table=1
FT                   /translation="MLNFDYPQKDWYKDVRLCGCRQCCEAVRRKRQGSSGSCGMGEHGQ
FT                   YLDEGYEGRGEHVRSSSAHSGSGGHFVPTISFDTVPIQGISPEEDEQDALHEHQRAYGT
FT                   SLDYTLEEYYNNEDTSYNHDYRSGGGYAGELSPLRSLSPSRYGSGAQLAKFDVLPDGRR
FT                   VRIDYPSKSTLLSDSFVLNKTHREWRSKWKARKAQIERRKLEEPQRWYRYPSILFPETK
FT                   VDLSDLPMINDEGVAYNSNQRANMKRIARVVRTPVGFPVSPRIVLCHVSGRKHTWAAVD
FT                   WVLQNFIADSDHLVVVANLPRLMSRFGYMSRSVSRSRSRSRSRSVRRTTGLNSTSSFGS
FT                   DVSESMTKNKDEEWCNGYTVGSIETILDHLIEYITFIIPEKLAIKVTVEVMIGKTRQVL
FT                   IEALNLHCPDLLVASTTKYKENDGLLDHRSKRLTTVLANYYPLPVFVVPAKRMFLLGMQ
FT                   LESIVHGSDACNAAAPVSQQFSSEVGDSLAPFKPSLKTMHTSPAVMLHTESSVPEVEYG
FT                   MDESEITSIDSELSDGVTEYAGTELLQQDPVGRVARMRETYRRRVQKTFSKIDSDSTLQ
FT                   ADERHFNKLDAVINASLKFNKELENSKSPSILELQRIITGGEKHTGFRKKSMLDVLDLP
FT                   SAKPRKQDPIPKPNLSAGDPTPRRTTRIKFEATVKDVDGSTAVQQSPSDEVLREMSPLR
FT                   QVQSLSQSNLMKYVSNNSLRKVRSANTNPVNSTKYNESTGSSGKRKRGGFLSALFGGSG
FT                   GGSASNTASPATSRRSSMSSSENSGGTSTGKRKKKWKLLK"
FT   CDS_pept        join(complement(196357..196515),complement(195584..196309))
FT                   /codon_start=1
FT                   /gene_family="HOG000141786" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756865"
FT                   /locus_tag="AGOS_AEL232C"
FT                   /product="AEL232Cp"
FT                   /function="GTP binding"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="AAS52453.2"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="HOGENOM:HBG058924"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="UniParc:UPI0001DB29B0"
FT                   /db_xref="UniProtKB/TrEMBL:Q758J4"
FT                   /transl_table=1
FT                   /translation="MTPTGGEVDFFLDSPFRLQKLMLVAPPSRTMDLLTAWIHRLWTCL
FT                   CLFFNQRQLKIAIVGLQNSGKTTLAALLTGHPFRADTIPTLGIDVRHATIGQTLLQVYD
FT                   LAGQARHRFLWDRCLDTTDLVVYVLDLSDDTAWEAAKHALQSVLVATNARRTPVLIIGN
FT                   KADLVAPPPILPPDDASPAPPGPSQQSHRSASVSSNARPFDISPYHWRFMTPLLSHYDY
FT                   DDIPTYVIDTSNHHLLLDLQVLSRELGLDLRNGILHLTNETVLAMDRDIGLFTVSCRDG
FT                   TGISDVIEWLMQL"
FT   CDS_pept        complement(196551..197366)
FT                   /codon_start=1
FT                   /gene_family="HOG000001070" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756866"
FT                   /locus_tag="AEL231C"
FT                   /orf_name="AGOS_AEL231C"
FT                   /product="AEL231Cp"
FT                   /protein_id="AAS52454.1"
FT                   /db_xref="HOGENOM:HBG058925"
FT                   /db_xref="HOGENOM:HBG203316"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="UniParc:UPI0000252C86"
FT                   /db_xref="UniProtKB/TrEMBL:Q758J3"
FT                   /transl_table=1
FT                   /translation="MPLELADGGQPGPFAYDGHQAPLLGGTSGWLPLCAVCWRRVRAGI
FT                   LYSCPIPCPPLSLNLPPPMTSPQQRIIVQMNQERRLALEDYLTTYGRVPIGTKVNEVRL
FT                   ADIELDHLTLRFRHSDVELEIEKTIALDPPLQHWDEAPARLDAMALEAAARRGLAAVQV
FT                   RGGAAPSALGWLLIGLIYLPAACYYEPRLLAWAVPGALLQRSVLQSVFAGVAVCHIAEC
FT                   MLLLRPRLHTYRVPTDYRIEWYFFGLLEGYPAIRRFDRAARSLKSRPTT"
FT   CDS_pept        197631..199457
FT                   /codon_start=1
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756867"
FT                   /locus_tag="AEL230W"
FT                   /orf_name="AGOS_AEL230W"
FT                   /product="AEL230Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS52455.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="HSSP:1A06"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013896"
FT                   /db_xref="InterPro:IPR015741"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI0000252C87"
FT                   /db_xref="UniProtKB/TrEMBL:Q758J2"
FT                   /transl_table=1
FT                   /translation="MSNANHHHQQQKMYTGGRNMPHGMHRPGSIPIGQRIGKYQVIKTL
FT                   GEGSFGKVKLAHHVSTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYD
FT                   VIKSKDEIIMVIEYAGNELFDYIVQRDKMSENEARRFFQQIISAVEYCHRHKIVHRDLK
FT                   PENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSS
FT                   GVILYVMLCRRLPFDDESIPVLFKNISNGVYSIPKFLSQGAANLIKRMLIVNPLNRITI
FT                   HEIMEDEWFKVDLPDYLVPVDMKADATSKPGTDDERIDEALVAVLANTMSYDKDEIYEA
FT                   LEDPNQTDPTVLEIRDAYLLLKENKSLIDGLRSNKQKLDQLDTFLSQSPPTFESHSQLG
FT                   PGSGFQAALGGSQHGDQNPHQVKRLASRQRTYQLSFSEQQDEDSTIAILPSSLPQIHRA
FT                   NMVAQGSPAAVKISPLSNKKSKTRWHFGIRSRSYPLDVMGEIYLALKNLGAEWAKPSEE
FT                   DLWTIRVRWKYDVGTQQNERIPDLMRMVIQLFQIETNNYLVDFKFDGWESSSGNPISSS
FT                   STDDEMSTFSAYPFLHLTTRLIMELAVNSQSS"
FT   CDS_pept        199823..201340
FT                   /codon_start=1
FT                   /gene_family="HOG000094160" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929694"
FT                   /locus_tag="AGOS_AEL229W"
FT                   /product="AEL229Wp"
FT                   /function="NAD binding"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amides"
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin silencing"
FT                   /biological_process="protein deacetylation"
FT                   /protein_id="AAS52456.2"
FT                   /db_xref="GO:0006342"
FT                   /db_xref="GO:0006476"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016811"
FT                   /db_xref="GO:0070403"
FT                   /db_xref="HOGENOM:HBG252407"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="UniParc:UPI0001DB29B1"
FT                   /db_xref="UniProtKB/TrEMBL:Q758J1"
FT                   /transl_table=1
FT                   /translation="MPSLIQSQESFDEELPSVLEKKATPKPQLQTEKLKHIELDSDNVD
FT                   EELLSMINRQIGRSRKIMVLTGAGISCSAGIPDFRSSGGLYNMVKKQYPEVQIRSGQEM
FT                   FDISLFREEEKISVFATFMDSLHSSAIQAKPTRAHEFIAHLKNRGKLLRCYTQNIDGLE
FT                   EHLGLEMSHSVDPGASFNTQWKNLDVVQLHGDLNSLSCTQCFEVFNWTRSWKRILKAGE
FT                   LPPCPRCCAFNQERENQGKRLRNSVGILRPNIVLYGENHPSCEFITQGLNMDIAKGKPD
FT                   LLIIMGTSLKVDGVKKLVKSISRQVHERSGIVLLINSTTIGDCNWHGIIDYQILAECDA
FT                   WVADLKKRLPDFFMTQQQVDKLRQLKREASELKKRQRKEQYLFPQAERRNIPNTPPSTP
FT                   SPTKRRRAAANTPSSTLRTLKETVVTLPPTQVPSLQRDQRDTTMNKIYMKLIKDDDHYA
FT                   KLTDMPEEELMQSVIAEKKAIAPSKNRKVKDSQSMDFDEVPTDVDEP"
FT   CDS_pept        201524..202108
FT                   /codon_start=1
FT                   /gene_family="HOG000142065" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081021"
FT                   /locus_tag="AEL228W"
FT                   /orf_name="AGOS_AEL228W"
FT                   /product="AEL228Wp"
FT                   /protein_id="AAS52457.1"
FT                   /db_xref="HOGENOM:HBG103416"
FT                   /db_xref="HOGENOM:HBG124112"
FT                   /db_xref="InterPro:IPR007175"
FT                   /db_xref="UniParc:UPI0000252C89"
FT                   /db_xref="UniProtKB/TrEMBL:Q758J0"
FT                   /transl_table=1
FT                   /translation="MRLMEMSTAVTTNNGMNRLEKDNFMRIHLQHKYTLLHHLSSADVT
FT                   HLSGLYLKSFYNAVKRNRVVLPNIICDGDVKFCGSCGIVYVAGVNLQAHVQETSQEDGI
FT                   VKKELVYKCLKCSHEKRFVLSQSDPPVPKAPFVAKWPSKENSKSSIAKSSGRERAKKRK
FT                   KNMLSNLLAAKKQHESTKGKVSLQLEDFMKS"
FT   CDS_pept        complement(202256..203830)
FT                   /codon_start=1
FT                   /gene_family="HOG000248734" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756868"
FT                   /locus_tag="AGOS_AEL227C"
FT                   /product="AEL227Cp"
FT                   /protein_id="AAS52458.2"
FT                   /db_xref="HOGENOM:HBG058927"
FT                   /db_xref="InterPro:IPR010482"
FT                   /db_xref="UniParc:UPI0001DB29B2"
FT                   /db_xref="UniProtKB/TrEMBL:Q758I9"
FT                   /transl_table=1
FT                   /translation="MDSLRGHHTKERGSGHGRGECGVMQGMLLDKMMEKVLGMAIPPAG
FT                   EAGGGAIESRVQAGRARPGLSVPIMSRNFVQMNSRLSFPFQVVNEVIRIANWESTACTL
FT                   SVGMLYSFVVLRPLVTLSSAPMFYILFAVMVPYYMQIHAPEPWEELGANPIPAAGPALK
FT                   EPDLPRPVPELSKEFILNLTDLQNHMVLYVVCYDFITGLLAKFAFFADENVSAAAFVGL
FT                   LVLGVFNMLFIESLFRWIPLKLLLLACGWGFLIMLHPSCRDACFDYISSEETRLKVLTM
FT                   TNKIEQLINDYWDYCEPRETRQAAIFEIQKFDRRTKEWRTAGFSSDDYTLLSKLRIAEE
FT                   PIDSSATSLDDVKPPLDWKWLGKYDWVLDLEPRQWVTDGFVQYVDIDAETKWVYDLNFD
FT                   GTRGQYRRRRWIRLCTRNRSVQENANVDTIDDDNSDDYELVDYSGCTGVSQNSMHGSVK
FT                   SCHSISEPTDQIVVERLRSHTLSPAANASVSSADSTASATIATPNKNVEQGSRAIKSLT
FT                   DFLNING"
FT   CDS_pept        204042..205016
FT                   /codon_start=1
FT                   /gene_family="HOG000247885" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624157"
FT                   /locus_tag="AEL226W"
FT                   /orf_name="AGOS_AEL226W"
FT                   /product="AEL226Wp"
FT                   /protein_id="AAS52459.1"
FT                   /db_xref="HOGENOM:HBG051997"
FT                   /db_xref="HOGENOM:HBG202806"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0000252C8B"
FT                   /db_xref="UniProtKB/TrEMBL:Q758I8"
FT                   /transl_table=1
FT                   /translation="MVSGEPGNVASAMAYVELKDVSKDYLSGVCLVDEEGSQLIVSSWD
FT                   GTASLYDWEKNKRMGRLSHEWPLTSVAVCAGTRRAYVGSAQGEVLELDWESERMVALQG
FT                   VQCGLGISAMGSYGQFVVVGSWDGSLAVVDTRRNTVRHIRRLTGKILSLDCGAARVVCM
FT                   TTDGVYVFRTSDIDAAPERRESGLKYQSRCVRLVPDEEGYVQSSVDGRVAVEYFGDEGR
FT                   KFAFRCHRMNLKDTQLVFPVNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVE
FT                   DSVVKLCCNRRALVIAASDDSFKTSAVVEDIALQRSRVYVKVF"
FT   CDS_pept        complement(205065..206498)
FT                   /codon_start=1
FT                   /gene_family="HOG000247886" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624158"
FT                   /locus_tag="AGOS_AEL225C"
FT                   /product="AEL225Cp"
FT                   /protein_id="AAS52460.2"
FT                   /db_xref="HOGENOM:HBG058928"
FT                   /db_xref="InterPro:IPR011383"
FT                   /db_xref="UniParc:UPI0001DB29B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q758I7"
FT                   /transl_table=1
FT                   /translation="MVDEFAEATAQFVQWLPKVGIEVAPEVRVEDLRDAGQNRSVVASG
FT                   AVQEGATLFTIPRSALLNVHTSALRECAAGLPAALEEKIGHWEGLVMCVYYERCVLQER
FT                   SRWWPCLRLFPAVEEMDNLIYWNAEQRQLLTPSLVGSRIGDESAREMHARVLALAEEWG
FT                   LSELKEMSWDAFVHIASVIMAYSFDCRLNSDEEDDEEDDDGALDGGTVAADGCIKSIVA
FT                   LAETLNSDTHLANANLTYDRDQLKMIAVKDIKAGEQVYNLYGSYSNAELLRRYGYVEWT
FT                   GSKYDYGEIELSAIRETISKELAVPDFPFDAVLALLEDKDGWAGELFDYNDIVEESYDC
FT                   YADGELAPDGAFLVQLLVALAQVPRAALGKGSTLSVRTRKISKKVMQLLESGRITRKAA
FT                   DVLESVIRDRMQAYPPHAAVFDGQKPTDLQAMDPAPRREAMARCVLQCEVKALQKCALA
FT                   ISSNYKIISDDLLMGKLLN"
FT   CDS_pept        206940..208682
FT                   /codon_start=1
FT                   /gene_family="HOG000186562" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756869"
FT                   /locus_tag="AGOS_AEL224W"
FT                   /product="AEL224Wp"
FT                   /function="binding"
FT                   /protein_id="AAS52461.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG038558"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001DB29B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q758I6"
FT                   /transl_table=1
FT                   /translation="MTTAEEYKKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNR
FT                   SACYASMRKFREALADAQECVRIKPDWSKGHNRLGAAHYGLGDLDEAEESYKKALELDS
FT                   SNKAAQDGLAQVQATQQQRMEQPDLGFGQMFQDPNLIQKLKNNPKTAEMMKDPQLVAKV
FT                   LQFQSNPQAISTELMRDPRLMTVMAAILGIDLSMDSPEPKSAAPADAPAPSAEQPSEAK
FT                   PEPTPAASQPAPAAEKEEEPEQMHVDDDRSKAEEAKAKGNELYKKRQFDEAIANYEKAW
FT                   DLHKDITYLNNRAAAEYEKGDYESAIKTLEKAVEEGRELRADYKVIAKSFARLGNAHYK
FT                   LADLKKAIEYYEKSLTEHRTPEVLNKLRSLEKEQKKREAEAYIDPEKAEEARLQGKEYF
FT                   TNADWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCDMAIQKDPNFVRA
FT                   YIRKATAQIAVQEYAAAIETLDTAREKDAEVNNGSNTREIDQLYIKATQQRFQPANANE
FT                   SPEETYARAVKDPEVAAILQDPVMQSILSQAQQNPAALQEHMKNPQVFKKIQTLIAAGI
FT                   IRTR"
FT   CDS_pept        complement(209080..211491)
FT                   /codon_start=1
FT                   /gene_family="HOG000218211" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19776709"
FT                   /locus_tag="AGOS_AEL223C"
FT                   /product="AEL223Cp"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="AAS52462.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG229122"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR013093"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="UniParc:UPI0001DB29CC"
FT                   /db_xref="UniProtKB/TrEMBL:Q758I5"
FT                   /transl_table=1
FT                   /translation="MLRSVGRVPGYRVRGAATSWMHRPLAGGCWLPEHISVNPGNRPSL
FT                   ADGHLSVWLAACRPFSSSVARYQANKNYRMDLGKQQEQSALEQYGINLTKLARAGKLDP
FT                   VIGRDQEISRAIQILSRRTKNNPVLLGRAGVGKTSLIDGLAQRIVKGEVPSSLMDKELV
FT                   ALDLGSLIAGAKYRGEFEERLKSVLDEIDKSEGQVIVFIDEVHMLLGLGKTDGSMDASN
FT                   ILKPRLAKGMRCISATTFDEFKIIEKDPALTRRFQPVILDEPSVSDTISILRGLKERYE
FT                   VHHGVRITDTAIVSAAVLSNRYINDRFLPDKAIDLVDEACAVLRLQHESKPDSIQAIDR
FT                   AIMTMEIELESLRKEEDPVSLERADALKKSLKEKNDELEKLTKVWDKEKKEIEAIKSAK
FT                   ATLEQAKIDLEIAQREGDYGKASELRYAKIPQLEKTISESEKSGSKNNILHDAVTADDI
FT                   SAVVSKMTGIPVSSMFKGDKDRLLNMEQSLTKRVVGQDEAISAICQAVRLQRAGLTSSK
FT                   RPIASFMFLGPTGTGKTELTKALSEFLFDNESNVIRFDMSEFQEKHTVSRLIGAPPGYV
FT                   LSESGGQLTEAVRRKPYAVVLFDEFEKAHPDVCKVLLQVLDDGKLTDSQGHHVDFRNTI
FT                   IVMTSNVGQDILLNDSELTIDGKVSEKTKNKVIESVKRIYPPEFINRIDELLVFNRLSK
FT                   SVLRSIVDIRLKEVQQRLSDKRMVLALTDEAKDWLTERGYDPGYGARPLNRLIHKTILN
FT                   PMALYLLKGQLRDGETVKVTVEADKLVIKPNHEESESTDSTGETHAALDT"
FT   CDS_pept        complement(212965..213669)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18929695"
FT                   /locus_tag="AEL222C"
FT                   /orf_name="AGOS_AEL222C"
FT                   /product="AEL222Cp"
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="AAS52463.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG058929"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="UniParc:UPI0000252C8F"
FT                   /db_xref="UniProtKB/TrEMBL:Q758I4"
FT                   /transl_table=1
FT                   /translation="MESNRGSADAKASLEELEKKGLLGAAGVVVPDMAGVGGGVQQGMA
FT                   AMPVSVRAQYQQAMQEGAGAGGGAGSGGSQPPLIQLPSMTMPSLMYQLSHHPTHHGSMP
FT                   QIPVLKQHQQGQQEMGSGSSAGSTANGSAGLPLLSTTTSTQGIQAIQLNEGEHINSQGQ
FT                   LIGRSGKPLRNTKRAAQNRSAQKAFRQRREKYIKDLEIKAKQYDKLEQEVLSLRRENEE
FT                   LKMRLADIEKLT"
FT   CDS_pept        complement(214099..214527)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756870"
FT                   /locus_tag="AEL221C"
FT                   /orf_name="AGOS_AEL221C"
FT                   /product="AEL221Cp"
FT                   /protein_id="AAS52464.1"
FT                   /db_xref="HOGENOM:HBG058930"
FT                   /db_xref="UniParc:UPI0000252C90"
FT                   /db_xref="UniProtKB/TrEMBL:Q758I3"
FT                   /transl_table=1
FT                   /translation="MGYIDSQVHAYHYHHDHEMALRWLKETFPLPDEIEMKGKSNAASS
FT                   GTGANLTAPAPASTPVGPAPSSHIIGAAPAAHGLVNQYWDCFDDEEQWTMFHGLKMACN
FT                   GDLFKDGVLLGNNFHRADRLAALAAATKPPPPNRAPTS"
FT   CDS_pept        complement(214585..216090)
FT                   /codon_start=1
FT                   /gene_family="HOG000114462" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756871"
FT                   /locus_tag="AEL220C"
FT                   /orf_name="AGOS_AEL220C"
FT                   /product="AEL220Cp"
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="AAS52465.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG176634"
FT                   /db_xref="HOGENOM:HBG735468"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000252C91"
FT                   /db_xref="UniProtKB/TrEMBL:Q758I2"
FT                   /transl_table=1
FT                   /translation="MRSYVTLAAVLATALVAVPINAESAKGDVLRSANGTQGDLDQIKG
FT                   ISIGGWLVPEPFITPSVFETAVEWARDAGSNVSIIDEYTLCEALGPKTAKALLQQHYDT
FT                   WITVNDIREIKRHGFNLVRIPVGYWAWKKPDSEDEYVGNITYWDPYVGGIQLEYLKKAL
FT                   SWCADTGLRALIDLHTAPGSQNGFDNSGQRLDEEDSLLWLNQTGTGELTSAVLHDIFTH
FT                   ILDEFNDVVWAVEILNEPIAETIGVDKVIDFYNDTIQHYISLNKTKPLVIQSAFEPAGF
FT                   WDDYWNDTSVPVLVDYHYYHVFSRDQLSSDTMQRLVNVAHAASDVSDTMDAHSSFIGEF
FT                   SGAITDCAKWLNGLGVGARYDSTYYDTFPPKNSSWREPLGKCSSQRDISLWDDSYKSAV
FT                   RLFIEVQLRSFEHSTRGWIFWTWKTEGAGEWDYLKLVHHHLFPQPFDNYRFFSDDGFIA
FT                   LQDAQPRNSAAPRSSAAGAPRPAVLALLPALCAAAALLVSDVM"
FT   CDS_pept        217560..219053
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756872"
FT                   /locus_tag="AEL219W"
FT                   /orf_name="AGOS_AEL219W"
FT                   /product="AEL219Wp"
FT                   /protein_id="AAS52466.1"
FT                   /db_xref="HOGENOM:HBG058931"
FT                   /db_xref="InterPro:IPR014844"
FT                   /db_xref="UniParc:UPI0000252C92"
FT                   /db_xref="UniProtKB/TrEMBL:Q758I1"
FT                   /transl_table=1
FT                   /translation="MGGAHPTYLRLETVLQELSGARGCSIEMLTGGRLLLEGAYGRQER
FT                   QVTRPAWYIKCADEQQYGPLEQALKAADLEQLPYQFEKDTFQRGSLMVAFTLSSVCAGA
FT                   WMLLLVLALLPVNNHNTRRRLVALYAVFYAVTQTVLLQMLTREIFEKQYRGNYQRSYEL
FT                   NAVTQSAMLCTFRLITTIFANLTWVQIVHYMLHNYRKTTHRWVPRWLDTNSKRVQWLGS
FT                   FLCLSHAIIWGLNLFLNVPVFIPEIGEYRRTNLPLYIPHIAFESLLFLLFAISLCYYLY
FT                   HDLGHSLMFHRQNREHHEDESVFTKLRLICQEYLSTIPVIVYNLVVFALYLVCFFVNTI
FT                   KYHSNLLWLFTLTTFLRLLITVNTWGLIGILERRERVVSKQTVLGRKINNKDRFFADPY
FT                   SNTDYRGDSVNGERRLQGVAGQRIGMFQAETAGISSVLSKMAGAVSAWFCWCRAPSSPT
FT                   AGEPGTPENMELQHIKTENESVDSGETELERNILFTHGA"
FT   CDS_pept        219380..223795
FT                   /codon_start=1
FT                   /gene_family="HOG000112234" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624159"
FT                   /locus_tag="AEL218W"
FT                   /orf_name="AGOS_AEL218W"
FT                   /product="AEL218Wp"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent DNA helicase activity "
FT                   /function="DNA binding"
FT                   /biological_process="DNA replication"
FT                   /protein_id="AAS52467.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004003"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG058932"
FT                   /db_xref="HOGENOM:HBG203807"
FT                   /db_xref="InterPro:IPR014808"
FT                   /db_xref="UniParc:UPI0000252C93"
FT                   /db_xref="UniProtKB/TrEMBL:Q758I0"
FT                   /transl_table=1
FT                   /translation="MLTKGNKRSSSVSVSPQKSRSKSATEDGPSANLKPPTKKQNKKFS
FT                   YKFAPVNNLSTLEAACSPSSPSSGRASAAGRAAEQQLRNAENDKENKTWLSGVKDRHSE
FT                   ESGSAKRDCHLGPASQYNGDGPSEEVIWMFSPGKQQRDPTPAEQVLPITIPDYSSGTDD
FT                   VGPLNNQSSTPIMSSRFKTILSLPHFYSNDAHARANMSRRHIRTGTRSATATPNFESKA
FT                   STRDIDDIINDIAGDYVVHQTQLPSSPMKVGDIQGESREPSANTSEDNVRDDPLQDNGR
FT                   NTTPALHDITSSADDDDSLIDILTQNFSKPKTKQVIELQSVPEKHNTERSSSTGPFLSL
FT                   ASGLDSSSQLDPSDETSKAELLGSDANDDSLISYLEKKHVKGQPEVAVVPEPSKEPVGV
FT                   QNDAMKDTANNTETEDLNRWQRLAMCGYKRKGLARLVVLSVKEFNILSNPRQKILTCLD
FT                   SDGVKSTVIVRKPWVQMEFAPGDVIHIIEGKHSSNTRLLSDDKDPITGLINDNLLVQHP
FT                   DLLLSATMIGNSIDCMRRAVLGAKIIEPGEPSIHITIGCIVHELLQEFLRYRLNHDSID
FT                   DDFIESALTEVIEKYKLSILMCNETADSVREIIEQFHLPNIRSFVADYVKESNSGCKVN
FT                   VAGHSQKELLSISKAVDIEENIWSHMYGVKGFIDATVETSVGSSKRLLAPLEIKTGKYK
FT                   HISHEAQGSIYTLLLSDRYDIPVDFHLMYYSKTNDFVKHPTSMVSLKHLLVLRNQLASK
FT                   LKHNIAEIESRESLANLELHLPPLLKSSTCDTCHAKTHCMVINKLTENGSIEDSGLAGS
FT                   EYDDLTGHLSKNLARYREFYQKYIGLLHLEESSLNSNSKEMFLMDSELREATSGRCISG
FT                   LVIQEVSMVGDLYHYKFRRSSTSDVNVPMINSQLAVNESIYISDELGHFSLATGHVKDI
FT                   SDSYIVISCSRRFNLDNIRASGFSEDQQQVIESVLTETSLQHTNVTERLTYRVDKYEHA
FT                   VGLSMSRFNILNLFLPEIDPDKEYVNANGDRIRLNKWHGGDGKTRRLLVEGQPPRFSKR
FT                   PQFTYTPDETKFNKDQLKAIDKAIRCKDYALILGMPGTGKTTLIAEIIRILARNGKNVL
FT                   LTSYTHSAVDNILLKLLDSELQIARLGYKHRVHPGVRHLVQSLEDVQTHEELVSSVDEF
FT                   QVIATTCLGVNDSLLALRTKNFDYVILDEASQVSLPIALGPIRYGDRFLLVGDHYQLPP
FT                   LVRNHIAKEDGLEDTLFQLLCDQHPSCMTELTLQYRMNEDIMALSNELIYDGKLKCGDR
FT                   SVAERALRIEVPKSITQPWLREALNPCKRVIMINYDNIPSIRETADRDNIRNEGESRIV
FT                   GLLVSGLLSCGASSADIGVMTLYRAQLRLLKSELAPHSSTLEVLTADQFQGRDKECVII
FT                   STVRCNPSLNAGALLRELRRVNVAMSRAKSKLILVCSLATISSVPQLQGFLRLLHRNGW
FT                   VYTLSPSTYP"
FT   CDS_pept        224445..226949
FT                   /codon_start=1
FT                   /gene_family="HOG000142071" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624160"
FT                   /locus_tag="AEL217W"
FT                   /orf_name="AGOS_AEL217W"
FT                   /product="AEL217Wp"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAS52468.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG058933"
FT                   /db_xref="HOGENOM:HBG204443"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000252C94"
FT                   /db_xref="UniProtKB/TrEMBL:Q758H9"
FT                   /transl_table=1
FT                   /translation="MTIEKEVERRLADGLEGVVISGSPRQGGGEEQSEPSSAPTAEDSD
FT                   PEQTAVEDQRAERSQARHEEVPKGNTAISQLEQLENTNLLTVRIKWVNPENLMDDHKSQ
FT                   LLNRNNDAILCSRGIPINPSIIENYEYFFDRKRLEILKEHADVYTFESGTEEFMRSYED
FT                   GSSTWLYDLVVQAQFKAFQDLCAARNQIKENLEKSDHVEAWSISQNPHALTHPGNLYIR
FT                   GIPKDLSVDDLIPIFSKFGTVLSLKIIIDGNTRESLGYGFISYPLGSQAARCIKELNGN
FT                   LMNGSPLFINYHVERKERERIHLDHLKEDNDDERFRGVFVGNLPTEYEDGTLITPEQVF
FT                   NKFNHILDPVDILSYYFPKRNSNTNIEYKDDDSTSPTSSSKENAETCDSQNEDSPLKGY
FT                   GFIKFSTHDMALKAIDKLNSFTWLGHSLVVNKAVQNKTLYNNHSHYRTSSTRASISSRQ
FT                   SSLSGIPFFGPATPATSTLHHPPPPAFTMFAKPYSVSPTNSEVLLADRSPARSGSSNDG
FT                   SPRVNTIPQVPLYGAQTQSHSPESLTAPGSRQGSLYLPSCPPMYTSAGTLMSSHPQFGH
FT                   SAAHAAAAAFGGLPIPTRDQQESNLYVKHIPLSWRDEDLNDFYSQYGEIISAKIITVGG
FT                   SKNEIGESKALEDVPVGTSRGYGFVCFKNPLDASRAMMATDRFQVGTNHVLYVSFAQKR
FT                   GKSVSAGSGSSAGSHQPMSSSGRSSSHGSYHHGHGGSRQSPYDSIMGNYNPKFLNAMIQ
FT                   QQNQHLNGSPGTHSPTMMSQRNSWAPNQQAPYLVPVVMAPPPLTVPRSSPAMSSPKRSP
FT                   DYNGTADSTVIDATPECGTLDA"
FT   CDS_pept        complement(227661..229013)
FT                   /codon_start=1
FT                   /gene_family="HOG000142070" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756873"
FT                   /locus_tag="AEL216C"
FT                   /orf_name="AGOS_AEL216C"
FT                   /product="AEL216Cp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52469.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG058934"
FT                   /db_xref="HOGENOM:HBG103400"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI0000252C95"
FT                   /db_xref="UniProtKB/TrEMBL:Q758H8"
FT                   /transl_table=1
FT                   /translation="MQPKTFIHQLHHMLSDRSLETWIRWSAEDDHIFCLKPYDPEFPGT
FT                   VLKKNFKHGNVSSFVRQLHLYGFHKLQTGPGAASSGPAGDNEPPTHIIKSNKESMVWYF
FT                   THPSGYFYKGACQPDLARIQRKSNGVGKDGKRKNGLSPVCVSILDPSTRGAASPAAAAP
FT                   PLEGAQRYTTPGYGDGMAHGVAPLHSTPAYADVAKRRSASSLDLLIHHPQSLPQQPLPA
FT                   AAHQQQNPASHTPQPGPNHQPILRPSVFSVPQQLGTTAASPVASQHIASSNPPATPLEY
FT                   YHYENNLQLLQRCMLTIVDILQVPPSQQNNIAKQNLNHLRSEILSMDSKWTTLRSYQPY
FT                   YTSPHSSLSSEASGPLHSNPHSSSTAISLSMQGQPVSSTQKSSIFSNPRLSVASSASLS
FT                   NGGGSVSGSSQYGGYYQQESKAPAPVFPPLQQQSQYAYPPPQHHTNHSQSY"
FT   CDS_pept        complement(229443..230489)
FT                   /codon_start=1
FT                   /gene_family="HOG000256285" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081022"
FT                   /locus_tag="AEL215C"
FT                   /orf_name="AGOS_AEL215C"
FT                   /product="AEL215Cp"
FT                   /function="6-phosphogluconolactonase activity"
FT                   /biological_process="pentose-phosphate shunt"
FT                   /protein_id="AAS52470.1"
FT                   /db_xref="GO:0006098"
FT                   /db_xref="GO:0017057"
FT                   /db_xref="HOGENOM:HBG398862"
FT                   /db_xref="HOGENOM:HBG725991"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="UniParc:UPI0000252C96"
FT                   /db_xref="UniProtKB/TrEMBL:Q758H7"
FT                   /transl_table=1
FT                   /translation="MQGIRRYAAHASEGAPPDRSLDGSAYAGHTSCPDLFQISRAARLF
FT                   SAGARYGTVLQNVRAASLISELASSLKAAAAGEFNGGRWRGQPGQLQAMVAVYAYPDTD
FT                   ALAQDLGEYIVAQQDAALAAHGQFAVAVSGGSLVGVLAAALLHGPAAARVRWAQWHVFF
FT                   CDERLVPLEHAESNYHALRTQLLDPLAAAGALGPVVHSFNEALLGQGANERIAEAYEAQ
FT                   LPAALDLALLGAGPDGHTASLFPGPAHAWMLDERRARVLWCRDSPKPPADRITLTLPAL
FT                   EAAAAVAFVAEGTAKRPVLERALVRRDPALPCAVVTARCARVAWFTTAATVQDLPLQTA
FT                   AYCASSRT"
FT   CDS_pept        complement(230731..231381)
FT                   /codon_start=1
FT                   /gene_family="HOG000111920" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18929696"
FT                   /gene_name="CPD1"
FT                   /locus_tag="AEL214C"
FT                   /product="2',3'-cyclic-nucleotide 3'-phosphodiesterase "
FT                   /EC_number="3.1.4.37"
FT                   /function="2',3'-cyclic-nucleotide 3'-phosphodiesterase
FT                   activity"
FT                   /biological_process="RNA metabolic process"
FT                   /cellular_component="Golgi apparatus"
FT                   /protein_id="AAS52471.1"
FT                   /db_xref="GO:0004113"
FT                   /db_xref="GO:0005794"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="HOGENOM:HBG058935"
FT                   /db_xref="HOGENOM:HBG398102"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR012386"
FT                   /db_xref="UniParc:UPI0000252C97"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758H6"
FT                   /transl_table=1
FT                   /translation="MAVALWYCPPANSPCYDTVNSLILSLQTLFPDAVLFEPHVTITSQ
FT                   LRCDSADDAAAVLAAACAALRACRPQLDARGSPVVRFDAVAVGRRYFDKVHLACAHDRF
FT                   LYGVAQVIRELFVQDPPDPAAAADWVHSSFRPHLSLVYSDLYHVDQALLRVLRQRIGDA
FT                   LGAALLPHPPAPGLQALWALQPPLDGWSIPGSFKVVRCEGPVRDWHVLAAADL"
FT   CDS_pept        231601..233316
FT                   /codon_start=1
FT                   /gene_family="HOG000198688" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19776710"
FT                   /locus_tag="AEL213W"
FT                   /orf_name="AGOS_AEL213W"
FT                   /product="AEL213Wp"
FT                   /function="transcription activator activity"
FT                   /function="translation initiation factor activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52472.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016563"
FT                   /db_xref="HOGENOM:HBG489279"
FT                   /db_xref="HOGENOM:HBG713726"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR011665"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="UniParc:UPI0000252C98"
FT                   /db_xref="UniProtKB/TrEMBL:Q758H5"
FT                   /transl_table=1
FT                   /translation="MAKCKNCGHTEIVVDLSNANNDRVCKACGVVSEDNPIVSEVTFGE
FT                   TSSGAAVVQGSFVAAGQAHAAFGPHGTSALESREATLNNARRKLQAVSHALQIPEYVRE
FT                   AAFQWYQLALSNNFVQGRRSQNVIAACLYVACRKEKTHHMLIDFSSRLQVSVYSIGATF
FT                   LKMVKVLHIVKLPLADPSLFIQHFAEKLDLGDKKIKVVKDAVKLAQTMSKDWMYEGRRP
FT                   AGIAGACLLLACRMNNLRRTHSEVVAVSHVAEETLQQRLNEFKNTKSGNLSIKQFRDTS
FT                   TEEEVQQSDSKPPSFRRNRLKETKLKEKGPAEHLETSDQALARNPILSQVLGGQEVTSK
FT                   EVLFYLKQISERRERALSKRRDQGNNDSPDAHSQAGDKRSRGDASGSDYEDQDGSRLDS
FT                   DASSEHSQGQIDGYSLETDPYRPRNLHLLPTSESLLSKVSDDPENLEDVDDEELEAHIL
FT                   DEEASKLKERIWIGINGEYLLEQESKRLKLEADLASGNTSLKKKRSSKKRKTDASNLLP
FT                   EALAAADPTGIQPALQVAEASGDLTTAESVKNMLQKTSFSKKINYDAIDGLFGG"
FT   CDS_pept        233566..235737
FT                   /codon_start=1
FT                   /gene_family="HOG000204601" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756874"
FT                   /locus_tag="AEL212W"
FT                   /orf_name="AGOS_AEL212W"
FT                   /product="AEL212Wp"
FT                   /protein_id="AAS52473.1"
FT                   /db_xref="HOGENOM:HBG347669"
FT                   /db_xref="HOGENOM:HBG561315"
FT                   /db_xref="InterPro:IPR007949"
FT                   /db_xref="InterPro:IPR012977"
FT                   /db_xref="UniParc:UPI0000252C99"
FT                   /db_xref="UniProtKB/TrEMBL:Q758H4"
FT                   /transl_table=1
FT                   /translation="MVKKSRAAILPTNVILLQNLVKRDPESYREEFLQQYSHYESLRDI
FT                   FMMNSTTQDASSAGGSGSFADDESVGEFAELIGFVSQVCSCYPKETAGFPAELKQLLLE
FT                   HHRALPFQVKEKIIASLTMLRNKDVITPDMLIQTLFPLLVAYSSTQGSNIGLNSHAKAL
FT                   RKTVYGNVVSLLKNCNTGSKNQKLNRSTQAICFNLLEQPDSQGLWATRLTRELWRRGIW
FT                   DDSRAVEIMTQAALHDDVKIAASGVLFFLDADREREENFEDKSDDDDVVDMQSLRHKLK
FT                   INKKSSKRGKKLENAVKQVKKKSNSANDQAYLNFSAIHLLRDPQGFAEKLFSKHMSGKG
FT                   GTKFSLEQKISLMQLTSRMIGTHKLLVLGIYSYFLKYLTPKQTDVTKILATAAQSCHDL
FT                   VPPEYLSVVVRKIADEFVSDGVSSEVCAAGLNSIREICSRAPLALDETLLRDLVEYKSS
FT                   KAKGVSMAAKGLLALYREVAPEMLQRKDRGKLASIELQQQRAAAAQPRRPQFGADSGVS
FT                   GIPGLELLAEWERTQDRPAADDDDANWEVASSDDDVDGEWVTVQSDRDYDVDLSDSDLD
FT                   LDDDEAAPAPAPAPAAPELAASRILTPADFAKLQELRTERGVAKLLGVRNEDLVDSDAL
FT                   VGPVKYKQNKQERMERVLEGREGRDKFGSRKQKRGEQGRSTTNREKQRKKNFVMMIHKR
FT                   GVQGKQKMSLRDKQKVLRAHITKQKKKGH"
FT   CDS_pept        236041..237294
FT                   /codon_start=1
FT                   /gene_family="HOG000007059" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756875"
FT                   /locus_tag="AEL211W"
FT                   /orf_name="AGOS_AEL211W"
FT                   /product="AEL211Wp"
FT                   /function="ATP binding"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS52474.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG130207"
FT                   /db_xref="HOGENOM:HBG315432"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniParc:UPI0000252C9A"
FT                   /db_xref="UniProtKB/TrEMBL:Q758H3"
FT                   /transl_table=1
FT                   /translation="MMLSRRLAHGAHKAVRVQTRALSIHEYQSSELLRQYGIGTPRGQA
FT                   ASTAQQAYDAAAGLGHELVVKAQALTGGRGKGHFNTGLQSGVHMISSAEEARELAEQML
FT                   GNRLITKQSGAKGKPVSAVYVVERVKARHEAYLSILMDRQTKKPLIICSSQGGMNIEEV
FT                   AHSNPDAIKKFYVDVKKGLDAETAAAVARSLGFSQEAEADAADAVQKLYKIFREKDATQ
FT                   IEINPLSEVEGQHTKVMCMDAKFGFDDNASFRQQEVYSWRDLTQEDPDEVVAKNSDLNF
FT                   VKLQGNIGCLVNGAGLAMATMDVIKLYGGDPANFLDCGGGATPETIETAFKLILSNTKV
FT                   KAIFVNIFGGIVRCDYVAQGLVAATKNLDVKVPIVARLQGTNLEEGRRIIKESGLKIYG
FT                   FDELDPAAEKVVGLAASS"
FT   CDS_pept        complement(237342..237722)
FT                   /codon_start=1
FT                   /gene_family="HOG000188910" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19776711"
FT                   /locus_tag="AEL210C"
FT                   /orf_name="AGOS_AEL210C"
FT                   /product="AEL210Cp"
FT                   /protein_id="AAS52475.1"
FT                   /db_xref="HOGENOM:HBG335382"
FT                   /db_xref="HOGENOM:HBG627499"
FT                   /db_xref="InterPro:IPR005336"
FT                   /db_xref="UniParc:UPI0000252C9B"
FT                   /db_xref="UniProtKB/TrEMBL:Q758H2"
FT                   /transl_table=1
FT                   /translation="MSTAAAGRAFRRFWQSETGPRTVHFWAPTLKWGLVVAGISDMQRP
FT                   VERVSGTQNLSLMATAVIWTRWSFVIRPKNYLLASVNFFLGLTASYQLARIARYRLREG
FT                   DSAGEVLRYIVNGPRDPAGAAA"
FT   CDS_pept        238290..239702
FT                   /codon_start=1
FT                   /gene_family="HOG000033975" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929697"
FT                   /locus_tag="AEL209W"
FT                   /orf_name="AGOS_AEL209W"
FT                   /product="AEL209Wp"
FT                   /function="1-phosphatidylinositol binding"
FT                   /function="clathrin binding"
FT                   /biological_process="clathrin coat assembly"
FT                   /cellular_component="clathrin coat"
FT                   /protein_id="AAS52476.1"
FT                   /db_xref="GO:0005545"
FT                   /db_xref="GO:0030118"
FT                   /db_xref="GO:0030276"
FT                   /db_xref="GO:0048268"
FT                   /db_xref="HOGENOM:HBG204440"
FT                   /db_xref="HOGENOM:HBG252389"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR011417"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="InterPro:IPR014712"
FT                   /db_xref="UniParc:UPI0000252C9C"
FT                   /db_xref="UniProtKB/TrEMBL:Q758H1"
FT                   /transl_table=1
FT                   /translation="MGAFQAVVKKATKIKMAAPKQKYLKTILAGMETPAVLEEIMRALQ
FT                   VRVGDSAFTVVYKALVVVHVMMREGAKHVTLAYLAARRDFFELRGLLQGGAAAHSGVHL
FT                   VRRYVDYLRTRAAEYGRLECDYVRDGAARLKELGRSTVVLQHVESLETQITALLRNKYS
FT                   QHDLNNGMLMAAFQLLVLDILALYNALNEGIITLLESFFELQRADAQRTLDLYKRFVQL
FT                   TENVVKYLKMGKAVGLQIPVIKHITTKLIRSLEDHLREGEAGGPKAPPESSNAYTETQK
FT                   QLELVREQKRLLQEQLHLTSPLVQQLTAAPPAAPPAVAAAVTGYNPFFDAGAFAQPQLQ
FT                   PQQTNNPFLTQAPAFQPVASGVSAQHAPLLPQHTAPMPLLVAQPTNPFATAAPATNPFA
FT                   AYNPAQMRYSYTQPELHQQQQQQQQLQQQQIQQQQLQQQQFQQQQFQQQQLQQQQLQQQ
FT                   QLGYLNQNLIDI"
FT   CDS_pept        240008..242971
FT                   /codon_start=1
FT                   /gene_family="HOG000200154" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19776712"
FT                   /locus_tag="AEL208W"
FT                   /orf_name="AGOS_AEL208W"
FT                   /product="AEL208Wp"
FT                   /function="6-phosphofructokinase activity"
FT                   /biological_process="glycolysis"
FT                   /cellular_component="6-phosphofructokinase complex "
FT                   /protein_id="AAS52477.1"
FT                   /db_xref="GO:0003872"
FT                   /db_xref="GO:0005945"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="HOGENOM:HBG027559"
FT                   /db_xref="HOGENOM:HBG324640"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR009161"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="UniParc:UPI0000252C9D"
FT                   /db_xref="UniProtKB/TrEMBL:Q758H0"
FT                   /transl_table=1
FT                   /translation="MSVETAYGVAFRSLATTDERLYKATVQFYKRLSFATVKLYDKFKN
FT                   HGDEMLLSGTSQSSRHETWLMSFKLSEVDSSGCRVPQQEAERKLQSDGAMIKVRLVNEV
FT                   AAADCGALRVSYYSGSFAEAAAAFPDREEVSEHEFRIRDPLGNEIALTDTPHLHDAVLG
FT                   EQAVGADFFLSGSGETHRLAQGRETAAALMRSLRETPGAPDSKPKKKLAVMTSGGDSPG
FT                   MNAAVRAVVRAGIYYGCDVFAVYEGYEGLLKGGEYLKHMQWSDVRGWLSEGGTLIGTAR
FT                   CMEFRERKGRKQAAANLIEQGIDALVVCGGDGSLTGADLFRSEWPSLVEELVSDGRFTA
FT                   QQVHPYRNLTIVGLVGSIDNDMSGTDSTIGAYSALERICEMVDYIDATAKSHSRAFVVE
FT                   VMGRHCGWLALMAGIATAADYIFIPERAAPQNKWQDEMKEVCRRHKAKGRRNITVIVAE
FT                   GALDTELNPITAEQVKTALVELGLDTRITTLGHVQRGGTAVAHDRWLATMQGVDAVKAV
FT                   LEMTPDTPSPLIGILEEKIIRIPLMESVKLTKQVAAAIQEKDFDKAISLRDTEFIELYE
FT                   SFISTTIKDSTAVPESGPLRVAIVHVGAPSAALNAATRAASLYCLANGHKPFAIINGFS
FT                   GLIQTGEVRELSWIDVEDWHNLGGSEIGTNRCAAADDMGAVAYHFQKNEFDGLIIIGGF
FT                   EGFKSLQQLYSARSQYPVFNIPMVMIPSTVSNNVPGTEYSLGTDTCLNALVNYTDAIKQ
FT                   SASATRRRVFVVEVQGGHSGYVASFTGLVTGAVSVYTPEKKIDLHSIQEDLALLKENFR
FT                   HDQGENRNGKLLIRNEQASSIYTTELIADIIAEQSNGRFGVRTAVPGHVQQGGVPSSKD
FT                   RVAACRFAVKSVKFLESWNEKAKQAASHDDRQLGFRYVKGVKTPMLPNNDASAAVICVN
FT                   GSTVSFKPVNDLWQNETDVELRKGHDIHWSEFTKVGDILSGRCNLRKEVDAMRAASA"
FT   CDS_pept        243295..245175
FT                   /codon_start=1
FT                   /gene_family="HOG000246586" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756876"
FT                   /gene_name="TRF5"
FT                   /locus_tag="AEL207W"
FT                   /product="Poly(A) RNA polymerase protein 1 "
FT                   /EC_number="2.7.7.-"
FT                   /function="nucleotidyltransferase activity"
FT                   /biological_process="cell division"
FT                   /biological_process="mitosis"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="AAS52478.1"
FT                   /db_xref="EMBL:AAG17722.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG124542"
FT                   /db_xref="HOGENOM:HBG395964"
FT                   /db_xref="InterPro:IPR002058"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniParc:UPI000006979E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HFW3"
FT                   /transl_table=1
FT                   /translation="MMTASVAGNRSGRSGNIARERSNRSRGAQKSDKERNLSKGSSRPK
FT                   SNSSRVKKMRKSSLSKVQKNFAVFNDSAEHENKYETLAVAEADEKEVILLDEEEDTAMT
FT                   TETKGVHAEETANVTGAEGVNAAANALDDNQDFIGFSDSEEEVASGEENGDADYAVEDA
FT                   EDESSEPLPTNADYPWIQNHDHSRQREIADWLTLEIKDFVSYISPNKTEIQLRNDALKR
FT                   IRDAVQDFWPDANLHCFGSYATDLYLPGSDIDCVVNSKSGDKDNKNALYSLASYLKRNG
FT                   LATQVSVIAKARVPIIKFVEPASQIHIDLSFERTNGVEAAKIIRGWLHDTPGLRELVLI
FT                   VKQFLHARRLNDVHIGGLGGFSIICLAYSFLKLHPRIICRDIEPLQNLGVLLIDFFELY
FT                   GKNFGYDDVGIAVSEGDASYINKKEYPELTRNLRGTFNLVIQDPGDPANNISRGSFNIR
FT                   DIKKAFAGAFELLTNRCFELDAATFKHRVGKSILGNVIKYRGAKRDFKDERALIVNKAI
FT                   QENEEFHQRRGRIVHRDTAEFINISDDDDYELQPPPKRARVPAPAPAPADNVVVLDDPA
FT                   DDYVPAQPVDKLMGLDDTDDYLPAPASPTDTPKLDKAAKRNYWLSKGQTM"
FT   CDS_pept        complement(245238..245780)
FT                   /codon_start=1
FT                   /gene_family="HOG000246587" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756877"
FT                   /locus_tag="AEL206C"
FT                   /orf_name="AGOS_AEL206C"
FT                   /product="AEL206Cp"
FT                   /function="translation release factor activity "
FT                   /protein_id="AAS52479.1"
FT                   /db_xref="GO:0003747"
FT                   /db_xref="HOGENOM:HBG058937"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniParc:UPI0000252C9E"
FT                   /db_xref="UniProtKB/TrEMBL:Q758G8"
FT                   /transl_table=1
FT                   /translation="MIIWRAAHSCFRTSTMPWAMRATRRYSDGAAEMRGWLEQLHWSQI
FT                   PKQLYRAQYARSSGPGGQNVNKVSTKCTLTVEGFSKCAWFPALVREQAVRRLRYYARAQ
FT                   DAVVVQCDQWRSRERNREECLRRLVRELKAVVHVAAAPDPVAEARHARLHAAADRHRLH
FT                   GKRRQGERKRLRGRVEY"
FT   CDS_pept        246099..248480
FT                   /codon_start=1
FT                   /gene_family="HOG000234202" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756878"
FT                   /gene_name="CLA4"
FT                   /locus_tag="AEL205W"
FT                   /product="Serine/threonine-protein kinase CLA4 "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS52480.1"
FT                   /db_xref="EMBL:AAG17720.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR015750"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000006B481"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HFW2"
FT                   /transl_table=1
FT                   /translation="MSLSAAARELSESDFQDIGPAPKPPPVAYNQTKPLVNYMSQMDLG
FT                   AKSGGKMRAVQRKKSGWVSYKDDGLLSFLWQKRYMVLNDNYLSLYKGDSGREDAVVQIP
FT                   LTSIVSVSRNQLKQNCFEVVRSSDRSGAPAAGAGGDSSKKSVFIATKTELDLHTWLDSI
FT                   FSKCPLLSGVSSPTNFTHKVHVGFDPETGSFVGMPFNWEKLLKHSRITGEDWNNNSAAV
FT                   IQVLQFYQEYNNGTATPTAQAAAQAAGAPGRPPMLTLSSNSSQASMQQIASTPPYSGGE
FT                   MIPQRKAPTPPKPVVTSGSAIPSAKGGPNVGVTTSPSVHHQNTQHGKQQSPTQSGPPKS
FT                   LPPLHRDEEGPTAPLGNSVSSVATKESPTERLLNNLSETSLMQKQLPAKPVAPPSSVGP
FT                   VAPPLRLQPQRVAPGRPAQPGPHAPDTRPGGPNAMKQQHGPPAAASGQLGPDSKKPEGA
FT                   PGHPTAVAKKKKAGRPTMSNAEIMTRLAAVTFNTDPSPFFQMIEKAGQGASGSVYLAQR
FT                   LKIPPYDENSGVSQHELNDNIGDKVAIKQMILSKQPRKELIVNEILVMKDSQHKNIVNF
FT                   LEAYLKTEDDLWVVMEYMEGGSLTDVIENSIGSDASESPMTEPQIAYIVRETCQGLKFL
FT                   HDKHIIHRDIKSDNVLLDTHGRVKITDFGFCAKLTDKRSKRATMVGTPYWMAPEVVKQR
FT                   EYDEKVDVWSLGIMTIEMLEGEPPYLNEEPLKALYLIATNGTPKLKHPELLSLEIKRFL
FT                   SVCLCVDVRYRASTEELLHHSFFETSCEPEELANLLKWKK"
FT   CDS_pept        complement(248759..253534)
FT                   /codon_start=1
FT                   /gene_family="HOG000074721" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756879"
FT                   /gene_name="YNL297c"
FT                   /locus_tag="AEL204C"
FT                   /orf_name="AGOS_AEL204C"
FT                   /product="AEL204Cp"
FT                   /function="binding"
FT                   /protein_id="AAS52481.1"
FT                   /db_xref="EMBL:AAG17721.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG058938"
FT                   /db_xref="HOGENOM:HBG202733"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000006B644"
FT                   /db_xref="UniProtKB/TrEMBL:Q9HFW1"
FT                   /transl_table=1
FT                   /translation="MASSDIFTSTVRQLTQDLHALASESKRRNSEVKHASDRSLQILRI
FT                   VHSFEELERHPDFILPFVLSCKSGNAKFTSLSMQSLQRLAIHQSIPREQIEHVLEALID
FT                   STQLAVEIQLKVLQIIPIFFKTYGKHIIGPLCAKMLRCCTTLLLTPSKAQVVVGTASAT
FT                   LKQLINDVFGRLKYPDADAELYDVLISNNETIKVNSYRYDANLLFTDLCSIYGSRSQQN
FT                   TLLDSNCINEEYGLELLELVLLNYELLFLTHRDLLFLLRTKAVPLLLRYISSSKNFAIV
FT                   VRSARCITLLIKVQYLTLLELELEVILSLLIHTLSPKSDTLLWRKALILEVFLNVIQDN
FT                   TILLEVFKAYDVHESRKDVVFVLLETMTENFESNSLSELLNVSEFLPSGEQALLLNETA
FT                   VSKNKLMDLLDKASAPSTDGTYIVFLLIAISNGISNSIGSKAVAASHDGDEKILEELCD
FT                   MYTKIFDSIFKIQKKILYAGALDNQLFHSVLRAFQKLAHAAGILSLSSELSQCLRVFCL
FT                   ATIETTAEEEVPLESVQSPNATGMLNAISDTLRGVPTTPPSPKEEAKSSYRSLHQRNLS
FT                   VFRALLSLSISLGPTLTGEHWEYILEAWQWTVYSISGPSHDLHNTPHSTSSPAIPKLIK
FT                   NDTLAVEASINKLFESTRTYSYESFERFLLCLVEGAARLPQDPECNKATGARRVDVQGN
FT                   VMDFHHHKVFYIDRISDLVKFNISRFTDPEGKNIWNKLSDFLISQATVHSSTDEDLRLY
FT                   VTQVFMEIITKVATDAENLQQQYDSKFDIIGDRLLEALMKLNNAVLGFVNSSVHMSVSI
FT                   NVDFDILFHILRTLKDLVDNFGESLQDSWTTVLKILMPQFGIIKRSYENDSERGMDGGN
FT                   LTEAIQQKHRDLVHISFKVFKLISDNFLETLPYPVIKDVIDTLFEFVQQDTDLNISFSS
FT                   ISQFWILGDYMRTMVTLPRDTGVTTDGIIQVPTPGKLPSNNTEGRDISDALWIYLLKTL
FT                   VKCTNDSRLEIKKGAIQTFFRIVDSYSSSFPSWELVSEEVVEPLLSSAPNPREYIEYAD
FT                   FFSITLQGLVHLYPIYFADFRNKPWDKEWSWLFSFIQRLQSSQSFEARFIASHNLGELM
FT                   SLIKDINDVPKGIVTSCYEIWSSYNVLYTELLPSSDKKNNISCLEEVIRSFIPLYRLLD
FT                   KFELLTLRTVEDCLAIFNTAFRYPLLPEHVSDKKKLSILQSETLKALKQFPMNQDHAIE
FT                   LVIWYQLSSVMVLPFDTRKRIEQKLAGKLDGVSRNRIPTFEAVSYHASMMLLERINACN
FT                   SFDDQFMNQKYLTKTLKNFYEPIKYKSMIELASEDSLPLWVVSSRCFNHIFASLFCHLK
FT                   KYEDNKQNDWCGDLLEIYVKVLVAPLQRMDQVADIATEAHDISEYKKHRDLLLKYINLM
FT                   AIDVNHIQPYVSSLWNNSFYYDFDAIEDHIINGSTNLQEITDKLVAFDFSNVIGSTEEP
FT                   ALLSKCNLTTICLEDLIQFCNNMEPGSKKLRSIAVPFLISRVAFVLRRYITDESLLNRA
FT                   PLSKVKRLELVKVLNGLHDILDLRIGHVDEEVENLRVLYPLLLNTIPLSHKVGGLQDLL
FT                   QKLSLRFNVLYT"
FT   CDS_pept        253865..255121
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756880"
FT                   /locus_tag="AEL203W"
FT                   /orf_name="AGOS_AEL203W"
FT                   /product="AEL203Wp"
FT                   /protein_id="AAS52482.1"
FT                   /db_xref="HOGENOM:HBG058939"
FT                   /db_xref="UniParc:UPI0000252C9F"
FT                   /db_xref="UniProtKB/TrEMBL:Q758G5"
FT                   /transl_table=1
FT                   /translation="MLKALIPVRTIPYAWATSSPSRVASRSKSFKAGGCGIVRGGRRSK
FT                   QKDKGKKGKGMQAELDKLQSSGQFMWTLSHGVVRNFVRRRPAANSIIYMVDKPRSPVTT
FT                   QLINIPAHPHMSTQLDMKGPLPEACDDIPSFWGAAMFPIRGEPTDGREASCEKSGSRKV
FT                   RNSEPSRAIKSPICGGNELASALLEIGGSLEGGYGCHDHGGWTSAQERVTGTATRSAAA
FT                   HEGSRDHLLQLIPTLQVDQNMFEIEMDNLTISLCKKVYDATGIPWKHHLCSERLPLFIY
FT                   STQSPRTRLDFQRFLRRSIKAHVQPLLNVLSEKRSLSAIQLDAAAAQEIDILVDYLSWQ
FT                   IPSIRPIRCKAACLVHEGPVAGFSRVFWLQPGLRDWISRKRRRTGWHIAYSRRTKSNDS
FT                   RQLSLATFESAFYASTPLV"
FT   CDS_pept        complement(255180..256688)
FT                   /codon_start=1
FT                   /gene_family="HOG000066077" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756881"
FT                   /gene_name="RIM21"
FT                   /gene_synonym="PAL2"
FT                   /locus_tag="AEL202C"
FT                   /product="pH-response regulator protein palH/RIM21 "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="AAS52483.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG124042"
FT                   /db_xref="HOGENOM:HBG202740"
FT                   /db_xref="InterPro:IPR014844"
FT                   /db_xref="UniParc:UPI0000252CA0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758G4"
FT                   /transl_table=1
FT                   /translation="MVQRTRWRYSAIAHNYNSCRPMELGAGIAVGAWDGVWARARSAEF
FT                   VAATDMGDPVYSAFMRYDDSAPLHAAVAADWATYVAADFNGGPFKYSIFPILYSFTASL
FT                   VVTMGLTVIVFFNVRTKPHRGVPKLLRVAAVLACGNLLTFVVRAMMQLGRDHAEGVVPM
FT                   NHILDMLWTDTAFNTVDILAVLILQLCQVQTVMRFFTRFQEKRLISLCGILLAVLSQVL
FT                   WAIPPYSEAVSNHFMPLDDDKDMDVLPPFVYLVRIAQAGSYASFVLMHVFAKKKLCVQS
FT                   VQMFLLTVLTVVVVVLQPAFFITDVTNVWIDNLSEIFSTTCYMGSTVIVWEWSNRLSIL
FT                   EARRQAQSILGRPVYEDEEQGYNFARYALKIQTALTSKSDEGDTTSATTFAAPRSARFE
FT                   GKGGPQSPVYVQEGEQQAVMAFNKRMGTRALAHHVLDSIIYYTDKVVVKGLGNLSASLP
FT                   SKTSSATSVRGRVRKRIGLEGANDVFVYRTKDLVFDSDEDIPRT"
FT   CDS_pept        257168..258892
FT                   /codon_start=1
FT                   /gene_family="HOG000248756" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756882"
FT                   /locus_tag="AEL201W"
FT                   /orf_name="AGOS_AEL201W"
FT                   /product="AEL201Wp"
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS52484.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="HOGENOM:HBG058940"
FT                   /db_xref="HOGENOM:HBG397500"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI0000252CA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q758G3"
FT                   /transl_table=1
FT                   /translation="MAEVYQSALKSPSVPNLAKTAGGEATNRRRNTRSLHREDNLSLLD
FT                   LYEGVDDTEEEREEEVVRPRAASAASAGRVPQRAVPRGRQAAGPGRGGDGLRGDGRPLF
FT                   MHSATTVTSLHTEATSVVSMTTGGTITPTGTRRLTRSGSHCDRYGFKKQTQYVSEEAYD
FT                   AWWEGYSKYCIRRKHKWRALLAKAGLGLDGDNPDRFPSKSEKLKRYVRKGIPAEWRGNA
FT                   WWYFARGQEKLNKNRGVYDRLLAKINDPSERATLKDLDVIERDLNRTFPDNVHFQKSAN
FT                   SEQEPPMIRSLRRVLVAFSIYNPKIGYCQSMNFLSGLLLLFMDEEKAFWMLVIITSRYL
FT                   PGVHNVNLEGVNIDQGVLMLCIKEYLPEFWSRIWPESDGKKASNRNEFLYKLPPMTLCT
FT                   ASWFMSCFIGIVPIETTLRIWDCLFYEESHILFKISLAIIRLSEPEFPQRQRRLKNRDD
FT                   EDMEVFQVIQTFPKSLLDPNDIFDKVIFRKRIRFNSLNQEEIDRCRKYVMGQRQKLKNY
FT                   TEIMGDRISDKGRDPRIHLDIINEALSSEEYGFRRNLTGVHWNNSIKERVRQLSKRK"
FT   CDS_pept        complement(258942..259553)
FT                   /codon_start=1
FT                   /gene_family="HOG000113515" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929698"
FT                   /locus_tag="AEL200C"
FT                   /orf_name="AGOS_AEL200C"
FT                   /product="AEL200Cp"
FT                   /protein_id="AAS52485.1"
FT                   /db_xref="HOGENOM:HBG058941"
FT                   /db_xref="HOGENOM:HBG202945"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniParc:UPI0000252CA2"
FT                   /db_xref="UniProtKB/TrEMBL:Q758G2"
FT                   /transl_table=1
FT                   /translation="MTNTEREFVNKFLTLAALEEPTRTRDYFKPLEQVKSIAVTLQPLK
FT                   YKYNKQSRPRAGQGLEGNEVKLFLKSVRPPRFAHTALFAANDNVSQVKERLREIEPAVS
FT                   TADLRLLLKGKVLNDGMILSDLKAPEAALMVLVQPHRENAPAAAAAPPRPESDGLDVAA
FT                   VPTLDVPWDRISSTLEDALGDRGVAAATLTRLQRGWDLAG"
FT   CDS_pept        join(259707..260372,260425..260472)
FT                   /codon_start=1
FT                   /gene_family="HOG000248765" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18929699"
FT                   /gene_name="ERF4"
FT                   /locus_tag="AEL199W"
FT                   /product="Ras modification protein ERF4 "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="AAS52486.2"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="HOGENOM:HBG058942"
FT                   /db_xref="HOGENOM:HBG397257"
FT                   /db_xref="InterPro:IPR019383"
FT                   /db_xref="UniParc:UPI0001DB29E4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758G1"
FT                   /transl_table=1
FT                   /translation="MPKSEATEATGSKSGPDLLEGGNNPLFFNCHEFLVTKYRELGEEV
FT                   VREHTEDEALCITHFPNIYCPQGSVEFDRTRIVRLPRRFEESMHYPSFSTELPGHEPAA
FT                   LQREDEARFTPAGFHDGHVFGRSSLSPLSNYVSPEECRDVVRAINGYLKEAYRVQGTQN
FT                   ILFNALDVLTFYTVSLLLSYFRRRTQLEQLEDYVEEVNERFFEKRGIRIISPRRSAYLS
FT                   LDIQIPRPVPPAARS"
FT   CDS_pept        260693..261910
FT                   /codon_start=1
FT                   /gene_family="HOG000176412" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756883"
FT                   /locus_tag="AEL198W"
FT                   /orf_name="AGOS_AEL198W"
FT                   /product="AEL198Wp"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="tRNA pseudouridine synthesis "
FT                   /protein_id="AAS52487.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="GO:0031119"
FT                   /db_xref="HOGENOM:HBG175930"
FT                   /db_xref="HOGENOM:HBG397258"
FT                   /db_xref="HSSP:1K8W"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI0000252CA4"
FT                   /db_xref="UniProtKB/TrEMBL:Q758G0"
FT                   /transl_table=1
FT                   /translation="MNGIFAIEKPSGISSNQFLQKLKHALTKSQVFSKDLQKAIAERAM
FT                   QYQKETGRKPSKHKLRKVSQIKMGHGGTLDPLASGVMIVGIGTGTKKLSEYLSGTVKMY
FT                   ESEALFGLSTTSGDMEGDILNETSTAHLDIESLKTVEKKFVGALKQTPPIYAALKMNGK
FT                   PLHEYAREGIPLPKSIEPRKVTVYELEVFDDSLSTNHSYRLLKPPSDSVKAAIEKMNAN
FT                   IDNDTLYYSEEYCASQGLDSQEAKIEPPIKLTEEERAAINEQGDNYRAPLLHFKAKVSS
FT                   GTYIRSLVSDIGKAMRSSAYMVKLIRTEQQNWSLTKNNVFKLEDFTDRDEALWVPVLEK
FT                   VLETGHEVKLDEEFKSAEQKLADSKMLLEKSAEQFSEAPVDEPSQQSDVPEECANPKKR
FT                   DIDSIV"
FT   CDS_pept        complement(261981..263585)
FT                   /codon_start=1
FT                   /gene_family="HOG000248364" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19776713"
FT                   /locus_tag="AGOS_AEL197C"
FT                   /product="AEL197Cp"
FT                   /protein_id="AAS52488.2"
FT                   /db_xref="HOGENOM:HBG191085"
FT                   /db_xref="UniParc:UPI0001DB29E5"
FT                   /db_xref="UniProtKB/TrEMBL:Q758F9"
FT                   /transl_table=1
FT                   /translation="MMSREYLGVLLWLLTNIITGARSQGLPQALSMPSVYGSRAFMSEN
FT                   LELKDTVGGLFNNQTMHELAPINCSIVPGARNKLEFNVSTLSSGISTAYEVLTLLSGNI
FT                   CWRPLNTTGQVLRVYYSFNKTTLDDLSGAEAADFAEGYMEALAVRPYQVDDNQTDPYST
FT                   LYLVSLLVDSETGKPLPAAAANPEPWHYRLSISQNDLGFQWDSRPWIEVIDTDYNSALL
FT                   STGNLGPASDDKGKRKYDPDLYDLYLYSVEHIDTFNGLSRSYCAVSGGPRLIRSSSSDY
FT                   TERPNSTLSNPSLKITKSLVEQVGQVREQFHITGLNSSTTYVAYLTMRVSSATTGIAGT
FT                   IFQKTVFSTMENDACSLIFGLDFCKGVAYSVPTSSLQNKDKTLMAGAYDAIASSLYANF
FT                   SLALQLIPCDESTESRYSPLRHCEDCEQSYKSWLCAVTIPRCTSRPKENYVARDSDDNR
FT                   NALINDKIKPVSNYYEILPCIDMCHQMVRDCPSSFGFSCPSRSKFPQLAHRSYQSYSNV
FT                   SEALNCNYIGNAEIIST"
FT   CDS_pept        263972..264973
FT                   /codon_start=1
FT                   /gene_family="HOG000224152" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756884"
FT                   /locus_tag="AEL196W"
FT                   /orf_name="AGOS_AEL196W"
FT                   /product="AEL196Wp"
FT                   /function="ATP binding"
FT                   /function="DNA clamp loader activity"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="DNA replication factor C complex "
FT                   /protein_id="AAS52489.1"
FT                   /db_xref="GO:0003689"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005663"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG533331"
FT                   /db_xref="HOGENOM:HBG541599"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="UniParc:UPI0000252CA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q758F8"
FT                   /transl_table=1
FT                   /translation="MSGVARNANNLPWIEKYRPDSLDDVYGQRDVVETVRKFVQEGRLP
FT                   HLLFYGPPGTGKTSTICALAKEIYGKNYRNMVLELNASDDRGIDVVRNQIKEFASTRQI
FT                   FSKGFKLIILDEADAMTSAAQNALRRIIEKYTKNTRFCILANYAHKLTPALLSRCTRFR
FT                   FQPLAEAAIERRVLSIMAHEHLQLTEDARAALLRLAAGDMRRALNVLQAAKATLDDPAQ
FT                   PVTEDVVYDCVGAPHPRDIETVVDSILRDDWATALDTVRRVRVARGLALVDMIHGAVEL
FT                   LTSYDLKQPTRIALLTHLADIEYAVSKGGSDKIQTSAAIAAIKSSMELQLQT"
FT   CDS_pept        265575..266288
FT                   /codon_start=1
FT                   /gene_family="HOG000000866" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19776714"
FT                   /locus_tag="AEL195W"
FT                   /orf_name="AGOS_AEL195W"
FT                   /product="AEL195Wp"
FT                   /function="protein kinase binding"
FT                   /biological_process="regulation of cell division "
FT                   /biological_process="regulation of cyclin-dependent protein
FT                   kinase activity"
FT                   /protein_id="AAS52490.1"
FT                   /db_xref="GO:0000079"
FT                   /db_xref="GO:0019901"
FT                   /db_xref="GO:0051302"
FT                   /db_xref="HOGENOM:HBG192607"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR012104"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="UniParc:UPI0000252CA7"
FT                   /db_xref="UniProtKB/TrEMBL:Q758F7"
FT                   /transl_table=1
FT                   /translation="MDAKALALLFRSPVTDEMLQFLTRATLRVAPCGRDAQCASPPMSG
FT                   GARRTLPSIHMFITRLVRYTNVYTATLLTTAVYLERLRLLLPRDATGIPSTAHRIFLAC
FT                   LILSAKFHNDSSPLNKHWTKYTDGLFTTQDVNLMERQLLRLFDWNVRVGHRDLCRDLAP
FT                   LLAPIKLDLTRCARMHARSPLPRRALCSPAHSLSASSSTSTLVSTGRSSALHKPRPAAA
FT                   LQAPAPLYSIPGHIL"
FT   ncRNA           266474..266565
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR40"
FT                   /product="AgSNR40"
FT   CDS_pept        266969..267253
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059089"
FT                   /locus_tag="AGOS_AEL194WA"
FT                   /product="AEL194W-Ap"
FT                   /protein_id="ADJ41769.1"
FT                   /db_xref="UniParc:UPI0001DB29E6"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGC6"
FT                   /transl_table=1
FT                   /translation="MSETNTAAAATTEPVVAKPAEATEAVATPVEKKVEEPAKKTEQAA
FT                   EAAAEPAAAAETDAAAPAAETEAPVEAKAEAKKLPFWKKLSAKLKKILN"
FT   CDS_pept        267514..268635
FT                   /codon_start=1
FT                   /gene_family="HOG000192069" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756885"
FT                   /locus_tag="AEL194W"
FT                   /orf_name="AGOS_AEL194W"
FT                   /product="AEL194Wp"
FT                   /function="binding"
FT                   /protein_id="AAS52491.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG028784"
FT                   /db_xref="HOGENOM:HBG316388"
FT                   /db_xref="InterPro:IPR007216"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniParc:UPI0000252CA8"
FT                   /db_xref="UniProtKB/TrEMBL:Q758F6"
FT                   /transl_table=1
FT                   /translation="MYSTAAAGAGPIHSVPPNQMNFPPLVSTMATQGAQQQQGVQQAQV
FT                   GAGGSSLPKNMGQGQQGMGPPHMGMVSGGMPLVGQPVMPNMPPATAGISGQQASSRALD
FT                   DPNVYHWICQLTYGPNKEQALLELGRKREQYDDLALVLWSSFGVMTALLQEIISIYPLL
FT                   SPPMLNNQLSNRVCNALVLLQCVASHPDTKTAFFQAHIPLFLFPFLNTTSRQRTFEYLR
FT                   LTSLGVIGALVKNDSVEVINFLLRTDIIPLCLRIMESSSELSTTVAIFILQKILLDDNG
FT                   LQYICATQERFYAVSQVLTNMVDQLTVQQTPGRLLKHVVRCYLRLSDNLEARRLLKQVL
FT                   PRQLKDNTFTDVLQDDLGTKRCLAQLLLTLNEE"
FT   CDS_pept        268941..271739
FT                   /codon_start=1
FT                   /gene_family="HOG000184434" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19776715"
FT                   /locus_tag="AEL193W"
FT                   /orf_name="AGOS_AEL193W"
FT                   /product="AEL193Wp"
FT                   /function="binding"
FT                   /function="structural molecule activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="COPI vesicle coat"
FT                   /protein_id="AAS52492.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030126"
FT                   /db_xref="HOGENOM:HBG022373"
FT                   /db_xref="HOGENOM:HBG631201"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013040"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR014863"
FT                   /db_xref="InterPro:IPR015873"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017106"
FT                   /db_xref="UniParc:UPI0000252CA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q758F5"
FT                   /transl_table=1
FT                   /translation="MSTHTYKSGFRVTVSNKAPEEAQAGHLPDKMTVYQDCLNEFNESP
FT                   VKPARCRMLIGKLLKLLSHGETFPANESTALFFSISKLFQHPNNSLRQAVYLALKELCR
FT                   NSEDVLMATSSVMKDVQNGTDLVKPNAIRALTRVLDASTAFSAERLYKSAVVSKDPSIS
FT                   SAALVSSYHMLPIAESTVKRYANETQEAVSDLKTYPHSAGPTDFYRVSSYISQYHALGL
FT                   LYKLKSHDKIAMMKLIQQFSANNVLRNQLAQVQMVRLVHELLRMDNQLVPQFVPQLQSW
FT                   LTSRYDAVKLEACKLISSLNSYMPSDIHTAMIHTLQGMLSVPQVCSRFAAVRLLNSISM
FT                   TAPEKVIICNPELESLINDSNRNISTYAITTLLKTGTSKNISSLIKTITKFIHEVSDDF
FT                   KVIIIDAIRTLSLKFPDEWKNILSFLIDTLKSAEGGYTFKNNIVDALFDLIQHVPQSRE
FT                   QALEHLCDFIEDCEFNEISVRIIYLLGKEGPSTEKPSLYVRHHYNRVVLENSIIRSAAV
FT                   SALSKFSSPKKDPSLAYSIEKLLKGIQTDEDDEVRDRATILVKLLEENKEKPGVADEFI
FT                   QPKHSYDLHALESKLTNYLHHNEDGFATPFDASSIPKYTEEELKAINLKQKQQQFFANA
FT                   EPSNSGKKTSGSDPKLSASATDIAAEAVQPSSIDYAEQLSSIEEFASYGAIIHSSKPIP
FT                   LTEPEAEFTVAGVKHLFQDHLVLQFNITNTLTDVALDKVTVICTPEEDAEMTELCAIPL
FT                   DRLLPGDTGSCFISYEKPTATTVGFFNNLNFTTLELDPATNAPFEGDEGFQDEYEIDAL
FT                   YLQPGDYIKSVFVGDFAATFEELPHEEVAVYNLSQSGASLQDIVNKLVLSTNCLPLENS
FT                   QFVSTESNSAVVKLFGKHITSEDRVALLVRLIKSTKGIALKVQCKSDSAELCGDLANGL
FT                   VL"
FT   tRNA            complement(271895..271966)
FT                   /gene_name="tRNA-Gly"
FT   CDS_pept        272327..273508
FT                   /codon_start=1
FT                   /gene_family="HOG000087628" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624161"
FT                   /locus_tag="AEL192W"
FT                   /orf_name="AGOS_AEL192W"
FT                   /product="AEL192Wp"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS52493.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG489518"
FT                   /db_xref="HOGENOM:HBG586249"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="UniParc:UPI000017DC9A"
FT                   /db_xref="UniProtKB/TrEMBL:Q758F4"
FT                   /transl_table=1
FT                   /translation="MPPKKQVEEKKVLLGRPGNNLKAGIVGLANVGKSTFFQAITRCPL
FT                   GNPANYPFATIDPEEARVIVPSPRFDSLCDVYKPASKVPAHLTVYDIAGLTKGASKGEG
FT                   LGNAFLSHIRSVDSIYQVVRCFDDAEIIHIEGDVDPVRDLDIINTELRLKDIEFAEKHL
FT                   EAVEKITKRGGQSLEVKQKKEEAELVKRIIELLKSGQRVANQSWSTKEVEVINSMFLLT
FT                   AKPSIYLINLSERDYIRKKNKHLLKIKEWIDKYSPGDLIIPFSVCLEERLSHMSAEEAV
FT                   EECEKIGVQSAFPKIITTMRQKLDLISFFTCGPDEVREWTIRNGTKAPQAAGVIHNDLM
FT                   NTFILAQIMKYEDVMEYKDDNAIKAAGKLLQKGKDYVVEDGDIIYFRAGAGKN"
FT   CDS_pept        complement(273618..274502)
FT                   /codon_start=1
FT                   /gene_family="HOG000258140" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756886"
FT                   /locus_tag="AGOS_AEL191C"
FT                   /product="AEL191Cp"
FT                   /function="copper ion binding"
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="cellular copper ion homeostasis "
FT                   /biological_process="copper ion transport"
FT                   /biological_process="respiratory chain complex IV assembly "
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS52494.2"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0006825"
FT                   /db_xref="GO:0006878"
FT                   /db_xref="GO:0008535"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG533755"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017276"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI0001DB29E7"
FT                   /db_xref="UniProtKB/TrEMBL:Q758F3"
FT                   /transl_table=1
FT                   /translation="MISRTRCLQAAAGIARQRAAFGGVREFSRTRLATQEAPAGPEAPG
FT                   KRRPLSRIPLGAQETHSQRVEGGAIEFTTWKAAAVLLVLGGGLFYVFSREKRRLEVQRE
FT                   AEANRGYGRPAVGGPFQLVDFNGNEFTEKNLLGRFSLVYFGFTHCPDICPAELDKLAAW
FT                   LRGLKQRGIDVQPIFVTCDPARDPPAVLKEYLAEFHPDIVGLTGSYEEVKKACKQYRVY
FT                   FSTPPNVKPGQDYLVDHSIFFYLMDPEGAFVDVLGRQYDEQTGQAKIEEHVKAYVPAAE
FT                   REKRKEKWYSFLF"
FT   CDS_pept        275085..277739
FT                   /codon_start=1
FT                   /gene_family="HOG000162144" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081023"
FT                   /locus_tag="AEL190W"
FT                   /orf_name="AGOS_AEL190W"
FT                   /product="AEL190Wp"
FT                   /function="chitin synthase activity"
FT                   /biological_process="chitin biosynthetic process "
FT                   /protein_id="AAS52495.1"
FT                   /db_xref="GO:0004100"
FT                   /db_xref="GO:0006031"
FT                   /db_xref="HOGENOM:HBG175045"
FT                   /db_xref="HOGENOM:HBG327157"
FT                   /db_xref="InterPro:IPR004834"
FT                   /db_xref="InterPro:IPR013616"
FT                   /db_xref="UniParc:UPI0000252CAB"
FT                   /db_xref="UniProtKB/TrEMBL:Q758F2"
FT                   /transl_table=1
FT                   /translation="MVANPFLSEESDRAGGPMHGERAIPPLPRSPGRLAPSRAATRYSP
FT                   QRPERGGLAERAHLAPNRYEANLSLSPSRNMHTVLDMGFEASDSDSDSERSPVAPSSHG
FT                   GRTHGGRPSMGSAYSPRKADDDGSSSVLSGATIGQTNFQLNHPQKRYIRRGKSEVRRTP
FT                   PLAKQKNILKLDNPIPRGLLDILPRRDSPEFTEMRYIACTVEPDMYVEQGYSLRMAEMD
FT                   RECQVVVCVTMYNEDKYALARTLHSIQRNISHLCRRKKSQVWGKNGWKKVQVIIVSDGR
FT                   NKINSGSLDYLSALGVYQEDMAKSTVNGEPVRAHIFELTTQVSINDQLNYKSENIVPCQ
FT                   MVFCLKEENQKKINSHRWLFNAFCRVLDPTVVMLVDVGTRLNDTAVYHLWKAFDMDSNV
FT                   AGAAGQVKTMKGKYGCKLLNPLVASQNFEYKMSNILDKPLESMFGYISVLPGALSAYRY
FT                   RALQNNEDGTGPLYSYFLGESIEGRNCNVFTANMYLAEDRILCWELVAKRDAKWVLKYV
FT                   KEAQGETDVPEEPPEFISQRRRWLNGAMFAALYAQLHFFQIWGTKHSLRRKIFFHIEFL
FT                   YQFFQMFFSWFSISNFFLTFYYLAGSMIGVLKNGKAVFTFFKYLIICDLAAIFIISMGN
FT                   SPQGANHLFIISMFLLSVCSTYALVCGITFAAKTLTAISTPSAAFSNIMVSLLSTYGLY
FT                   ILSSFLYLDPWHIFTSSIQYFLMLPSFVCTLQIFAFCNTHDVSWGTKGASQGSKPKSEA
FT                   MVTQGPDGKQIVEGTEWPQDIDNKYQEIKSRLKSDEVVEIKVDPIQKQADHYRDVRTRI
FT                   VMLWMLSNLILIMMITQIYSPEETSNNKYLVFVLGSVAGLAAFRFLGSFSFLVIKYTRM
FT                   IVKWKRKSAQIAK"
FT   CDS_pept        278326..281757
FT                   /codon_start=1
FT                   /gene_family="HOG000158449" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929700"
FT                   /locus_tag="AGOS_AEL189W"
FT                   /product="AEL189Wp"
FT                   /function="heme binding"
FT                   /function="transferase activity, transferring hexosyl
FT                   groups"
FT                   /protein_id="AAS52496.2"
FT                   /db_xref="GO:0016758"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG057742"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR004835"
FT                   /db_xref="UniParc:UPI0001DB29E8"
FT                   /db_xref="UniProtKB/TrEMBL:Q758F1"
FT                   /transl_table=1
FT                   /translation="MSDDYYMFDNESLLKSSPQDNLVQRTGSLVRPERNHMNDPSHPHH
FT                   YYARKAKETRVSVNPSSTGIMPSTDPLPSKTLNKPRPPVKPKIAKRREDDPLSLWQFYC
FT                   YAITFWAPSPLLELFGMPKKERQFAWREKVGLISVIIYCGIFVAYLTFGFTNTVCNVDR
FT                   QRLRNNEVAHQYLIIHGKAYNLDFSAHPAAAGIDAGSNVLYNPIAAGGKVASFLFQNVN
FT                   GNCKGLIIPKENCSIPHEGLDLAWYFPCKLYSQDGSTSPEFSLSEYYDGWACHTSENAR
FT                   GAYYNLQPTADVYFTWEDIKNSTRNLVVYNDDVLDLDLLNWLQTEDLEIPGAFDDLKSA
FT                   NLKGFDISVVLSNSHDKQVARCLSEIVKVGVIDSDTVGCIASEVVLYISLVFILSIVTI
FT                   KFLVSCYFHWCIARKQGASPVDNKTLAKMANDIEDWSENINSQGPIKPVQHPTGFGQSK
FT                   DFNLNMFQRNRNFRLDLSQGNLDVTADLALLEKLKGFGITTMTIQSLLKELSPESTPYN
FT                   IASPRSPSILPLNPLTDDFFSHNQNEHLDPSIIHPNVIPQPPPDYTPFGYPLIHGICFV
FT                   TCYSENEEGLRTTLDSLSTTTYPNSHKLLMVLCDGLIKGSGNSKSTPEIALDMMEDFVV
FT                   PPERVQAYSYVAVAYGTKRHNMAKVYSGFYKYDNSTVPPEKQQKVPMICIVKCGTEDEQ
FT                   ASSKPGNRGKRDSQVILMSFLQKVTFDERMTRLEFELLKNIWQITGLMSDFYEFVLMVD
FT                   ADTKVYPDSLSHMVAEIVKDPKIMGLCGETKIANKRQSWVTAIQVFEYYISHHQAKAFE
FT                   SIFGSVTCLPGCFSIYRIKCPKGEDGYWVPILCNPDIVERYSDNVTNTLHKKNLLLLGE
FT                   DRFLSSLMLKTFPKRKQIFVPKAACKTIVPDKFRVLLSQRRRWINSTVHNLIELVLIND
FT                   LCGTFCFSMQFVIAIELIGTVVLPLAICLTIYVVIFAIVSKPTPVITLILLAIILGLPG
FT                   ILIVVTATRWSYLVWMGIYLLALPIWNFVLPTYAFWKFDDFSWGDTRQVAGGDKGNHCD
FT                   GEGDFDGSLIQMKTWREYERIERLERTNKLGTTPGVGEPTSRRAFSSMDNFPAILSEQL
FT                   NGSYAQQAGPLLPPLPPLPPLPALSSQSPRPRPRAP"
FT   tRNA            complement(281872..281944)
FT                   /gene_name="tRNA-Thr"
FT   CDS_pept        282642..284135
FT                   /codon_start=1
FT                   /gene_family="HOG000239405" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20624162"
FT                   /gene_name="SHM1"
FT                   /locus_tag="AEL188W"
FT                   /product="Serine hydroxymethyltransferase, mitochondrial "
FT                   /EC_number="2.1.2.1"
FT                   /function="glycine hydroxymethyltransferase activity "
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="L-serine metabolic process "
FT                   /biological_process="glycine metabolic process "
FT                   /biological_process="one-carbon metabolic process "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="AAS52497.1"
FT                   /db_xref="EMBL:CAD27655.1"
FT                   /db_xref="GO:0004372"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006544"
FT                   /db_xref="GO:0006563"
FT                   /db_xref="GO:0006730"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG301263"
FT                   /db_xref="HOGENOM:HBG420026"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="UniParc:UPI0000252CAD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758F0"
FT                   /transl_table=1
FT                   /translation="MFIRRLHTSSRRLTCGEALRACQQTGARSANGQLMLSQHVQEFDP
FT                   EMYDILTKERSRQKRSITLIPSENFTSVAVMNLLGSEMQNKYSEGYPGQRYYGGNQYID
FT                   MAESLCQKRALELYGLDPAKWGVNVQSLSGAPANLYAYSAIMEVGDRMMGLDLPHGGHL
FT                   SHGYQLQNGNKISYISKYFQTMAYRVDPATGLVDYDTLSETSKLFRPKVIVAGTSAYAR
FT                   VLDYKRFREIADACGAYLLSDMAHVSGLVAAGVHPSPFEYSDIVTTTTHKSLRGPRGAM
FT                   IFYRKGIRKVTKKGTEIMYDLDKRINFSVFPAHQGGPHNHTISALAVALKQAATPEFKN
FT                   YQTAVVENAKVFGEELSKRGFSLVSGGTDTHLLLIDLSPMGIDGSRLETILERLNIAAN
FT                   KNTIPGDKSALYPSGLRVGTPAMTTRGFGPAEFGRVAAYINEAVKLAIGLKSQEPVDAK
FT                   DAKTRLAHFKSFCAESEQVTKLANEVADWVAQYPVPGEL"
FT   transit_peptide 282642..282722
FT                   /gene_name="SHM1"
FT                   /locus_tag="AEL188W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758F0 "
FT   mat_peptide     282723..284132
FT                   /gene_name="SHM1"
FT                   /locus_tag="AEL188W"
FT                   /product="Serine hydroxymethyltransferase, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758F0 "
FT   CDS_pept        complement(284212..284838)
FT                   /codon_start=1
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756887"
FT                   /locus_tag="AEL187C"
FT                   /orf_name="AGOS_AEL187C"
FT                   /product="AEL187Cp"
FT                   /function="GTP binding"
FT                   /biological_process="protein transport"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="AAS52498.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR015599"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI0000252CAE"
FT                   /db_xref="UniProtKB/TrEMBL:Q758E9"
FT                   /transl_table=1
FT                   /translation="MARHYCCQVKLVLLGESSVGKSSIVTRFTTGEFRKNQATIGAAFT
FT                   TRSVQWEEDAGDGSDAKEVRSVTFEIWDTAGQERYRSLAPMYYRNTDVALVVYDVTEQQ
FT                   SFQNARSWIDELNTYIGEAQRNDVVVRIVGNKIDLHAGGQLEQPLPSATFVSAKTGEGI
FT                   EELFMDIAKHVKPERFVLQAEPQESPQRSILNVLGASSADHGCRC"
FT   CDS_pept        285036..290222
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19776716"
FT                   /locus_tag="AEL186W"
FT                   /orf_name="AGOS_AEL186W"
FT                   /product="AEL186Wp"
FT                   /protein_id="AAS52499.1"
FT                   /db_xref="HOGENOM:HBG058944"
FT                   /db_xref="UniParc:UPI0000252CAF"
FT                   /db_xref="UniProtKB/TrEMBL:Q758E8"
FT                   /transl_table=1
FT                   /translation="MSRDPLGLVDLLRVWLSDRCLQAHRSHHVPSRSLFPNSPQLWDQN
FT                   SPEAVERSVKTMQLENKPSQQTNKRIKALDVLDKHISQRSTQKKLQQVPQLLPGDSHTS
FT                   SGEDEGLPGKIWRGDGRAAGRPRTSPEIRVERQNADEERPTLSASSPLKKSVVFSEEVT
FT                   SSPIRATVSSSPVRSAHNRPPSKSILKSSPSKLLAGVQGQERALHQFLNPNMASIVAVD
FT                   PFSLDYWTVGEVHTLSDQNSLAEYKRVLEGAVHLLKQPAGSSRQFEIYATLNGILPSPN
FT                   ATSVSDVDARKLSLTIENIDVLMQISYVKLKQTQENLLLSSKKDPFLSRLYVQIVRFFS
FT                   NLLATVRIVKSFERKPHVRSICQSVMDLALESLNHENTNKVMITAQLTLLREERYGEFF
FT                   LSDIQIKTFIEAVANIKGIASTNLLYEKHLLLKQYLVKYPDCMLDSVRLWFSTEVLARI
FT                   LIVHEHYNGKLLSSSISVMLELLKVSLVNRRRLEISALLNTTAVECIPQLDNKEFARSR
FT                   VQRSKTTKQLLQERIKELILENKDYRSAMDIWLCVMGLVYGDPSSLESILDEEGDSWIK
FT                   LNLLCHNSSDPAASKLAFKAWRILIYLTFVNFQLNFSQANELMKLLLRPLRLFAECDLN
FT                   NKSIIEGINYTISDILYMSFSDPSSSIRFQYLQRHIISPLFMDILPKYKCSAVIQHTEG
FT                   IFVKLLGKNDDGRQAKKLFNPMRVLSPVGITESDFSAIPFNILNCSWGDIMNLVSIMLT
FT                   FEHIDLGAIFEMFLALLLRVPDSLRTPDNCTTCVAFAKRLLLELSKEDSAVAFDAILEK
FT                   CVSFFFQAFEAILFEGLSGVTPFYDLINIEKQSPEEQLRWLKLTLDLTKHMIPDVFIVE
FT                   KFLELSNPAINSYAGNFVGSKLLSATIQPSILDSFLTIVNKVPTPEAIENVLEFCTNVL
FT                   PESIDILSKLNFLDWDDNALVYFVKKYSKRVSNGRLDPNLLERLRPHLFVNTNLFVELS
FT                   TLLVKSGERELMKELVSHHPYSISLSMLDKVDLTEALAKESVAQLLSRISELSLDEQYK
FT                   LLIHAIKTREASALVASFEHIKLLLENKPQNISVDLDIISKDIFALCCDVKEWKLMANI
FT                   SGVLIERNLVTHLLMNLEDKADIVLQYFDPVTIIAILARYSDNSTTCDAIFRKCLEDHD
FT                   PFVCFQLLRELVGTNNFKVFSANYVYLFKFIFDPKDRFCEKNREEALELFPVLTNHLML
FT                   LSQNIVSEAMEAIKSMVTLQGREYQFQLLARMVHHPQFSVKGDERLVNLIRTWKESTST
FT                   PKKRPRMFRFISPRKGDVTAIQEEITVPVSGGHAICENDIDEPRTGATLNDPQDDASSS
FT                   ADMADYPVLNNLSNPASGRDEDETEQESSDECIASQSHLNREARKLAQNNGVFPIEGVA
FT                   TDILDQTPSSPPSGLPAPNSAVENDIDNDAVKGDNSTSNEHHASINSSPDAEPAEVDSH
FT                   PMGNRGSRQNADPELAEDCPTRGNCQTDRQNICDKDAQADFEDLPDSPVPTSFDKREGG
FT                   NDIASFADKQGLASMATEKAGERVFDFVEDTHSTPVKIVHMPNQPIEPEHKGNSANKDP
FT                   GDSPLIVGATTVGQTAASEESLEEEQDPDVSVVAPLRIPIFKSNHAFYPHLGTHSDEDR
FT                   IAVKEENNTVSFESPVLHQPQPPNTGNDTSRETTPYYGKPLKAKFPSKKVRRVVSRINA
FT                   LEQDDITHMGPDEKDSLRRELLTFIMKLEGL"
FT   CDS_pept        complement(290357..291904)
FT                   /codon_start=1
FT                   /gene_family="HOG000216658" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756888"
FT                   /locus_tag="AEL185C"
FT                   /orf_name="AGOS_AEL185C"
FT                   /product="AEL185Cp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS52500.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG333050"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015729"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI0000252CB0"
FT                   /db_xref="UniProtKB/TrEMBL:Q758E7"
FT                   /transl_table=1
FT                   /translation="MESSQAECLPEIKELELGETIGQGTFAFVKTASLRADPQTIVAVK
FT                   FVHVERCKARGMTDEDLTREVVLQTRCAGHRHVVRVLDCNVSREYLWIAMELADGGDLF
FT                   DKIEPDVGVDSEVARFYYQQLVRALTHLHEACGVAHRDIKPENMLLDRAGNLKVADFGL
FT                   ATRFRRRDGTRRLARDRRGTLPYLAPEVVGERAYHADTADIWSAGVLVFVLLTGETPWS
FT                   EPSVDDGMFRAFVADGGNLSDGPWGKIGLVELNLLRKMLQQRPAARATLAQLRQHPWFK
FT                   APVVFADPDGMCADPAQLARRLLFKLRVPLSDAAYVQFTQDAPCSGPALTATQPVENEL
FT                   AHLEHDSYNSKTPIFSQCNLDRATADELQKRPATQSVRFDREVAVMQFRDEVDPTLSFD
FT                   FNPAKFTKFFTADDMASVLPQLEFALRESSIPVRAGMYDSFCELERIMGADKVFPVSID
FT                   IKARDRKGWLLSGIVCIREVADGLKVVCFERKAGDPLEWRRLFKRIALFCRHLIYIA"
FT   CDS_pept        292107..292991
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756889"
FT                   /locus_tag="AEL184W"
FT                   /orf_name="AGOS_AEL184W"
FT                   /product="AEL184Wp"
FT                   /protein_id="AAS52501.1"
FT                   /db_xref="HOGENOM:HBG058945"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="UniParc:UPI0000252CB1"
FT                   /db_xref="UniProtKB/TrEMBL:Q758E6"
FT                   /transl_table=1
FT                   /translation="MSVEQVSGAHACEEQVARFERNVEAAERRSASEDKALVIYSGGND
FT                   DEWLLRWFRPVLVESVGDKCVWLRVTAGSAGAAQVRTRYGVGGSPGVWCVRGGQVVLGL
FT                   QGQRGGAGFARRLLRSLDAQTTCELAFKLTDGGLLRHKFSAGATLALVRAWVDAHRNDG
FT                   TLPYQFYSSAQRATLTEAQERLTLTELDLVPRSALILKPVQTAAAEAVGDAHGGGLLSS
FT                   LQRAVAWLVTRSAPAAAAPTAGTASPSPASSCYASPMQSPLLKHFDCGESELSIPPTCI
FT                   APSARKFQSPDRR"
FT   CDS_pept        complement(293068..294321)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756890"
FT                   /locus_tag="AGOS_AEL183C"
FT                   /product="AEL183Cp"
FT                   /biological_process="protein transport"
FT                   /protein_id="AAS52502.2"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG058946"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI0001DB29E9"
FT                   /db_xref="UniProtKB/TrEMBL:Q758E5"
FT                   /transl_table=1
FT                   /translation="MLPESRLASLYSDFRKLQELNPDGFQANVLTWKDHLMNTVWRDEL
FT                   LIEGGDELLERLSTKETGFPKSIDVAIDQLVMDRRLVPLGRFVRGPDFGLLSWVRWTLH
FT                   KVVDLSWRSRVRENGRYLRNCAYVNMDVLAARHGAVEGALEERVVARATRYTDLVFSRE
FT                   EFYGVVRESLRGRGEYDVVLADLDKHRKAILVDGDVVKVVMPAVRALVQPFGPDRVTAN
FT                   DRHIAEFKGSLRLVERQVQAIHGHVEETARALRGAVAAGAARDVQRRYLRMNKLAQASL
FT                   SRALNQFTNLMEIKDHIDKSVDNLHLVEVLSGASRALADINRQIGSLDDVERLLDDVHE
FT                   HMEDSERISGALTASVAEDDGELDSELAAMEQELQQELQQEETLLGVLERLQVSDREPQ
FT                   ALARSASPAKLAEPPQTL"
FT   CDS_pept        294427..295854
FT                   /codon_start=1
FT                   /gene_family="HOG000112972" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756891"
FT                   /gene_name="HSM3"
FT                   /locus_tag="AEL182W"
FT                   /product="DNA mismatch repair protein HSM3 "
FT                   /biological_process="DNA repair"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS52503.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG058947"
FT                   /db_xref="UniParc:UPI0000252CB3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758E4"
FT                   /transl_table=1
FT                   /translation="MEEWRIQDRMSQLADVLEAPEEHGVGSVNGLVDMLQLDLGVMVRL
FT                   DADARPLLSAMKKVLTAGEMSGLDYSGLLSLLDTVVKLAPFETVLEVFSVEDIITALES
FT                   DDQLVRTSCKVLAVSHPKDLFSTTRIMDVLLQLYFSQRTVPVNAVEDVFQSLCTDGLIR
FT                   RRILENNYPLLREMRSTHDAILFSRYLVLMTILFRHIDRSEFQKELFVPTTEEVLDSLK
FT                   KDIFLFINVAKYYRALLEYATDPGAAGGPRDWALSYILPVLHAFGHIYENKEKYIEVHS
FT                   YARAYLFQLLRTVSYLEDMEVFRELDVKYLHISGDNPDVMHFMAIFNPMYLYRHHFDLL
FT                   TSQVTVKPSFLPVLKNIVSCQETFEILKPALTASAILIMPYSEQMVLLGQLSSYPHSTE
FT                   YLVQELPKVMSNLICNENGPISEPETIELRKKVFENLLLYSATVLNVWYEPLLDEYTNI
FT                   CSGKTSFVRTEVVDMYL"
FT   CDS_pept        complement(296010..299225)
FT                   /codon_start=1
FT                   /gene_family="HOG000163047" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929701"
FT                   /locus_tag="AGOS_AEL181C"
FT                   /product="AEL181Cp"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="AAS52504.2"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG346461"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012961"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR016438"
FT                   /db_xref="UniParc:UPI0001DB29EA"
FT                   /db_xref="UniProtKB/TrEMBL:Q758E3"
FT                   /transl_table=1
FT                   /translation="MDGDLFSVFGEEPKELPELPAEDIEQVPDEHQVETKKRGLSPSSN
FT                   TKEESQQAESTAKKVKKDKKLVDEKKKSEVVPVLADSFEKEASREVEASSGLATADAAQ
FT                   VEENGKMKLRHQVRHQVALPPNYDYKPIGQHIRTNEARTYPFTLDPFQDTAVSCIDRGE
FT                   SVLVSAHTSAGKTVVAEYAIAQSLREKQRVIYTSPIKALSNQKYRELLAEFGDVGLMTG
FT                   DITINPDAGCLVMTTEILRSMLYRGSEVMREVAWVIFDEVHYMRDKERGVVWEETIILL
FT                   PDKVRYVFLSATIPNAMEFAEWICRIHSQPCHIVYTDFRPTPLQHYLFPAHGDGIHLVV
FT                   DEKGTFREENFQKAMASISNQLGDDSNSATSKGKRGQTYKGGAAKGDAKGDIYKIVKMI
FT                   WKKKYNPVIVFSFSKRDCEELALKMSKLDFNSDEEKDALTKIFNNAISLLPEADRELPQ
FT                   IKHILPLLRRGIGIHHSGLLPILKEVIEILFQEGFLKVLFATETFSIGLNMPAKTVVFT
FT                   SVRKWDGKQFRWVSGGEYIQMSGRAGRRGLDDRGIVIMMIDEKMEPQVAKGMVKGQADR
FT                   LDSAFHLGYNMILNLMRVEGISPEFMLEHSFYQFQNITSMPVMEKKMNELSKKLEDIHV
FT                   DDESNVKDYYDIRQTLDAYNEDVRKVMTHPANVLSFLQPGRLIKINVGGKQDYGWGAVV
FT                   DFAKRINKRDPTAVYADHDSYIVNVVVNTMYKDSPLNLLKPFNPVLPEGIRPAADGEKT
FT                   TCALISITLDSIQGLGNLRIFMPSDIKADSQKEVVGKTLKEVQRRFPKGIPLLDPIKNM
FT                   KLEDEEFLKLLKKIEILESKMNSNPIANSVKLQELYEKYSEKVAMQNDIKHLKSKMNEA
FT                   QAVIQLDDLRRRKRVLRRLGFCSASDIIELKGRVACDISSGDELLLTELILNGNFNELK
FT                   PEQAAALLSCFAFQERCKEAPRLKPELAEPLKAMREVAAKIAKVIKDSKLEIVEKDYVE
FT                   SFRHELMEVVYEWCRGASFTQICKMTDVYEGSLIRMFKRLEELIKELIDVSNTIGNVTL
FT                   KEKMEAALHMIHRDIVSAGSLYL"
FT   CDS_pept        complement(299576..301528)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929702"
FT                   /locus_tag="AEL180C"
FT                   /orf_name="AGOS_AEL180C"
FT                   /product="AEL180Cp"
FT                   /protein_id="AAS52505.1"
FT                   /db_xref="HOGENOM:HBG058948"
FT                   /db_xref="UniParc:UPI0000252CB5"
FT                   /db_xref="UniProtKB/TrEMBL:Q758D2"
FT                   /transl_table=1
FT                   /translation="MSANGGAAKKMRGAVLCSSFGLLVATTGTSVAVAFTTKQCPETLY
FT                   RASLIVVTATTAVCAASHATARVKAQPKMLVPLATIPCVGMVGAAMWYVMQLAWHRTAV
FT                   LDSTAMGVGGLIVTHLALLIASVFCSGFAAGIVMLAGAPTEETPECEGHALGKRNAAPY
FT                   GNNRQPLDSTAAEVSQRSMSTLIPEVDDIWEYSSKNWMNDYDTNYPICEKGATPDIPRP
FT                   VFRPACATRRYRSISGSSIVQKSSAGPHGTACSKKGIFDLLQNKILKKVSPAHMDDLPR
FT                   HEEQYLEARYVTRLSNGCDVSSSALKAPDYLVSPTFPTASAGRLILMNTHDDDNQDISD
FT                   NSIMANSLRKDHRRANYSASILIPPQTLSESSLQVTVGPKERPHSALTQGIDVTHTDRS
FT                   EDAKTLIASNTNGSGSADGDRDRDFSGNSGCQQHSPTNLLPPFGSPGAASNSVLDPVGP
FT                   KLASRGCAHGNLVINHMRTLNMENTSTLDIAEEAIRHQGSDDSLLQGLTRGNTPREVAA
FT                   ISAQHKSAAASSTSSAGRAFARSGHADLPLHMWSPSQRSAPLISHGSRTQSVSSSPIRA
FT                   HALTQKLGHSLSKSLLNIRWDQRESIERLAPPRGQLADLRYVHHLQGKYSPSRSTNTCS
FT                   SAERKHFLTVKSAFN"
FT   CDS_pept        302174..303043
FT                   /codon_start=1
FT                   /gene_family="HOG000141793" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081024"
FT                   /locus_tag="AEL179W"
FT                   /orf_name="AGOS_AEL179W"
FT                   /product="AEL179Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS52506.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG104444"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI0000252CB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q758D1"
FT                   /transl_table=1
FT                   /translation="MELRVWKLWRRWERRQEVGRGTTCYVEVWQRKGVTCAVKRVRGDD
FT                   PSEHHNREVRAMLTKEYNILRSLHSVHVVAVVEQRLSKGWILLEYVPFCVQKVMRMDLA
FT                   PGAEERRCLLGQLVEGVAYLHSSGVVHRDLKLDNMMLAPDCHTLKLIDFGHAVKLQAGK
FT                   TKCYGIGGTEPLIAPEALNQLSYEGYPVDMWSIGIIMYMLFNDIADLRYPWRIARSSDE
FT                   AFLAYEEEGLLHISTEEHLCRRFLTPDPALRITAAEAVEIPFLQYNCDGHVHERTRRLC
FT                   QKFWGTYM"
FT   CDS_pept        complement(303110..304033)
FT                   /codon_start=1
FT                   /gene_family="HOG000191799" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929703"
FT                   /locus_tag="AEL178C"
FT                   /orf_name="AGOS_AEL178C"
FT                   /product="AEL178Cp"
FT                   /biological_process="vacuolar transport"
FT                   /cellular_component="retromer complex"
FT                   /protein_id="AAS52507.1"
FT                   /db_xref="GO:0007034"
FT                   /db_xref="GO:0030904"
FT                   /db_xref="HOGENOM:HBG020982"
FT                   /db_xref="HOGENOM:HBG525567"
FT                   /db_xref="InterPro:IPR005377"
FT                   /db_xref="UniParc:UPI0000252CB7"
FT                   /db_xref="UniProtKB/TrEMBL:Q758D0"
FT                   /transl_table=1
FT                   /translation="MFFKSPIDIEILFDGQESRKQVEIPSVSSTSKTLKDRYPLYEDGE
FT                   SVSGLVTLRVREGRKVEHLGIRVSLVGSVDTTKSSSEAKKRAIDTFLSLSADICPPGEL
FT                   VHSQSFPFNFKDVEKRYESYRGKNIDVMFYVKVVVLRKSTDIVKLKKFWCYLYNTIPPV
FT                   LAAGAADENKPVKLDIGIENCLHIEFEYSKSQYALKDVIVGRIYFLLTRLKVKHMEISL
FT                   IKRETCGHEPNQLSDTTSIRYEIMDGSPVKGETIPIRLFLGGYDLTPNITSNYFSVKNY
FT                   LSLVIIDEDGRRYFKQTEIILYRTLS"
FT   CDS_pept        complement(304264..305682)
FT                   /codon_start=1
FT                   /gene_family="HOG000248043" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18929704"
FT                   /gene_name="TIM54"
FT                   /locus_tag="AEL177C"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit TIM54"
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS52508.2"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058949"
FT                   /db_xref="HOGENOM:HBG397749"
FT                   /db_xref="InterPro:IPR021056"
FT                   /db_xref="UniParc:UPI0001DB2A09"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758C9"
FT                   /transl_table=1
FT                   /translation="MMGEFKHPPQEKQKMSSTKKAGYSNPAFAAMGIPALRLPGPKWCA
FT                   FWLVVGAGIAGVVYDKREQRRICKHYSSLVKDQGAAHMDTWLKPRRLTVFVAPPPGDYL
FT                   ETSMKVWRRYVKQVLFEAGLDYEVFTEERQGVIRHEVAERVRQLRRDIAAAEAAEQRAL
FT                   DEKRWLNRMRSWWRREKLSEEELERIRAQKFRDEFTYKQLLGVFYKNAPLREQKVWDAD
FT                   ALVEDPVLAGGVICIGRGAYKEYIAGIHEGTLGPLDPPTLTPEAPTELSAAAEDLTQAP
FT                   EQPEPSAAAEALKQAPEQAEHSPAEPDSAATDAPDEKSNNAPAPPPAPYVSPDEYSSLS
FT                   LSQELVGDVRHPSSHIPALFHQPLLVIPVPNLSGFLQTPRKIYRFYTRRYYAEECCKAA
FT                   AAMVLQTIRPFQPDDLNLGISEEEDWPRRWVEQGRERKSEWVQDLKADPRVIAELHVVD
FT                   PALMADLAATMNLN"
FT   CDS_pept        complement(306792..307727)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756892"
FT                   /locus_tag="AEL176C"
FT                   /orf_name="AGOS_AEL176C"
FT                   /product="AEL176Cp"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52509.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG058950"
FT                   /db_xref="HSSP:1A5J"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI0000252CB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q758C8"
FT                   /transl_table=1
FT                   /translation="MPNQKRGPWTCEEDKLLLKLIDQHGAFNWVKISALLKSRSPKQCR
FT                   ERYHQNLKPSLNKTPISEQEGELIQELVAKIGKKWAEISRVLNNGRSDNAIKNWWNGGT
FT                   NKRKRARKSIAARQIIQNYHMHSLQSYVQTREQAVYVPAAATPPQQQGKFAEQQALPPL
FT                   TALTPNMSRRNSLEVVPQNVGFKDAKRQFMLYSPEDSSQASRCAISEGPAASFVPRLPA
FT                   LAHRAVPLSVAVTPASPQGCHNAMPGTGPGLAEHQLAIHSPPGSRETLYDTHDRSALCK
FT                   LDFLLNKDEANKAAQVEFTAAPAASGADHK"
FT   CDS_pept        complement(308933..309640)
FT                   /codon_start=1
FT                   /gene_family="HOG000156894" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624163"
FT                   /locus_tag="AEL175C"
FT                   /orf_name="AGOS_AEL175C"
FT                   /product="AEL175Cp"
FT                   /protein_id="AAS52510.1"
FT                   /db_xref="HOGENOM:HBG388166"
FT                   /db_xref="HOGENOM:HBG437583"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="UniParc:UPI0000252CBA"
FT                   /db_xref="UniProtKB/TrEMBL:Q758C7"
FT                   /transl_table=1
FT                   /translation="MSSELEGTTPKDARADGFKLAVCVYCGSSFGNSAKYADAARSLGE
FT                   LFHQLQWKLVYGGGTTGLMGTVARATMGPDCDGYVHGIIPNALVAKERDDKADHNALLH
FT                   ASVDNHTGVTPISEEYGATTIVPDMHTRKAMMARESDAFVALPGGYGTLEEVMECITWS
FT                   QLGIHQKPIILFNIDGFYDSLLAFVDRAIADGFISRKNGDILEVATSPEEVVRKIENYH
FT                   VPDGRFNLRWADM"
FT   CDS_pept        310175..312160
FT                   /codon_start=1
FT                   /gene_family="HOG000141792" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624164"
FT                   /locus_tag="AGOS_AEL174W"
FT                   /product="AEL174Wp"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS52511.2"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058951"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001DB2A0A"
FT                   /db_xref="UniProtKB/TrEMBL:Q758C6"
FT                   /transl_table=1
FT                   /translation="MVGDIQLQETQQGVVHGHIHNYNNLTYIHGHVHNSSRGGDGEERP
FT                   QAEPEGGVMTAVQATRREIDCSKYQDCQHFEFVNYHNLNLFQELQGEAAGVPAPGSRGW
FT                   QDDLLLPQQGAKRSKGTCTQCSPKIMEICCEQQHVAGGEGPSEIAVFHGCPTGERGGED
FT                   RSGAVVNLPKFINCDFTCPSGTAMSHIDSSSSTLTVETSAADSPTLEDGSFDWLCQQCV
FT                   NYDSCEDTAGHEQQHCHDHVVNSETDIKILNDLVSISSMYEAPLCKNADQSINLLHSSI
FT                   SGIADTGAAVGSNSPTPTAQVIPQGRAHHHHHHHHHHHHRIELHPHKSLEDAITKGQER
FT                   FTSNERDPVPEQLPAEQRRCLSINGTNTINFNWNFKSNDRALRCLWDDCSAIHPNLLDL
FT                   QSHMLKDHISGSAADADFPCRWKDCDFLSADTDSLINHVNGTHGIGFDIQFLDDKALQL
FT                   QNCNHCETHCSSNAIEPSADGTFRCLWGSCTDCFSSRQALNDHIVSSHVPSGRSAYQCN
FT                   WAGCTKHFTQRQKLLRHIKVHTGHKPCSCPHCPKTFSTDDILAQHIRTHSGERPFHCHY
FT                   CRKQFSTSSSLRVHIRTHTGEKPLSCTVCGKRFNESSNLSKHMKIHERKYMCKLCKRSF
FT                   DRLPQYNSHVAKCARLRLAKPSIERL"
FT   CDS_pept        312486..314081
FT                   /codon_start=1
FT                   /gene_family="HOG000113025" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19776717"
FT                   /locus_tag="AEL173W"
FT                   /orf_name="AGOS_AEL173W"
FT                   /product="AEL173Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS52512.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058952"
FT                   /db_xref="HOGENOM:HBG202197"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000252CBC"
FT                   /db_xref="UniProtKB/TrEMBL:Q758C5"
FT                   /transl_table=1
FT                   /translation="MVSRNREMSLVLYNRNNQNDTSIVVHDARTRSLVLFHEAAGRLSL
FT                   AASDSASYEGGRCPHCGHLLGLQSYFIHDQYFQLLEDLPRPGTVEAPDTFIPQNLFTQG
FT                   YYQNFFQELEVLGNGARGAVYKVEHTFLEHSLGVYALKKIAIGDDMAWLNKCIQEVKFM
FT                   NSITQDCLHLVKYNHVWLERTSSVGHVTAQAGANKTTTATDDVPYMFILQQFCPGGNLE
FT                   GVINTKVFQRLTGSESTEERKRLFRMRRRGLTGTRKGLSTRQVLSVASDLAHGLRELHS
FT                   LDIIHRDLKPSNCLLLGEYDPSSTENFPKILIGDFGESQLRGQLRTATGATGTLEFTAP
FT                   ELVLFEDDVRVKAMTSSAPQFTFESDMYSLGMILYFVVFGELPFGPGGDMRLLKTQIKK
FT                   YSCSASALQQRHSGYFLKPIDPRIFELISSLLSPSAADRPDADEAIAIINDILASCNSA
FT                   DAHVPAKGLVMHREAAMNLAVRSAQLAVSLAYMRWHYASPWNNLNLFLLGFSFNCSSST
FT                   RPYLLAITLALFLM"
FT   CDS_pept        314143..315762
FT                   /codon_start=1
FT                   /gene_family="HOG000095231" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756893"
FT                   /locus_tag="AEL172W"
FT                   /orf_name="AGOS_AEL172W"
FT                   /product="AEL172Wp"
FT                   /protein_id="AAS52513.1"
FT                   /db_xref="HOGENOM:HBG058953"
FT                   /db_xref="HOGENOM:HBG204224"
FT                   /db_xref="InterPro:IPR013745"
FT                   /db_xref="UniParc:UPI0000252CBD"
FT                   /db_xref="UniProtKB/TrEMBL:Q758C4"
FT                   /transl_table=1
FT                   /translation="MLPPSLFPVPEQAQCDQRACVSFYQRITRCLSIQGLMGKSEQKLE
FT                   VHSRMDYRRKVSAPEAVTYGASTESIREFSTSSDLLPQNGPVTQGLSTSAEKAKPERTP
FT                   SSNYSSVLPSLSRVGFQSIFQNNETRRSRQSVLSESFNGAQISQNDDRLAGSYNYNQLL
FT                   EQSERGTGSYGKCSSSLSLELHVPKTRMPHGSNSSQQNGLSRGKNSLKQAAIKLFRVRS
FT                   TSSKYQDVDVQPTPWMKFLHSQHGKHQKAAYVTSNVVESNKSVYSQGQSQPSNLSDKSV
FT                   RLFHEVNFDNNDVQLLHDLIKNMPSFESNFHQFTIHEQDALLSNIWGVYCNLILSVFKN
FT                   HRLWQLPAKIEDINRVLKFYIKLKQDGKTACTGSKFLNEIEQCLRASFYVLETQVLYDH
FT                   AEGIEMQSALKRLCAVWELFYQHAYGDSMAVLAPLDSNFQRYPQYWCATQDSGHLTLAQ
FT                   LLFQMFRDAIVVPYYQTFMNDGDNIAASFQKHFTDEDEKNCVTQTEKLLLLQCFGLLSS
FT                   LNSRDVNQQIVQGLLAGVRMSI"
FT   CDS_pept        complement(315831..317069)
FT                   /codon_start=1
FT                   /gene_family="HOG000164765" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756894"
FT                   /gene_name="BTN1"
FT                   /locus_tag="AEL171C"
FT                   /product="Protein BTN1"
FT                   /biological_process="amino acid transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="AAS52514.1"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="GO:0006865"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG020954"
FT                   /db_xref="HOGENOM:HBG330840"
FT                   /db_xref="InterPro:IPR003492"
FT                   /db_xref="InterPro:IPR018460"
FT                   /db_xref="UniParc:UPI0000252CBE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758C3"
FT                   /transl_table=1
FT                   /translation="MDRRKLIFGKFWLFGLLNNVLYVVILAAAVDIVGPTLPKSLILLA
FT                   DILPSFLVKLVAPFFIDRVEYHYRIWSLIALSGFGMLLVASGRLGVCIVGIVLASISSG
FT                   VGEITFLQLTHYFSHVALNGWSSGTGGAGLAGSFLYMLLTSILKIPVSRSLLLFSILPI
FT                   GFLLYFTLQVERTAYEPLASGHFMEAEDNSGSVISLEAPRTTVDNARDCASRPRLAALR
FT                   ERIEVTMRRLKVLVVPYMIPLSTVYLFEYLINQGVSPTLMFPIHEGYGTSQLFHKYRDI
FT                   YVAYGTLYQLGVFISRSSGSWVRIRGLYLLSVLQFLNLVILLIQSWYYVIHSVWVIMAI
FT                   VLYEGLLGGASYVNSFLNISEDVPLAEREFSLGAVSISDSSGTLVAAFIGILLEPVLCS
FT                   HQVKTGRPWCQLE"
FT   mat_peptide     complement(315834..316982)
FT                   /gene_name="BTN1"
FT                   /locus_tag="AEL171C"
FT                   /product="Protein BTN1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758C3 "
FT   sig_peptide     complement(316983..317069)
FT                   /gene_name="BTN1"
FT                   /locus_tag="AEL171C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758C3 "
FT   CDS_pept        complement(317257..318633)
FT                   /codon_start=1
FT                   /gene_family="HOG000223045" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18929705"
FT                   /locus_tag="AEL170C"
FT                   /orf_name="AGOS_AEL170C"
FT                   /product="AEL170Cp"
FT                   /function="1-aminocyclopropane-1-carboxylate synthase
FT                   activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transferase activity, transferring nitrogenous
FT                   groups"
FT                   /protein_id="AAS52515.1"
FT                   /db_xref="GO:0016769"
FT                   /db_xref="GO:0016847"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG502043"
FT                   /db_xref="HOGENOM:HBG645860"
FT                   /db_xref="InterPro:IPR001176"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0000252CBF"
FT                   /db_xref="UniProtKB/TrEMBL:Q758C2"
FT                   /transl_table=1
FT                   /translation="MNISEAGRLLGHSRLRHIPGRRYNSMGKIRGNNYFAETTRDVWTI
FT                   INEAAAKAAAESVANGGSGAGKGMKVLNLGQGFFSYSPPDFAIAGAQRALENAMNNQYA
FT                   PTRGRPALVEALLKLYRPMYGDLAAENVQVTTGANEGIFACLAGLVNPGDEVIVFEPFF
FT                   DQYIPNIELLGGVVRYVPIRPPAELSKRVTEGTEWVIDYDMLRQTINEKTKAVIINSPH
FT                   NPIGKVFTREELLKLGNICVEKGIYIISDEVYEHLYFTDEFTRIATLSEEISQHTLTVG
FT                   SAGKSFAATGWRIGWVISRNKELLALASKAHVRICFSSPAPLQEACAVAIEHALKTTYY
FT                   ADTRAAYQKKYERFQKPFDDLGLPYTRAEGSYFLLVDFSRLPLPADYHFPEELADKGRD
FT                   FRVAYWLINELGLVAIPCSSFFIPDHREASENMLRFAICKDDTYLDEAIERLMVLKNYL
FT                   "
FT   CDS_pept        318914..319312
FT                   /codon_start=1
FT                   /gene_family="HOG000164754" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756895"
FT                   /locus_tag="AEL169W"
FT                   /orf_name="AGOS_AEL169W"
FT                   /product="AEL169Wp"
FT                   /protein_id="AAS52516.1"
FT                   /db_xref="HOGENOM:HBG052025"
FT                   /db_xref="HOGENOM:HBG738918"
FT                   /db_xref="InterPro:IPR012875"
FT                   /db_xref="UniParc:UPI0000252CC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q758C1"
FT                   /transl_table=1
FT                   /translation="MFRSVLRHSYAVPTVNYTWSSRSLIRFFTSDEKAAPPSLPREEQK
FT                   EFERLQKIAQSQAAIDEYNRQFENDHTKESANSPILKTEIGSFSPEFSKTLPEFEGDKN
FT                   PETGEIGGPRQDPLRYGDYSYNGRVTDF"
FT   CDS_pept        complement(319346..321367)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081025"
FT                   /locus_tag="AGOS_AEL168C"
FT                   /product="AEL168Cp"
FT                   /protein_id="AAS52517.2"
FT                   /db_xref="HOGENOM:HBG123621"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019321"
FT                   /db_xref="UniParc:UPI0001DB2A0B"
FT                   /db_xref="UniProtKB/TrEMBL:Q758C0"
FT                   /transl_table=1
FT                   /translation="MTGELHPIFNADALGASHRLHAHTHGDGTKIVAYYNKHLRLGRFT
FT                   EQTYKSWHAEVDAKASSILNGSGSLLAFYGDHIIEVVDREGKKITLTVNGGIKQVLWHP
FT                   LAYLDSCLVVLTGQETIEIYELNEPRYEKPTLVLNEPTSQLGISSRVIDITNIAFAPDG
FT                   LSLYLFSTSEGGDVHVICPLLPSRIKADRAKWARQWNKATALYSTLTKDTPDDAKVATI
FT                   EYLEFVTQLLQAIEKNGSDGELVIPEHRRRTISQGPYNIHGFPEKLYSAVGTKLTVVPL
FT                   GESEAHLLLLSFDDSTNILLFPSTEVLMSWTKDLKNAYTLMLVEEFTATGTAFATCDGV
FT                   AVLGIDSAQRVEIPYLQALEDCIRDCNLAALQDINFTSSICKIPGKFHSVARFNAPGNK
FT                   GIILVGDHHAKIVPSTEAAKSDTETELDSQPGKEPTYTVCFPNSLEEILNTNKELQRRK
FT                   HQPLPLVPPALKNIPLNSDLNEQHLATLTNISKEVMDRIILSQSAGLLMHNRLSLQQYE
FT                   LHRQVETVADICSRHSVLRDSSEAMSSRLTSVLKRDRRLKQRLCMLQSTLNRINSSHKF
FT                   SDLPLSKKEADWFRELKNQAISFNDYVLQSAQLRDELAFLKNELESLPEHRQHDRQEEE
FT                   PFDFRRLQELLKLDSKIITECTDNLSAAARELERKLCI"
FT   CDS_pept        complement(321588..321893)
FT                   /codon_start=1
FT                   /gene_family="HOG000246609" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756896"
FT                   /locus_tag="AEL167C"
FT                   /orf_name="AGOS_AEL167C"
FT                   /product="AEL167Cp"
FT                   /protein_id="AAS52518.1"
FT                   /db_xref="HOGENOM:HBG189617"
FT                   /db_xref="HOGENOM:HBG395988"
FT                   /db_xref="InterPro:IPR013870"
FT                   /db_xref="UniParc:UPI0000252CC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q758B9"
FT                   /transl_table=1
FT                   /translation="MLSLRSSFRRLFSVSCRVYDQQAQKAVSSCPAGTPLNLLIKKGGK
FT                   EPLALEDSDYPEWLWKVLDPEAQAAKLAEDPIKARKKALRRMNREHIKQQNFLAKM"
FT   CDS_pept        complement(322078..324498)
FT                   /codon_start=1
FT                   /gene_family="HOG000200459" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756897"
FT                   /gene_name="LAS21"
FT                   /gene_synonym="GPI7"
FT                   /locus_tag="AEL166C"
FT                   /product="GPI ethanolamine phosphate transferase 2 "
FT                   /EC_number="2.-.-.-"
FT                   /function="transferase activity"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS52519.2"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG114816"
FT                   /db_xref="HOGENOM:HBG328034"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniParc:UPI0001DB2A0C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758B8"
FT                   /transl_table=1
FT                   /translation="MRFKEVGLLFCQLLAVLIFAAGFFPQKKVLKGDAQFQYMAETQRA
FT                   LEPAFDKLVLVVIDALRADFLFQQNVSHFDFVHELLNRGEAWGFTAYSNPPTVTLPRLK
FT                   GITTGSAPNFLDAILNVAEDDSSSNLKDQDSWISQFAKHGKKIHFFGDDTWLKLFPEEF
FT                   FQKHDGTNSFFVSDFEEVDTNVTRHLPHELQHKDWDVLILHYLGLDHIGHKGGAASQFM
FT                   PPKHREMDAVIRQIYDQVDNRTLLCVMGDHGMNDLGNHGGSSAGETSAGMVFISKMLSS
FT                   YPRPAAQDGVSSPVTAAEDYQFFTRIQQVDFVPTIASLFNIPIPKNSLGVFVREFSSLL
FT                   GQHATTKIIENYHQLMQLAAKKTAARGNDDIDSMLAEMKDVQATLARTATNYNYAMLFL
FT                   GVGMLSIVTAATAYCYISSARLNEASVLMIAVTALLGSSVFGSSFVEEEHQIWWWIIIA
FT                   VVGYSWATRPSCTPSHLVFLVCARLLRGWNNSGQKFMYDFTVAELLKSHPSIKWLLVCA
FT                   TLAVVALDGFTERPLLSIFNLLAGLLCFVYKTCWANVNGEVSPTYAQTLVTKACSLLFA
FT                   GGTPWDDKQLLVPLARLFFKVTAAIVCMRIAYNVVFAKRKFLSELFPLFTIVLIMQTAS
FT                   QNIPLFLVFTIMRSSLRNILRVGYPQQRCEMFFVLSLILQNLSFFQFGGTNSIATIDLT
FT                   NSYNGISENYNIYVVGLLMCIGNMAPAIYWSLAAVVDHQLYSKKSYAQQKLSSMFFYSV
FT                   NSLLLLVACICMRYHLFIWSVFSPKLCYLLGWNILIHFLTETVLEPFLLMVAG"
FT   CDS_pept        complement(324648..325796)
FT                   /codon_start=1
FT                   /gene_family="HOG000183078" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756898"
FT                   /locus_tag="AEL165C"
FT                   /orf_name="AGOS_AEL165C"
FT                   /product="AEL165Cp"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS52520.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG202432"
FT                   /db_xref="HOGENOM:HBG738425"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000252CC4"
FT                   /db_xref="UniProtKB/TrEMBL:Q758B7"
FT                   /transl_table=1
FT                   /translation="MSSYTCNSCALAFQSSEDQRMHMKSDWHRYNLKRRVAQLTPIDEN
FT                   TFKEKVAALATEEQQPPSSKELRRRQREALLEKKKKLLEMARQSMLQNMGDELKVNIES
FT                   LVADKLGVAAAPADQEAAPAEVPALSAEEQHEQLMAEKIKNKVEIPPEACLFCPKRTHA
FT                   SFEENLEHMQKKHGFYIPEQKYLVDKPGLVKYLSEKIGLGNLCLCCSFQGRSLEAVRAH
FT                   MLAKSHCRIPYESEDEKLEISEFYDFSSTYAELDAAANADEGEWEDVESDADSESGDEE
FT                   LPQELIYHDGVELHLPTGVKVGHRTLQRYYRQNLKPERELTEGQGTVIAAETRHFATIL
FT                   DAKQVATQKKVWQTEVKDKKRDSKRAAKFINNQPYYRDQLLQ"
FT   CDS_pept        complement(326059..326982)
FT                   /codon_start=1
FT                   /gene_family="HOG000248715" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756899"
FT                   /gene_name="TSC10"
FT                   /locus_tag="AEL164C"
FT                   /product="3-ketodihydrosphingosine reductase TSC10 "
FT                   /EC_number="1.1.1.102"
FT                   /function="3-dehydrosphinganine reductase activity "
FT                   /function="binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS52521.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0047560"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG058955"
FT                   /db_xref="HOGENOM:HBG398139"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000252CC5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758B6"
FT                   /transl_table=1
FT                   /translation="MKYELNGQVVLISGGSQGLGRAFAQKYIEESDSTVVIVSRSEEKL
FT                   TRAGEAICGGARRLGAGGAGRLLYYACNLGDAAAVGGLFATLADAGLQVTQVLFCAGGA
FT                   VPGLFAELSSAQLAAGVEMNYGTALHLAHGAVRHGARHLVFFSSAAAVYPFIGYSQYAP
FT                   LKAALRALVAVLRQECDGVRVSCVYPGNFASEGYAEENRTKPAITAAIEGSSEAISCAA
FT                   CCDKIVRGLRSGYDDVTTDFVGWLLLACNMGFNYHSTTYFLWPLGWLLGALVNLLVVPI
FT                   YMLLCRWDIHKWRTQREETHLAAKTD"
FT   CDS_pept        complement(327149..327418)
FT                   /codon_start=1
FT                   /gene_family="HOG000248474" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756900"
FT                   /locus_tag="AEL163C"
FT                   /orf_name="AGOS_AEL163C"
FT                   /product="AEL163Cp"
FT                   /protein_id="AAS52522.1"
FT                   /db_xref="HOGENOM:HBG058956"
FT                   /db_xref="HOGENOM:HBG397676"
FT                   /db_xref="UniParc:UPI0000252CC6"
FT                   /db_xref="UniProtKB/TrEMBL:Q758B5"
FT                   /transl_table=1
FT                   /translation="MLEPSRYQDPRTWKMTPAMIRARRPYIRGNLFGLVTLLGVAGGIY
FT                   VYTYRALHKDDDFADVPIPPVSEEELRQLRQEYELHKKQRAAER"
FT   CDS_pept        327583..328293
FT                   /codon_start=1
FT                   /gene_family="HOG000141790" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756901"
FT                   /locus_tag="AEL162W"
FT                   /orf_name="AGOS_AEL162W"
FT                   /product="AEL162Wp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS52523.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG058957"
FT                   /db_xref="HOGENOM:HBG202194"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="UniParc:UPI0000252CC7"
FT                   /db_xref="UniProtKB/TrEMBL:Q758B4"
FT                   /transl_table=1
FT                   /translation="MTAGLVRRLSRSKPHRDSLLRNLASQLFLHGSITSTKPKLKEAQR
FT                   YAERIITIAKHAAKKPAIFTPELQSRLHLSGDTAGLVRKLVEEVGPRYAGRAGGCTRLL
FT                   QLEPRLGDRAPAAVLELVDQPLRGPDGELQRGNLKLWLTVKAAMYAAEQGAAPSPLTVR
FT                   NLVKLAHGKELEQFLADVADVRRLLLEHQGAADSPEEAERFVGGLRSALEAPAAAPAPP
FT                   ARKRYEFAPRPARN"
FT   CDS_pept        328508..329578
FT                   /codon_start=1
FT                   /gene_family="HOG000217393" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756902"
FT                   /locus_tag="AEL161W"
FT                   /orf_name="AGOS_AEL161W"
FT                   /product="AEL161Wp"
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cysteine biosynthetic process from
FT                   serine"
FT                   /protein_id="AAS52524.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006535"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG370933"
FT                   /db_xref="HOGENOM:HBG748215"
FT                   /db_xref="HSSP:1O58"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniParc:UPI000018618A"
FT                   /db_xref="UniProtKB/TrEMBL:Q758B3"
FT                   /transl_table=1
FT                   /translation="MHAQLIRKMSAPTLAAGGFPDAIGKTPLIKLQKLSQELGRNIYGK
FT                   AEFMNPGGSVKDRAALYLVEEAERAGLIDPSRPGTIVEGSAGNTAIGLAHIARSRGYNA
FT                   VFYMPDTQSREKVNLLRYLGTEVHPVPVCPSTDPLNFNNRARDHAAALDNAVWTNQFDN
FT                   EANWKAHYATTGPEILQQMRNAGLEVDAFTCSTGTGGTFSGIARYLAEATERKCKLVVT
FT                   DPPGSVVYSFVKTGNLEREGSSFTEGVGQGRITKNLEASVDIIDDAVFVPDPESLNMTY
FT                   RLLDEEGLFLGGTSGLNVAGAVRVARELPPGSNVVTILCDTGHKYADRVFSKKWLQEKK
FT                   LYDEIPDSLKKYVTLE"
FT   CDS_pept        complement(329648..332029)
FT                   /codon_start=1
FT                   /gene_family="HOG000115673" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756903"
FT                   /locus_tag="AEL160C"
FT                   /orf_name="AGOS_AEL160C"
FT                   /product="AEL160Cp"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /function="protein tyrosine/serine/threonine phosphatase
FT                   activity"
FT                   /biological_process="protein dephosphorylation "
FT                   /protein_id="AAS52525.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008138"
FT                   /db_xref="HOGENOM:HBG058958"
FT                   /db_xref="HOGENOM:HBG204228"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="UniParc:UPI0000252CC8"
FT                   /db_xref="UniProtKB/TrEMBL:Q758B2"
FT                   /transl_table=1
FT                   /translation="MITSVRKQQKRQKSREQLGELESKKMEGEGVWGSGTIRAGRLAEL
FT                   AERQAQAALPASERMFPWLHGYVQDSAPRADKFALSVVRSQPLDAATIENSGILRASMD
FT                   LHEVLLTVDNTEAERAVDAALEEYGAGVCTARRAELLAACQRYQLLPFLQTDALKQCRY
FT                   GSRRLRLGDKGSWRQPGMFRRFDLQPARHVELSSVVVVYCLANMHPDRCCCHDAATILQ
FT                   WACRFVALNYPERAHLAPEVLILEDPGHVPASLVGTAPMALSSLQKPFPAQLVSRFDVA
FT                   SFNNWERDLLYKERLEISKMSSMSMIEDCVMCGNATDFEVLRLFRSNGAACPSTAAPRK
FT                   YYSPDNTIVLLKALEYQEKDGVPVLDSVLFNLPPSELHDVQLFVSCTEHTPFPHHDDIR
FT                   HHLTQMEAPIHIAFPSSGSIGLGTLTLDSITSCVNICHLIYRFSAVHKKLSLLYCSDGY
FT                   TETSFLLVAYLIFAWDQPLDEVLLRLHTEVERPYFLFPIDIQVLGHLQLLLRDMSPLRH
FT                   PNRGPELLAVDPDLFSRMFFTKPSQDSLFLKSKGPLPSRILPHLYLGSLEHAHDPNLLR
FT                   RLGIRNIVSVGETLSWLQSPHSREAAKTEESKQETITDAYVTAPAETAAATSTTASTGS
FT                   LNLLKRNRSPSAPEIKPLKSSSCKTTVFSKDGFEICHTSNLGDNGADPMLTQLDQMLSF
FT                   INRCYEAGEKVLVHCMVGVSRSATVCIAECMRRLNCAVIQAYLFVRVRRLNIIIQPNLM
FT                   FIYELLKWQELKHPDVLKIDWHIMCRAINELNSNYIKDMI"
FT   CDS_pept        332422..332973
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756904"
FT                   /locus_tag="AEL159W"
FT                   /orf_name="AGOS_AEL159W"
FT                   /product="AEL159Wp"
FT                   /function="sequence-specific DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52526.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG058959"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI0000252CC9"
FT                   /db_xref="UniProtKB/TrEMBL:Q758B1"
FT                   /transl_table=1
FT                   /translation="MMEDKGKAAMPRLPISKCKRIAKTDPDYIMTTQAAYIATAFATEL
FT                   FVQAISEDAMAQAQLDGRRAGGRAARLTYNDLARSVAREERYAFLADVIPETKTLAHLV
FT                   RQNKVRYSAPLAQGQATLPFARRAVEGGESDAASEDEDVEEGELQKDLAEVAKMNQIVD
FT                   LDAESSAGEADGDENEPEDD"
FT   CDS_pept        333130..334077
FT                   /codon_start=1
FT                   /gene_family="HOG000141789" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929706"
FT                   /locus_tag="AGOS_AEL158W"
FT                   /product="AEL158Wp"
FT                   /protein_id="AAS52527.2"
FT                   /db_xref="HOGENOM:HBG123623"
FT                   /db_xref="UniParc:UPI0001DB2A0D"
FT                   /db_xref="UniProtKB/TrEMBL:Q758B0"
FT                   /transl_table=1
FT                   /translation="MGLFNGDNNDDEVKKFNADALDSRLSRQLSQLDGVVSELWRDAVL
FT                   EPSSFVDNVVSHAMGKLPSDRLVDDLWLNATDALGGLLTGVGLPGGLGHPFKVREMLDE
FT                   RHGEKGLYSYKMPTDSQFMKCQEVRGLSVWDTRGWWRCLFPKAVVEKSLPAGQEAGVLT
FT                   REQVEQDREHRHGLFFPEYTGYLSWRSHMLSLARQRREQEEKNRAARERKALPAVGTNA
FT                   PEDVMSWTQQVAERTPASAANVVGTSKYTTYSYTDRGHEHITESKTYYDDGTVAINSEK
FT                   KITPVDGTEPVYETINQVVNRDDESSKDGWFWRK"
FT   CDS_pept        334437..335672
FT                   /codon_start=1
FT                   /gene_family="HOG000000738" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756905"
FT                   /locus_tag="AGOS_AEL157W"
FT                   /product="AEL157Wp"
FT                   /protein_id="AAS52528.2"
FT                   /db_xref="HOGENOM:HBG058960"
FT                   /db_xref="InterPro:IPR007133"
FT                   /db_xref="UniParc:UPI0001DB2A0E"
FT                   /db_xref="UniProtKB/TrEMBL:Q758A9"
FT                   /transl_table=1
FT                   /translation="MSSKKQDYIAKVSYRNSLPPPPLPPKLLKYRYPDNEAVESPQLIT
FT                   SLYTKTNVTPLIQLDKELGMPVDLLRIPGVLNQQDTKNLYGYDSVKLVPEDRILLRDPR
FT                   VDRLTKTDLSKVTFLRRTEYVSAATTAKSERKRPLDATAEANEILTPSRIVQKVESTFD
FT                   NVVTDLSKIKHPIKKNVHAVKTWSLLPDTASMDQAFFAVKMVGSAALDNKEKSNLDMST
FT                   ALFRPVELEEDEWVSLYTTEPSSSKLLNDELEQQLDELSESANVYKFRRFKDYDMKQIS
FT                   SPTNSKFLSELALRFNNEKGVVYYKPLRSRLELRRRRINDVIKPLVRENNWDQINLTLR
FT                   KPTTQETKFRDKVRMRFDPIDFPNVDDDEDEEMEDVSPEHMVAEADASAEEQRPDASDD
FT                   SLKATEEQDAPM"
FT   CDS_pept        336243..337148
FT                   /codon_start=1
FT                   /gene_family="HOG000263929" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756906"
FT                   /locus_tag="AEL156W"
FT                   /orf_name="AGOS_AEL156W"
FT                   /product="AEL156Wp"
FT                   /function="S-formylglutathione hydrolase activity "
FT                   /function="carboxylesterase activity"
FT                   /cellular_component="cytoplasmic membrane-bounded vesicle "
FT                   /protein_id="AAS52529.1"
FT                   /db_xref="GO:0004091"
FT                   /db_xref="GO:0016023"
FT                   /db_xref="GO:0018738"
FT                   /db_xref="HOGENOM:HBG000461"
FT                   /db_xref="HOGENOM:HBG286713"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="UniParc:UPI0000252CCC"
FT                   /db_xref="UniProtKB/TrEMBL:Q758A8"
FT                   /transl_table=1
FT                   /translation="MGFKVNAELRSCGGRLLKLSHVSDACKSTMDVNVYLPVQYYKKTE
FT                   RAIPTIYYLSGLTCTPQNASEKAFWQAQADKYGFAVVFPDTSPRGVEIPKDPEDSWDFG
FT                   EGAGFYVNATMEPFARYYNMYDYIHNELPGLLAKHFSAGPQNAKVDFLENIGITGHSMG
FT                   GFGALSGYLKNYRNAKWRFKSCSAFAPIVNPSVVPWGQKAFRGYLGEDKALWEQYDPCC
FT                   LVKKVENAGHDTILIHVGTSDPFLEKHLKPELLAEAIKGTSWEGKVSINLVDGFDHSYY
FT                   FVSTFVPEHAKYHAEKLGLV"
FT   CDS_pept        complement(337207..339003)
FT                   /codon_start=1
FT                   /gene_family="HOG000000739" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756907"
FT                   /locus_tag="AEL155C"
FT                   /orf_name="AGOS_AEL155C"
FT                   /product="AEL155Cp"
FT                   /protein_id="AAS52530.1"
FT                   /db_xref="HOGENOM:HBG058961"
FT                   /db_xref="HOGENOM:HBG204230"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI0000252CCD"
FT                   /db_xref="UniProtKB/TrEMBL:Q758A7"
FT                   /transl_table=1
FT                   /translation="MENKSNQDDPRSIDYGLPPDIVLATLPYLEPRDIKNLSLTNKYFY
FT                   KLLDYGGSNTLWHELYRKAFGYTQTNEEPFSSNGAEGLSTCSETVLVTAFPDMSWMERY
FT                   KARERCTRLYTWGSQQHGRLGYTLGCNPMVSDDVFDGRWGHQRVGISKPTLVPWFTEAC
FT                   RTDNGEPVPGLPDVAEIDQDDRTIVQMSAGGFSFQLLTKSGKLYFTGITYTGGHPGPGP
FT                   KNERDYNYFRNIVLEIDQNRIPDLFARNGMYRHRVHNAWSEPVPHDDLYRALNKMKKRC
FT                   LQHIPGNRHVQRLLARDSLSFYHEESAFAMKVDPSLFDKVKFVSVTSGRSHILALDDNN
FT                   NLYSWDGPDIDYGVRIVFEGLPVRKTNPLLKIGSGWDFNCVYIYAVGLVVWSSRSAVKK
FT                   GDTFAKANYNVIPDTADISGTNRISDYACCANNVVFYITNNGRKLWIYSHGVSKTVDLP
FT                   FDGRLTKIEASCMTLVLCTENSTYTLKVNNGDIVEDSFMKMNLEQGQKFIAVSAGDYHN
FT                   LALTDKGELYSWGLESDICGCLGQGDPDEAVDTRQIATFESARSIRVLQPAKVELPANS
FT                   VCVAITAGGWHSAALIMQNQST"
FT   CDS_pept        complement(339187..341853)
FT                   /codon_start=1
FT                   /gene_family="HOG000183136" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19776718"
FT                   /locus_tag="AEL154C"
FT                   /orf_name="AGOS_AEL154C"
FT                   /product="AEL154Cp"
FT                   /function="hydrolase activity"
FT                   /protein_id="AAS52531.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG058962"
FT                   /db_xref="HOGENOM:HBG395935"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017149"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0000252CCE"
FT                   /db_xref="UniProtKB/TrEMBL:Q758A6"
FT                   /transl_table=1
FT                   /translation="MANEPPLIHLWNHPHSIISTIAFPHRKLLFAGTQDSKILCFDLCT
FT                   YNLVKTIHLGEDTDNFTKTSVLGLSKSQDEKLLFSAGTDSLVRVWSIGTVPQDDSIEAK
FT                   ELVTIYSLMDIGDIFSLAYLDAEQTLVFGCQNASMLYVDNFMARKIPTRSAIDFDKLPH
FT                   RRYNKFFDSTGPGGGGGGGGGGGGGTGGAGGGVSNLPSVRSASFISPEGNNLILQVPSE
FT                   NIITYAHNGFIYSICRINGRGTWLSTHFEQYATDPNVSFFVSSAGDGISKIWALLPLNS
FT                   QERRVGHKVQLLTEFDNEESVFCQFVEYPFLYCGLSGGIIKIWDLNINQLVTSLKTPYA
FT                   EDIMSITVYKDNVFATHKQGITRFHQGNVNFWNAHQGLVLSSEILRKSCTSNRIDRMVT
FT                   GGNDGSLALWNINEWLNGTASPGGSAPTEEHSLPSGERRNSWTEYQQIQLDNDHMIATL
FT                   REFISYQTVSQLPEPQNIIDSRRCANFLQNLFTKLGANHCGLIPVSTGSNPVVLAQFKG
FT                   NAAAPKRILWYGHYDVISADHPSQWDNDPFTLTCENGYLKGRGVSDNKGPLLAAIFSVA
FT                   ELFQKGYLNNDIIFLVEGEEENGSRGFREILLASEGLLNQRWDWILFSNSYWLDQKVPC
FT                   LNYGLRGVINAEITISSDEPDRHSGVDGGVYREPSADLICITSKLQADDGTIRIPHFHD
FT                   AVQPVTEQERQDFRDIISRAEIDNRTTVEHLVAKWTQPSISFTKFNTSGPGNATVISQR
FT                   ASLVVSIRLVPPQDVRTIKQLLIDYITQSFAALRSRNHLHISILNEAEPWLGDPHNTCY
FT                   EILREELHDTWGIDPLFIREGGSIPCIRFLERQLNAPAVQIPCGQSTDNAHLDNENLRI
FT                   KNWYNMRAILTKVFNRL"
FT   CDS_pept        342472..344175
FT                   /codon_start=1
FT                   /gene_family="HOG000162649" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19776719"
FT                   /locus_tag="AEL153W"
FT                   /orf_name="AGOS_AEL153W"
FT                   /product="AEL153Wp"
FT                   /protein_id="AAS52532.1"
FT                   /db_xref="HOGENOM:HBG330582"
FT                   /db_xref="HOGENOM:HBG353816"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0000252CCF"
FT                   /db_xref="UniProtKB/TrEMBL:Q758A5"
FT                   /transl_table=1
FT                   /translation="MVAAEAVQELPPDEEELALAKLVFGDTADFHEALRNADLNYVSSD
FT                   EDVYGQESSSDDEEGTEIGHLNDDQLFFVDEGADTEGGADGEPEAMEVDQVSEESDSGE
FT                   ESGSSAAWSDSDDEHLNVTIGQTNMSKKLRTTYAEKELSSRQYVQRLRQQFEKIYPRPL
FT                   WVDEHESESGYESSANEDSEQLVDGDVSALAKILHNTYSYKAQSSSLLSPKTLDIVRLK
FT                   DANVSHPSRSAIQSLSFHPLKPLLLTGGYDRTLRIYHIDGKHNHMVSSVYLKGTPVQTC
FT                   KFYVSPSHSEQMVLTGGRRRYMHTWDLMNTTAHVANISKISRMYGHEETQRSFEKFKLA
FT                   HLHTQQGVHGIILLQGNNGWVNILHAVSGIWLMGCKIEGVLVDFCVDYQAQSQGKFRTI
FT                   LIATNTYGQVWEFDLTDGGSVMKKWNDDGGVAITTIQVGGGTSTSHILSSDKVRQNRWL
FT                   ALGSESGFVNVYDRQSSSAKPVATLSQLTTTISSLEFSPDGQVLCIASRAAKDALRLVH
FT                   LPTCSVFSNWPTSGTPLGKVTSVAFSTHGEMLAVGNEQGKVRLWRLNHYQ"
FT   ncRNA           344513..344570
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR189"
FT                   /product="AgSNR189"
FT   CDS_pept        join(344968..344977,345353..345759)
FT                   /codon_start=1
FT                   /gene_family="HOG000111598" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756908"
FT                   /locus_tag="AEL152W"
FT                   /orf_name="AGOS_AEL152W"
FT                   /product="AEL152Wp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS52533.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG119370"
FT                   /db_xref="HOGENOM:HBG385416"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="UniParc:UPI0000252CD0"
FT                   /db_xref="UniProtKB/TrEMBL:Q758E0"
FT                   /transl_table=1
FT                   /translation="MAKELAQTRDASQVFGVARIYASFNDTFVHVTDLSGRETIARVTG
FT                   GMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHVKIRATGGTKTKTPGPGGQAALR
FT                   ALARSGLRIGRIEDVTPIPSDSTRKKGGRRGRRL"
FT   CDS_pept        complement(345944..346336)
FT                   /codon_start=1
FT                   /gene_family="HOG000204097" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19776720"
FT                   /gene_name="RPS22A"
FT                   /locus_tag="AEL151C"
FT                   /product="40S ribosomal protein S22 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS52534.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG192816"
FT                   /db_xref="HOGENOM:HBG735443"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="UniParc:UPI0000252CD1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q752J5"
FT                   /transl_table=1
FT                   /translation="MTRTSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHG
FT                   YIGEFEYIDDHRSGKIVVQLTGRLNKCGVISPRFNVKINDVEKWTANLLPARQFGYVIL
FT                   TTSAGIMDHEEAHRKHVAGKILGFVY"
FT   mat_peptide     complement(345947..346333)
FT                   /gene_name="RPS22A"
FT                   /locus_tag="AEL151C"
FT                   /product="40S ribosomal protein S22 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q752J5 "
FT   CDS_pept        join(346738..346743,346893..347042)
FT                   /codon_start=1
FT                   /gene_family="HOG000230627" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19776721"
FT                   /gene_name="RPL39"
FT                   /locus_tag="AEL150W"
FT                   /product="60S ribosomal protein L39 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS52535.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG506293"
FT                   /db_xref="HOGENOM:HBG727906"
FT                   /db_xref="InterPro:IPR000077"
FT                   /db_xref="InterPro:IPR020083"
FT                   /db_xref="UniParc:UPI0000252CD2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758D8"
FT                   /transl_table=1
FT                   /translation="MAAKKSFKIKQKLAKAKNQNRPLPQWFRLKTNNTIRYNAKRRHWR
FT                   RTKMGI"
FT   mat_peptide     join(346741..346743,346893..347039)
FT                   /gene_name="RPL39"
FT                   /locus_tag="AEL150W"
FT                   /product="60S ribosomal protein L39 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758D8 "
FT   ncRNA           complement(347175..347264)
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR65"
FT                   /product="AgSNR65"
FT   CDS_pept        complement(347575..349758)
FT                   /codon_start=1
FT                   /gene_family="HOG000057137" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624165"
FT                   /locus_tag="AEL149C"
FT                   /orf_name="AGOS_AEL149C"
FT                   /product="AEL149Cp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS52536.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058963"
FT                   /db_xref="HOGENOM:HBG202261"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000252CD3"
FT                   /db_xref="UniProtKB/TrEMBL:Q758D5"
FT                   /transl_table=1
FT                   /translation="MTLRHDSMAALRESPFLNRKHTLSPALRFNCMVHEEEELSEADLE
FT                   SEGDSDRTQPATPSNNLRFYSSRQAAGLCRSVGTLNLSLENASRKLAPLTTSRDLPVRV
FT                   REEDNGGLEFLSGTAMCQGDGDKEFHRGDNLWRPFPPRHDKNLKRSASKCEMKPPLISD
FT                   RSQSRDNDSVEDENARNMAYSPLGNKKKMRKFPECQLFKDVKPDQSAFQQKGLMSKMRS
FT                   NLLPQKLIIPDTPVKKSPHSSIMESPMDCSVYGSSSVPHDTQPFKNFPLFKPGTPPIES
FT                   SPTYQHRAQRLDSKNDMPAQRMKRRSKVIKNTDLSNMLQQFTDDLFGSGDEEPVFNSSP
FT                   LRTPRKRSPQPDRLRPPVTTTRQQGKRRLVGTSHASQSARARNPDEHLGANFSNVTLLG
FT                   RGQFSTVYQVTFPETSAKYAVKSMAPKKHYSRSRIIQEIQLLSEISQETSDAEGREYVV
FT                   QFISSWEYQGTYYAMTELCENGNLDQFLQEQLVARSKRLEDWRIWKIIVEVCLGLRFLH
FT                   ETCSIVHLDLKPANIMITFEGNLKLGDFGMATKLPLTDKAFENEGDREYIAPEIISDGI
FT                   YDFRADIFSLGLMIVEIAANVVLPDNGNAWHKLRSGDLSDAGRLSSTEIYTTSIFSSTD
FT                   INSTNITEVSRPCSYNAGSGRIKHIPAWVPRFLIDNDSLEKLVIWMIEPDYRKRPTASN
FT                   LLQAEECQYVELTRKAGAIIQEDDFGPKPEFFS"
FT   CDS_pept        350314..352035
FT                   /codon_start=1
FT                   /gene_family="HOG000000718" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756909"
FT                   /locus_tag="AGOS_AEL148W"
FT                   /product="AEL148Wp"
FT                   /protein_id="AAS52537.2"
FT                   /db_xref="HOGENOM:HBG190107"
FT                   /db_xref="InterPro:IPR022751"
FT                   /db_xref="UniParc:UPI0001DB2A2B"
FT                   /db_xref="UniProtKB/TrEMBL:Q758D4"
FT                   /transl_table=1
FT                   /translation="MIKLRRKLIALLVGGFMLALLSSLPRQKSPIASAAHSPAQEWFTR
FT                   GSQDINDPLEFYKMLFERLRKDAAQIKTAGSYVTQDADCQIRDLEDKLPESSHLGSYDG
FT                   LAKCFRLERDHLEGLRQGHSEFLRTIHGELAISAKSALFKTLYPLPAGIVTVGGGRYSI
FT                   LAMVMIRALRKRGTTLPVEVFLTDDDADDEAFCSYIEHFNAKCVLFSDRLPKSVLASQK
FT                   LSGFELKAVALLLSSYQQVIFIDADNVPLKPLDDVFKSKPLAEYGLVLWPDIWKRVTAP
FT                   AFYDIAGIPVDFKRRVRFSADDVSPPSRYTKPGEVDESFNRAHVPLHDFAGTMPELSSE
FT                   SGQLLIDKARHMDTLLLILYYNVHGKHLFYRLSTQGTSGEGDKETFAMAAQALGKPYYQ
FT                   VKTKLRFQGYHTPSQYVGAALLQHDFVQDHEQWLRAREEVARRPSELAAYNPAYNVDEH
FT                   FYNTLMRPEKPLDVMFVHASYHKLVPIDLFREKVYIGEDGKQFRSFPDLAAMDNFDIEL
FT                   FAIQILNEAICSATTKIEFKYNRDKIKSPEEFEDMCTYVRDRMRMLLDTRDTRTHS"
FT   CDS_pept        352298..354760
FT                   /codon_start=1
FT                   /gene_family="HOG000057127" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624166"
FT                   /locus_tag="AEL147W"
FT                   /orf_name="AGOS_AEL147W"
FT                   /product="AEL147Wp"
FT                   /protein_id="AAS52538.1"
FT                   /db_xref="HOGENOM:HBG058965"
FT                   /db_xref="HOGENOM:HBG204111"
FT                   /db_xref="InterPro:IPR018808"
FT                   /db_xref="UniParc:UPI0000252CD5"
FT                   /db_xref="UniProtKB/TrEMBL:Q758D3"
FT                   /transl_table=1
FT                   /translation="MQEERVKYANSVLTSRTPFEVAEIVRIRLSQAKIINGEFYTLFKE
FT                   LSELKKSYVQQLRKIIIVNEDLDKLVYNGMVQRQVLTAPEMAGMDFDWLGELRGVWQQV
FT                   IRGLKADMHAQVEEYKGLDRDVVGVLRSHVETDEHWREVRKLHPKLSRMAAEMEVSRST
FT                   PEKVAAAERQWVEQAPRLLEVMEATDEKRLLVLKNCLLQYQNLLDDSLHANLDESEKVM
FT                   ERLLEFTPDREIDRFASAVVNYDFRFEPMQAAEADGEGAAAATPVEHRLRHVSGSSMLR
FT                   NLLSNDTFSDASNNVSLVPSRKSKLKSKVGSIFGRRRHRRAPQLQSESIPESDTSSLHS
FT                   HGTSSYHDSELYSKSHAVSSEAAAPRPAANSNNAPPAEKKPELEATRSSFSINQAPLVP
FT                   QPRSKKTPEIIGASNVQAITEKSGPADTAAPAQNFIRQRSTWDGVQQDPTALHDETNIV
FT                   SSLAPARRSSAAGQLGAHFWSPVPASQEGQNVPSLEGGRRDIHSMLFTNLSKADIDNSV
FT                   TRHESTNSQTSEMRQLEPQQTGSSLLLMNITGQSLFQHTELTSLGLNASIGEVINAKFK
FT                   DGILSSSQLIGEIALNYISSDSTGNSLPLDIILKIESAEQFDKIIVNHTILERTADENN
FT                   IIYKLAPQFIFGKTLGALKYSLKSPLVPIAIHPVWRFEQTQASVMLTLKIFSGLPPAVQ
FT                   ELVLEDLIVSVAIDNTVAKSALSKPQGSFSKEKRRITWRFKEPLVLRRDNEERLVARFL
FT                   TEGVAQESQKGVQAKFTIRGLQLGGGLVLRSQEVTLEDPFGSETADIWNDVTTSRTLVA
FT                   GAYYGLST"
FT   CDS_pept        complement(354986..355915)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19776722"
FT                   /locus_tag="AEL146C"
FT                   /orf_name="AGOS_AEL146C"
FT                   /product="AEL146Cp"
FT                   /protein_id="AAS52539.1"
FT                   /db_xref="HOGENOM:HBG058966"
FT                   /db_xref="UniParc:UPI0000252CD6"
FT                   /db_xref="UniProtKB/TrEMBL:Q758D7"
FT                   /transl_table=1
FT                   /translation="MSFNSFRRRGHTASKSVIKASLSQISEAQRTLEDTCCLVEYHGID
FT                   EEDVQVLNNPASESKDDPSAISEDEVAKQPSYGGETNQQCTEVRSEEYAVLSDSTEEME
FT                   ELERCYRGGSEVVLEPQSTSERIDDWCLTHVSCGTSTVLEAASSRVRDIARSWGVEGDE
FT                   RATLSAGTTRPPAVRPLPRVSSYESRKLAQLTPAELAQLTKFVKELLPYLIQGRASVRT
FT                   PRCEAKYGNVPTLFPDRGNLLRCSLDANNVSKMANLYEQMRQLLLDAPSNGNYEALDDI
FT                   SLSSMHSSLPVQSWYGWHMVPRVRDTEF"
FT   CDS_pept        join(356465..356700,356748..356836,356886..356944)
FT                   /codon_start=1
FT                   /gene_family="HOG000000901" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756910"
FT                   /locus_tag="AGOS_AEL145W"
FT                   /product="AEL145Wp"
FT                   /function="single-stranded DNA binding"
FT                   /biological_process="DNA replication"
FT                   /protein_id="AAS52540.2"
FT                   /db_xref="GO:0003697"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG539118"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI0001DB2A2C"
FT                   /db_xref="UniProtKB/TrEMBL:Q758D6"
FT                   /transl_table=1
FT                   /translation="MLRQVRQFHASSRALDFSKMMIVGRIGSDISQFVSQNDKKYAKYS
FT                   IASQPRRDGPTNWYTITVFNEPQMNFLTQYVRKGALVYVEADAANNVFEREDGSKSYSL
FT                   SLIQREINLIRNGKPAEQAEQEE"
FT   CDS_pept        357311..357652
FT                   /codon_start=1
FT                   /gene_family="HOG000247898" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756911"
FT                   /gene_name="GON7"
FT                   /locus_tag="AEL144W"
FT                   /product="Protein GON7"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="chromosome, telomeric region "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52541.1"
FT                   /db_xref="GO:0000781"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG058967"
FT                   /db_xref="HOGENOM:HBG395430"
FT                   /db_xref="InterPro:IPR014849"
FT                   /db_xref="UniParc:UPI0000252CD8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758A4"
FT                   /transl_table=1
FT                   /translation="MQPPTATYCTPEGDSHAFTVVPDAPRYRTTDGTTSGPSAYVLQAG
FT                   QIDRDRPSPPKLDAQGEPTALSRLRMHLTGLQDDINSFLTAEMQRAKNKKQKIDDTQEQ
FT                   RATGGSTAA"
FT   CDS_pept        357761..359320
FT                   /codon_start=1
FT                   /gene_family="HOG000179304" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756912"
FT                   /locus_tag="AGOS_AEL143W"
FT                   /product="AEL143Wp"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAS52542.2"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG191489"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0001DB2A2D"
FT                   /db_xref="UniProtKB/TrEMBL:Q758A3"
FT                   /transl_table=1
FT                   /translation="MPLRHEGVATKMAGRRESAPSSHEDRRVTKRMSDALSLAERDTPP
FT                   KDHQKGEPAVNERILLYKIDLFVLSFVCLQYWINYVDRVSFGNAYVSGMDKELGLHGNQ
FT                   FNVINTCFTVGYILGMLPNNLLLLVLPPRIWLSVCTLGWGLLTLAMYRATSFEYCCAVR
FT                   FFQAVFESCTFSGTHLILGSWYKENELALRSAVFTASGLIGSMCSGMMQVAIFDAMDGR
FT                   RGISGWRWLFIIDFLVTVPIAIYGFIFFPGTPDHNRADTSALVFSKAELRYARARLPAR
FT                   DERARLDLSVFHRVLGRWHWWLFSLLWVAGGENISFASNSTFSLWLANRGYSLAQRNRY
FT                   PMGIFAVGIAATFASAFYMDRCRCSQHWHVALAITAVMCIVAVLIRSNPLSPAIMFAAQ
FT                   YLGGVAYAGQAIFFSWANIVCQSDLQERAIVLASMNMFSGAVNAWWSLLFYSATTVPHF
FT                   RNGCYALLGTSIVSALISVIVRLLQLREQRRKLADLPANLNYVGADTSLEDPLATDSHR
FT                   SP"
FT   CDS_pept        359614..360852
FT                   /codon_start=1
FT                   /gene_family="HOG000057126" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756913"
FT                   /locus_tag="AEL142W"
FT                   /orf_name="AGOS_AEL142W"
FT                   /product="AEL142Wp"
FT                   /function="transferase activity, transferring hexosyl
FT                   groups"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS52543.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016758"
FT                   /db_xref="HOGENOM:HBG190594"
FT                   /db_xref="HOGENOM:HBG202276"
FT                   /db_xref="InterPro:IPR008630"
FT                   /db_xref="UniParc:UPI0000252CDA"
FT                   /db_xref="UniProtKB/TrEMBL:Q758A2"
FT                   /transl_table=1
FT                   /translation="MLFRPKSSRLSKDGSKFRSGIELFRESMHSTRAGLVHATMCSLLA
FT                   AGVLVLYFAGSLIYGSKDAAVVLPARHGHYVHSIQSPTPLIFPRVEDTHVLRDMGLRTL
FT                   YILRIDEHRRSRISMEVGDRPTPEKNLPKDDKRALAKRSFLDHGKRVYHRTSNHPEVVL
FT                   VTLIDFENYDKNTITRIVQNRVDYAAKRGYGIYVRWAQEFIPLVDKQTLEDSYEFMKPM
FT                   AMRAAMHAFPHAKYFWFLDHTGLIMNMDFSLQDNLLASRSLNNVLLRDVPVVAGTTIKT
FT                   YSNFAPANAKILVPQSPLGELDTNSFIVSSTLYGKAFLDYLSDPLIRNYNWDSLAASIG
FT                   HMLQWHPKFLSKTGLVKSKVIAARYIPNRSPDSPNAAEVAYEDGDAVVLFTGCDERQSC
FT                   PADIEKFSTKKSS"
FT   CDS_pept        361378..363000
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20624167"
FT                   /locus_tag="AEL141W"
FT                   /product="UPF0508 protein AEL141W "
FT                   /protein_id="AAS52544.2"
FT                   /db_xref="HOGENOM:HBG058968"
FT                   /db_xref="UniParc:UPI00015E166B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758A1"
FT                   /transl_table=1
FT                   /translation="MAPEKLMHVEQDHQIVLARLEKYLRLGQQCALAVQDPCVLHAFKV
FT                   EKLGWLARGLAEEHRLMLSRLARAGEAGGCAELVCAWLDGEGGVVGRYGALLVGCADLL
FT                   FESGMVRYQMRPRSEFLICVLQLYTKLEVLCGALAHDGLAQQLQNFEEAFVARWNRKNM
FT                   SLLLFDEVVDVLAVDAPFVSPPLFSLDNVVKRDFFELTLPKFGYTQLLVEVFQLDTGEI
FT                   AIFRVNSERLPYRADQGKRLLRQITSCGEPLTCIGRSLLFSTFRKSDLTVLEEMPSAMH
FT                   LTTRIDSDVHMVLRAVYQFEWDTFWRCTLHTMFSASPPSLGGIAAIASARRISHPPQNF
FT                   KIKHQKLAETLCCGTQGLGLQLQPSRPTTHERQLQDAGSDCSMQTSLLPPAPKLLSHAW
FT                   TAVPEESGEDSQSSSGYDNTPQQLQLFELEDSTSTRGSQNDSSLRLLELADSKRTDSGS
FT                   LVLQYPSFRSSIASSLHLRSPSPHSEDTASEGSARKRPQPDNGTRNAEHDDFEESFASH
FT                   KPENMKRRNAYLLQFLNHMRPAS"
FT   CDS_pept        complement(363224..364192)
FT                   /codon_start=1
FT                   /gene_family="HOG000034184" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19776723"
FT                   /locus_tag="AEL140C"
FT                   /orf_name="AGOS_AEL140C"
FT                   /product="AEL140Cp"
FT                   /biological_process="proton-transporting ATP synthase
FT                   complex assembly"
FT                   /protein_id="AAS52545.1"
FT                   /db_xref="GO:0043461"
FT                   /db_xref="HOGENOM:HBG176024"
FT                   /db_xref="HOGENOM:HBG395432"
FT                   /db_xref="InterPro:IPR011419"
FT                   /db_xref="UniParc:UPI0000252CDC"
FT                   /db_xref="UniProtKB/TrEMBL:Q758A0"
FT                   /transl_table=1
FT                   /translation="MRSLRFVQLHRHLAVLGRARCRVYSSATAAPLGVDKTSENNLQTE
FT                   TNRLAKTFTKFWDKVDLAREGGHVTVHIDGKPVRTPLGSPLRVDERRGILAHMLREEWA
FT                   GLTSLAVKPYSLPLTSLVSRCIDLETVSAPGCHPDTVAKVGGDRSAISQGLLRYLDTDT
FT                   LLCFSPRSEFEGALRKAQDEMYKPIIAGVETLLAEVSGKPVSLRCLDADVHGLRGNVQS
FT                   EDTRAAAGKYMDNLSVWDFAVFEKVVLTTKSFICGILLLQNKIGKAAPALKLSTEEIAR
FT                   AATLETIYQVERWGEVEDTHDVNHRDIRRNINAAAVVAYRE"
FT   CDS_pept        364312..364650
FT                   /codon_start=1
FT                   /gene_family="HOG000057125" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19776724"
FT                   /locus_tag="AEL139W"
FT                   /orf_name="AGOS_AEL139W"
FT                   /product="AEL139Wp"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="prefoldin complex"
FT                   /protein_id="AAS52546.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0016272"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG329661"
FT                   /db_xref="HOGENOM:HBG398811"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="UniParc:UPI0000252CDD"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Z9"
FT                   /transl_table=1
FT                   /translation="MAGNESLIQEIAAGLRNSKGQLELVTAQLAQLQRQKKLAHVTAKE
FT                   LGSYPVDQVWRSCGKMFLLDSKTDYTQQLDADAKTIEEQIKALEVKRHYLETTVENSIE
FT                   ALKKAVQR"
FT   CDS_pept        complement(364717..365472)
FT                   /codon_start=1
FT                   /gene_family="HOG000034146" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081026"
FT                   /gene_name="ATG27"
FT                   /locus_tag="AEL138C"
FT                   /product="Autophagy-related protein 27 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="cytoplasmic vesicle membrane "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial membrane"
FT                   /protein_id="AAS52547.2"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0030659"
FT                   /db_xref="GO:0031966"
FT                   /db_xref="HOGENOM:HBG191938"
FT                   /db_xref="InterPro:IPR018939"
FT                   /db_xref="UniParc:UPI0001DB2A2E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757Z8"
FT                   /transl_table=1
FT                   /translation="MKYVRCVLLTGALFNIAAGLKCADSKVLSRYKVSQHAAKGKFTES
FT                   TPPSETTDFWWINLCEEHSEPVPDKCKDDAMFCHRQQVKLDDGKEYVTQVFDVPRNQEV
FT                   DVEELRDGFQVSFTGKWGERERKVKVRYTCADDKAEDEVSAEGAFGAHTTPVEVALRGP
FT                   SGCIQATEKSSGIGGWITWLVIYAVLLTLIYLLAKSYMSVGHGSMQDFREEFVERSTNL
FT                   VSSLPEFAKEVMGKVVGGGPSSRGGYSAV"
FT   sig_peptide     complement(365416..365472)
FT                   /gene_name="ATG27"
FT                   /locus_tag="AEL138C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757Z8 "
FT   CDS_pept        365895..366449
FT                   /codon_start=1
FT                   /gene_family="HOG000205045" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756914"
FT                   /locus_tag="AGOS_AEL137W"
FT                   /product="AEL137Wp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="AAS52548.2"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="HOGENOM:HBG232228"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005721"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="UniParc:UPI0001DB2A2F"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Z7"
FT                   /transl_table=1
FT                   /translation="MARYGATSTNPAKSASARGSYLRVSFKNTRETAQAISGWDLTKAQ
FT                   TYLEQVLDHKRAIPFRRYNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAANAEA
FT                   KGLDSTKLFVSHIQVNHAPKQRRRTYRAHGRINKYESSPSHIELVLTEKEEAVEKATEK
FT                   KVVRLSSRQRGRLAAQKRITA"
FT   CDS_pept        complement(366664..368592)
FT                   /codon_start=1
FT                   /gene_family="HOG000205115" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756915"
FT                   /locus_tag="AEL136C"
FT                   /orf_name="AGOS_AEL136C"
FT                   /product="AEL136Cp"
FT                   /biological_process="intra-Golgi vesicle-mediated transport"
FT                   /cellular_component="integral to Golgi membrane "
FT                   /protein_id="AAS52549.1"
FT                   /db_xref="GO:0006891"
FT                   /db_xref="GO:0030173"
FT                   /db_xref="HOGENOM:HBG067191"
FT                   /db_xref="HOGENOM:HBG396211"
FT                   /db_xref="InterPro:IPR012955"
FT                   /db_xref="UniParc:UPI0000252CE0"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Z6"
FT                   /transl_table=1
FT                   /translation="MAANGSSVFQHALQLWKQADLPNLQEGLDQAILEVKHHEEEALES
FT                   RKTLATETKAFKKLDTDARLLQINKLIKMYQAEVDSLTSRFKFTEQKLFEVYGRLTEAP
FT                   DPQPLLQSSLDALQGSDNMRQLQKENAALKDKLTKYADYENLKARLREVEQNSAKTFAR
FT                   RLVAKEQEVNSTWEEKERNWEKKEDELNKQVKTLKETNKVLNDKLSKKNGLDSEDQADG
FT                   DAESKSSNSHVGAAEFRLLADELESSQVRILDLEKRNEELSGALAKASSAAERDSELHN
FT                   KDLQINHLESENALLTASLERERSSLAETRKSLGQQIQTISQELTSYKGELTTVRRKLV
FT                   TYSDYEQIKQELTALRKIEFGVDDDKPDEDGDLGSALTAANKKLQSSLAGLRSRNQDLE
FT                   QNNNLLVAQVKNLKEQLQELEALNAKLENDLGKVEDVARFNDNMSMISGATRHITNRQG
FT                   YGGKLSPTSSIIGIPEEAETVGLTSNTSILPIVTQQRDRIRNKNMELERQLKQSSLDRG
FT                   KLLAEVASLRKDNQKLYERIKYISSCNSGLGESTREVSTGVDIESQYQTGYEESLHPLV
FT                   QFKKSEQERYTKGRMSQPEKLFFTFANVILANKTSRLVFLAYCIALHVLVVITAAYSVS
FT                   ATRAVGM"
FT   CDS_pept        complement(368960..371023)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624168"
FT                   /locus_tag="AGOS_AEL135C"
FT                   /product="AEL135Cp"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52550.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG329518"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR007526"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="UniParc:UPI0001DB2A30"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Z5"
FT                   /transl_table=1
FT                   /translation="MGSSRSVGSYSGEGGQGSGGVSRAEAWSDKEEAKQWSQESAEGVD
FT                   IAFDEAIDGEVLSADRNSAVEEGAEADAPETKENTETLSGSGEVMEQDGGDGEEEEDDD
FT                   GVESSYPVAADTIEVDAETENATNSPGTVNAGDADTGPVEARELSELPAEVKQEHNGYG
FT                   SSMQVDDSGRAVAVEGGLQSSTEKEVDLVVPQTHEIVIPSYAKWFHLNKIHEIEKKSLP
FT                   EFFTNRIPSKTPQVYVKYRNFMVNSYRLNPNEYFTVTSARRNLCGDAGSIFRVYKFLSK
FT                   WGLINYQVNSKVKPTAVEPPYTGEYSTRHDAPRGLFPFQSYKPAVQIPDMSRLKKMMTQ
FT                   LRDPITGGNRQESSPSLKTEAGEEQAVDGKRMANGISTGHLRAPKKPRLQDMIDKDWEK
FT                   GEVIKLLKSLQQHGTDWMQVAKDVGNKTPEQCILRFLQLPIEDNFLDSEENLGPLKYGA
FT                   HLPFSKADNPVMSTIAFLVGLVDAETVRAMTQRAIKSIDGEEVPSANGTSDETPARVVK
FT                   DASEIAVASLGARAHVFANNEERALNAVTNELVHTQLRKVDLKLKLLDTMEKSLEVERK
FT                   ALQKQQEEVFLQRFSFSKYAINVLEKFEQALKDTQDPAVMKDNINAIRKMILNPPEFAM
FT                   GSSSAAPTDMSSGGAHETPGAAAPEGSVAALDITSVKPVSMDAPQLYRYWSG"
FT   CDS_pept        371713..372555
FT                   /codon_start=1
FT                   /gene_family="HOG000001022" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19776725"
FT                   /locus_tag="AGOS_AEL134W"
FT                   /product="AEL134Wp"
FT                   /biological_process="cell wall biogenesis"
FT                   /cellular_component="extracellular region"
FT                   /protein_id="AAS52551.2"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0042546"
FT                   /db_xref="HOGENOM:HBG058969"
FT                   /db_xref="InterPro:IPR008659"
FT                   /db_xref="InterPro:IPR018466"
FT                   /db_xref="UniParc:UPI0001DB2A31"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Z4"
FT                   /transl_table=1
FT                   /translation="MRAASGFGVVLWLLMQAVQLVWADVSVLKPEKGARFSAKSGKASL
FT                   ELRWRIDETTYPKKDEIEIYNVTLCGGPLNQLTCMMNLANDVLPADVKEDNGELSLDLT
FT                   VDANIVADGMYMVQLTANAGIMGYTINYSKRFYLEDMTGPKKITVSAPLDHPLWGEVHI
FT                   TARKDGVKFDPTAEYASVPYLSQTAKTRYAPMQTQPATKISATTWVNKHEVTSVSYFSV
FT                   IRNDLLFQETTITRSIDYTLSLFHNYATPQPHPSEWYDPKQRQTLSTRKINLSHLSKR"
FT   CDS_pept        complement(372632..372982)
FT                   /codon_start=1
FT                   /gene_family="HOG000142067" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624169"
FT                   /locus_tag="AEL133C"
FT                   /orf_name="AGOS_AEL133C"
FT                   /product="AEL133Cp"
FT                   /protein_id="AAS52552.1"
FT                   /db_xref="HOGENOM:HBG058970"
FT                   /db_xref="HOGENOM:HBG512047"
FT                   /db_xref="InterPro:IPR013970"
FT                   /db_xref="InterPro:IPR016588"
FT                   /db_xref="UniParc:UPI0000252CE3"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Z3"
FT                   /transl_table=1
FT                   /translation="MSHQTPRLDPAQIASTNHSVFRLIAKVVAQPKQEEITIQSPTTNR
FT                   EMVTLGSVRVSQLTKFKVEQWYEFVCRASDSGDAGVFVLDSVELPLPSGEELSVDGVVA
FT                   LQQLCSKFPEMY"
FT   CDS_pept        complement(373295..373948)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059090"
FT                   /locus_tag="AGOS_AEL133CA"
FT                   /product="AEL133C-Ap"
FT                   /protein_id="ADJ41770.1"
FT                   /db_xref="UniParc:UPI0001DB2A32"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGC7"
FT                   /transl_table=1
FT                   /translation="MVAILGQARRQVVRKMVSVQSNERYDEASHCSGDLDIVADYVTSL
FT                   LYKFVQFERSFNIMLVLGHSYDVQPFHDKFLREFGATVLTSQDDRDAWQDYRNRHSNVL
FT                   VTYTKAMLAPCAYTDMIIFIDYLPSLDDYTHAITNLRDGCGFCYLVFDPETVELDDMSS
FT                   RTLDLQECLECYRADDTGPVDPLSLDPNMQLLLSMLEMEENTIQACNYYDTVIY"
FT   CDS_pept        374828..376546
FT                   /codon_start=1
FT                   /gene_family="HOG000194592" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929707"
FT                   /locus_tag="AEL132W"
FT                   /orf_name="AGOS_AEL132W"
FT                   /product="AEL132Wp"
FT                   /function="metallopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="AAS52553.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008237"
FT                   /db_xref="HOGENOM:HBG059932"
FT                   /db_xref="HOGENOM:HBG324099"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017141"
FT                   /db_xref="UniParc:UPI0000252CE4"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Z2"
FT                   /transl_table=1
FT                   /translation="MAIILGKEGLRSEGGGRRRLARRDFLQVACGLAILLLGGWHWFAQ
FT                   DTKVASVSTAPLCGRINPIAPAFNKSLDRIFHDPVFKRDSIKRLSGAIQIRTEIGDVHP
FT                   APADDPEYYAEFYKFHAYLETTFPLVYEHLQVEVVNKVGLVYTWGGSDAALKPLLLAAH
FT                   QDVVPVNRDTWEQWNHPPFDGFYDEDTDTLWGRGTIDCKNLLIGTLEAVDLLLRDGFKP
FT                   TRTVLLAFGFDEESTGKYGAGEIAQHLEERYGKNGIYAIVDEGNGILPASDSLYFAAPV
FT                   TGEKGYADFVITVHGRGGHSSVPPEHTNIGIAAKLISLLEDNPSELTFSASNPVYGVLT
FT                   CYAEHDNSLPEIVRRAILNAPHDSGAAAKLLEFLATQHLYRDLMRTSQAVDIIRGGVKA
FT                   NALPEEVSFLINHRIDVTSNVETVLARNVRQIQAVAEKYGYGVVIGDEELAPKTELGYI
FT                   ALEVSNAFPPAPVSPTHGSEVWDLFAGTIQDVYENRVFADRDVEFYVGQSLFSGNTDTR
FT                   HYWNLTENIYRFMAIQLTGEVLSVIHSVNEHLNFTDHLSTVGFLYEYIVNTNEHT"
FT   CDS_pept        complement(376667..378034)
FT                   /codon_start=1
FT                   /gene_family="HOG000093298" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756916"
FT                   /locus_tag="AEL131C"
FT                   /orf_name="AGOS_AEL131C"
FT                   /product="AEL131Cp"
FT                   /function="mating-type factor pheromone receptor activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS52554.1"
FT                   /db_xref="GO:0004932"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG058971"
FT                   /db_xref="HOGENOM:HBG395950"
FT                   /db_xref="InterPro:IPR001499"
FT                   /db_xref="UniParc:UPI0000252CE5"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Z1"
FT                   /transl_table=1
FT                   /translation="MSTDHAWTIIALASLAVLLLLPPLVWHSGTRNTPGIILIVWLLIM
FT                   DIKCIVDAAIWGGTDFASRWAGYGWCDLMIRLQAGANVGISCAVSNIAFNLRRILKADA
FT                   ALPNAGSYKKVVVDLSFCIVSPLVVMGLTFLAQAFRFAIFRYSGCQVALSPTWVTAVCY
FT                   TLWILIWSMVGFVYAILLLLVFYRRRKDVRDILHCTNSGLNLARFARLLIFCLVIILVM
FT                   FPFSVFSFVEDLRNVEGGYIFIFKANREMWNQIPHLDPGSPLYSIWLYILMSYLVFLIF
FT                   GLGSDALSMYAGIARAIGFGAVMDRWNSHVNRNSDKHTDRITRQFLHRHGYDEFHSKPC
FT                   ADSAAARTDKSMPSTPTNFVVDYALPQDLKREERRRRQAYNNGNIYFDDSALGMGRYGD
FT                   CQLDLESGIDLSPMTAISFSRELNGSMKDTAASVSICSDDTKAEVFPPQHSHRGRN"
FT   CDS_pept        complement(378403..379704)
FT                   /codon_start=1
FT                   /gene_family="HOG000093529" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19776726"
FT                   /locus_tag="AEL130C"
FT                   /orf_name="AGOS_AEL130C"
FT                   /product="AEL130Cp"
FT                   /protein_id="AAS52555.1"
FT                   /db_xref="HOGENOM:HBG058972"
FT                   /db_xref="HOGENOM:HBG398421"
FT                   /db_xref="InterPro:IPR018805"
FT                   /db_xref="InterPro:IPR018807"
FT                   /db_xref="UniParc:UPI0000252CE6"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Z0"
FT                   /transl_table=1
FT                   /translation="MAFRVVPILYKTVLRAKYYAYLSCSDRMVYVQIAIAWHFISSSIA
FT                   LAHEAAHLSAPQIIPQLSREYHSIDFLNVGFTGSYSPVSTLKAVESKQCRCETGPRVWF
FT                   SGATAPIDEPLSVHFRGPLKLHRFAYYTSEHFVLDQQASGSWQRGAYFDAASRTRQNAV
FT                   FLTRAGAHSECLGKALTYAAEDGVSRSDRPATLSKHASLSSDQEFAIFADDPCPESGIG
FT                   NACGVYRKGIPAYHGFAGATKMFLFEFEMPAETLAPHPKFEFYDLPAIWLLNARIPRTA
FT                   QYPNNADCSCWASGCGEFDVFEAMNATESYHLYSAFHTFQGIDDVGSGIQPPAFFERRP
FT                   RGVMRGGVIFDSVGHVRVFMSDAVSFERNISSAKLASMMYRLQLSTPYKLVLPNVTAVR
FT                   PILEMTSNAIHLLHKAGMTGYVVLTLASLVYLII"
FT   CDS_pept        complement(380043..380618)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756917"
FT                   /locus_tag="AEL129C"
FT                   /orf_name="AGOS_AEL129C"
FT                   /product="AEL129Cp"
FT                   /protein_id="AAS52556.1"
FT                   /db_xref="HOGENOM:HBG058973"
FT                   /db_xref="UniParc:UPI0000252CE7"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Y9"
FT                   /transl_table=1
FT                   /translation="MNQDKFPGDPCGDEAQPCLCYCAGCCNIQAYRVYFVRLFITGFVL
FT                   PVCWLLNILLYLYVCWWIPHDIIFPGVKADSSLQDPEKSADFTGAAKAALDRPSSEEPW
FT                   DTSTVRDTLPADDTSRISPENAGQAHLKAIAASTIECHYRCRRIYLKWLARSLICIVGY
FT                   AAAAIALVAVLSSQKAAAAAGNTLLTSP"
FT   CDS_pept        complement(380885..382939)
FT                   /codon_start=1
FT                   /gene_family="HOG000248214" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20624170"
FT                   /gene_name="SET2"
FT                   /locus_tag="AEL128C"
FT                   /product="Histone-lysine N-methyltransferase, H3 lysine-36
FT                   specific"
FT                   /EC_number="2.1.1.43"
FT                   /function="histone-lysine N-methyltransferase activity "
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="chromosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52557.2"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0018024"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG191944"
FT                   /db_xref="HOGENOM:HBG328952"
FT                   /db_xref="HSSP:1E0N"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="InterPro:IPR006560"
FT                   /db_xref="InterPro:IPR013257"
FT                   /db_xref="UniParc:UPI0001DB2A33"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757Y8"
FT                   /transl_table=1
FT                   /translation="MSRSSSPSVSLPLPSSATLFLDREDKTEEALGTFIELEQCTYTHK
FT                   RLGDSRSNEFMECDCFEDYKDEQNHACDENSDCINRLTLIECVNDLCTSCGDDCQNQRF
FT                   QKKEYADIAVFQTEKKGYGVRAERDIEANEFIYEYIGEVISEADFRDRMVDYDMRGFKH
FT                   FYFMMLQAGEFIDATERGCLARFCNHSCNPNAYVSKWDVAGKLKMGIFAHRKILKGEEI
FT                   TFDYNVDRYGATAQPCYCDEPNCIGFLGGKTQTDAASLLPQNYADALGVRPSVEKKWVK
FT                   MRKALGEEIDKSGSSNINIEFVESLELEPCVQYSDVNKVMSVLLQIDDKFICSKLLERI
FT                   LLTSDETMRYQIIKLHGYKCFSKLLGLFETDENTQHRILQYLSDLPKTTKNGIVSSQID
FT                   KKVESLLQKEALKEDASALLERWNTYETYQRIAKKDFTKTSNGLNKVTDFRRVRLPLGW
FT                   EIIHENGRPMYYNAQRQIKRVDPPSDTHLQRPARTTPPQRYNGGFYDRTTKRPLDPESF
FT                   EKRKRQRLEWEQQELAKKKQEEVRHLKEKLEVEKQKKSELEQIIEDANKQQEQQRLERL
FT                   QKEKETAERRERRRQTHSASRIEHKWNKFFAQIVPNLIKSYATSMDRARIKECARDIVK
FT                   ILSSKELKKDATKVPPAEVTKEKRKKVNEFCKSYMDKLLAKMHEKAVSK"
FT   CDS_pept        complement(383265..385340)
FT                   /codon_start=1
FT                   /gene_family="HOG000113404" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20624171"
FT                   /gene_name="LST4"
FT                   /locus_tag="AEL127C"
FT                   /orf_name="AGOS_AEL127C"
FT                   /product="Protein LST4"
FT                   /biological_process="amino acid transport"
FT                   /biological_process="protein transport"
FT                   /protein_id="AAS52558.2"
FT                   /db_xref="GO:0006865"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG103414"
FT                   /db_xref="HOGENOM:HBG124103"
FT                   /db_xref="UniParc:UPI0001DB2A34"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757Y7"
FT                   /transl_table=1
FT                   /translation="MLGRLLRTNSFIDLLGSFPNGKDDGKGPQPHHEATPPPSSMHMPD
FT                   ELRTLLYGCRKVEGEGRGGEGRGSGTFRLVVAQELGQMMSRDNYQVVLDCGGTRAAVGS
FT                   GGAEMPLSELKEYIFGSPVRLSDRCRSDKLKLSRGARVIVVTRIFYTGYAGNARRLAVC
FT                   CCIPEQFLTVVTECWSQVSAWFDEVQDVLMPLLEAEPLLPKDLRVSAPAQVDVLLHKFY
FT                   RHLILPLHGLLETHRLFLYPADSLDFVTAWFREVFNWLEVKDGHRLKFLPALLGKLRHD
FT                   AAAELLHNRSSRIVVMSGNVTVANKLIFILSAFLRPRYSGQVHYVDDGLAARNVELKEA
FT                   PADPKYSSTITSKGWEIPRKRSRSSVLSKSSDETSFAHVFLPSSLRSTNSLQYISSSLN
FT                   SQYGSYGSWFKKTIPLGHSPRINESPDNTFMHHHTNSTSSLQQQQAGTCASGNNASSVT
FT                   TSTTPNTNRWSQGSPSISEYEEYPWLGYGTAPSGAPSKSRIQKVNMPRNSNRVHDKKLL
FT                   HERFVSICGDVQEVDFHTSPATESYGAILEVPILEELSFPSQELLPRYSSYLPTLDPAF
FT                   QVQACPITSNTERRLVDCMKQDLHNAEYSRTLLISLRSREIKEITITKDPSTKTIVQRT
FT                   KKIFLNGKPGHVSQKLHEEIHFVDNHLTATWKKWEDPVESEDKTKLFITSFHELMK"
FT   CDS_pept        385617..386819
FT                   /codon_start=1
FT                   /gene_family="HOG000142066" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756918"
FT                   /locus_tag="AGOS_AEL126W"
FT                   /product="AEL126Wp"
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS52559.2"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="HOGENOM:HBG058975"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniParc:UPI0001DB2A35"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Y6"
FT                   /transl_table=1
FT                   /translation="MYNVGGFEVARWAVFTTLSAALCVIGGIMVPVVARLCSSQRDVNS
FT                   RVLNYGLSLSAGAMMCSSMYTMLPRAKGRAVTEFLGFLGGVGASFVVNELVHRYTSQSL
FT                   LHCAHEGGEAGPSTGQGEGLGPSEERALAVRQSLRQYGSTTCIPLARTATVNSLAPTCG
FT                   SEHKQTVVCLESNIGYDLENLATYREQYRAGLPSNAGETACAGEDEEHAAAERHLHVLA
FT                   TPFSKLLSIGIQTCVAITLHKFPEGFIIFFTNGEDMEDSRLGLSVFLGLAVHNFIEGFT
FT                   MTLPLYTALDTKWLAVLLTAALSVGTQPVGALFGYFVFKHTDKHDVQLDMTLLLSITAG
FT                   FLFVLALQMFQTAVAFSDTHHHHEDDDGKLIKSEHSSGTSCLKWCCLGVLLVLGSNTFA
FT                   S"
FT   CDS_pept        complement(386970..388697)
FT                   /codon_start=1
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081027"
FT                   /locus_tag="AEL125C"
FT                   /orf_name="AGOS_AEL125C"
FT                   /product="AEL125Cp"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS52560.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG146321"
FT                   /db_xref="HOGENOM:HBG202405"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000252CEB"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Y5"
FT                   /transl_table=1
FT                   /translation="MVAAGYSALPQAIKERMHTLPSRLSTNFGGILGRDDEPVEVEHFQ
FT                   YEQKLDRTLLSRRSVIGLGFGLMSPVLGMSTTLGIGLVHGGPPTILGAFALCGLMSWLT
FT                   ALAIGEVVSKYPIELHGSVALLAPERYRLVAAYYTGCLILLGNWVMNASIQYAGAQLII
FT                   SLIAISGDLVSEENLAIWTVAVYFLSITVTGVINAKFASFLEPINTVCIYWILYAVVFI
FT                   DVLLILFHKGSFRPFLSAFSNFDNRLSGYESMLLSFLVGGLQQSNFTLQGFSMLPALSD
FT                   ETQEPEKDIPKGMSQAVLVSTVCGVIYLVPLLLVMPSPEEVMSDSRVMEIVLLFTKSTR
FT                   SNIVSYLQVMLILGNLLFSGIGSITTSSRAVYSISRDHAIPYYELWSYVSPGSQSQVPK
FT                   YAVYLSMGASYLFGILPLISGTAYNSFIGASVMCLCSASGLAVICVMLNGRRGVKGAAV
FT                   KIRCRLGWPVSIVVLLWLLLVMFCMCMPVTLPVTFSSMNYTSCIFAVFLVGIGALYNLW
FT                   GRYHFKIPQIYENIPLTSRGTTVSPLMLDSPSKAEDTFLTQNSLTTVVGEGSAGPSHC"
FT   CDS_pept        389294..392116
FT                   /codon_start=1
FT                   /gene_family="HOG000231589" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929708"
FT                   /locus_tag="AEL124W"
FT                   /orf_name="AGOS_AEL124W"
FT                   /product="AEL124Wp"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="AAS52561.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG156268"
FT                   /db_xref="HOGENOM:HBG737692"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0000252CEC"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Y4"
FT                   /transl_table=1
FT                   /translation="MDDDQYDEFGNPLHGDAYESSGDETGETGAQLVRRESADEHGEAA
FT                   RDLVLQRAEESVYGPDVELLVELEDREGLGVPLVKAESERRRVETAVFTQRDRNVPRAR
FT                   YDREYMMQLACAPERCRAACVVGALHSGKTSLLDLLAVQAHERLPYMSKAMRQGWKPLK
FT                   YTDSLKIEIERGVSMKLNGFTFLGADGRGQSHVLTLIDTPGHVNFMDETAVAMRACDVC
FT                   IVVVDVVEGLSSVVESLIKRAERLGLPLIFVLNKIDRLLLELKLPVKDCSLKLHALVDK
FT                   INAYTQGRYSPERGNVLFASSKLGFTFTLEEFVKYYYAPKLQAGSSELVERLWGRVYFH
FT                   KGQFSLHPNPENEVTFVQFVLKPLYKIITHTLSKDPSDIERLLHQELGISLGDIPPDVD
FT                   QVPLLKMVMGRVFGDETGLIDAIVKHGQPSTYKSQKELPVNADGTVAHVLKLMEYGGEL
FT                   WSLVRIYSGELRAKDFVSVINESQDVSAIEEDEITKVQVGQVALLGGRYILPVTHASAG
FT                   QLVLVKGLDEYYTKSATIFTGPAVCFPLIDYYNEPVFKVVVQPQVPSELPKLLDGLNLV
FT                   HKLYPGAVIKVEETGEQVIFGSGELYLDTLLYDLRQNCAKIEIKVSMPLVKFSEGCSDT
FT                   SFAAIPVSSPDGKIKLVISAEPLQQELIRDLTRGKLVSSELQDMKTLARKLRNDYGWDS
FT                   LAARSVRSFHNCNVFLDDTLPDEVDKGLVNAVMRHILQGFKWALREGPLAEEPIYGVQF
FT                   KLLDLQIEGDHSSSSIQLVALVRRACYIALLTAVPVILEPIYEVDIVVHEVLASIVKNL
FT                   FAKRRSARIYKIEAIVGTPLIEVKGQMPVIESVGFETDLRLATSGGAMCQMHFWNKIWH
FT                   KVPGDVMDEEAVIPKLKPAPMDSLSRDFVMKTRRRKGLSSEGYQSNNGPTLEKYIEPEL
FT                   YAKLRERGLV"
FT   CDS_pept        392304..393491
FT                   /codon_start=1
FT                   /gene_family="HOG000176390" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929709"
FT                   /locus_tag="AGOS_AEL123W"
FT                   /product="AEL123Wp"
FT                   /protein_id="AAS52562.2"
FT                   /db_xref="HOGENOM:HBG157401"
FT                   /db_xref="InterPro:IPR008610"
FT                   /db_xref="UniParc:UPI0001DB2A58"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Y3"
FT                   /transl_table=1
FT                   /translation="MAKGFKLKELLSRYKETVKGERPKKKNNVKKADTQQSNESAGQAN
FT                   ESLEESGSAKQQDVAPVDASTTPLSRKERRKQKKQQKQQQKQQEEQQEEASGDESAEAA
FT                   PASLDLDKLARSDSESESEDEFAEARSVEEHEAEDGSEEDVPLSDVEFDSDADVVPHQK
FT                   VTINNTKAISDSLARIQLPWQKHSFQEHQTVTAAANADAGITDIYDDTERELAFYKQSL
FT                   DAVVQARDALTALRVPFKRPLDYFAEMVKTDEHMDKLKSKLVKEASDKKAREEARKQRQ
FT                   LKKFGKQVQVATLQQRQKEKRETLDKIKSLRTKRKHNDIDDDAFAVGVEDAAAEKPHKA
FT                   GAKRQAKNAKYGQGGLKRFKRKNDAQSSAEMTDFSTRKMKGKAPRPGKSKRSRRH"
FT   CDS_pept        393863..394918
FT                   /codon_start=1
FT                   /gene_family="HOG000160912" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081028"
FT                   /locus_tag="AEL122W"
FT                   /orf_name="AGOS_AEL122W"
FT                   /product="AEL122Wp"
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /protein_id="AAS52563.1"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="HOGENOM:HBG015647"
FT                   /db_xref="HOGENOM:HBG328346"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniParc:UPI0000252CEE"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Y2"
FT                   /transl_table=1
FT                   /translation="MTKEDNRKKFVDEFPSLVSQLTQSLREYGIPQDAIDWYEKSLNYN
FT                   TPGGKLNRGLSVVDTYVILKNCKSPLDLPVDEYRRVALLGWCVELLQAYFLVADDMMDK
FT                   SITRRGQPCWYRVEEVGDMAINDAFMLEAAIYCLLKRNFRDQPYYVDLLELLHDVTFQT
FT                   EVGQLLDLMTAPEFIVDLNKFSLQRHSYIVIFKTAYYSFYLPVALAMYAAGVNDERDFA
FT                   QAREVLLPLGEYFQIQDDYLDCFGRPEDIGKIGTDIQDNKCSWVINAALKLCSPEQRKI
FT                   LDENYGRKDPECEQRCKQIFYDLKLQEVYERYEEQVAARLRERIGEIDESRGFRREVLY
FT                   SFLDKVYRRKK"
FT   CDS_pept        395120..395404
FT                   /codon_start=1
FT                   /gene_family="HOG000205681" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624172"
FT                   /locus_tag="AEL121W"
FT                   /orf_name="AGOS_AEL121W"
FT                   /product="AEL121Wp"
FT                   /function="ubiquinol-cytochrome-c reductase activity "
FT                   /protein_id="AAS52564.1"
FT                   /db_xref="GO:0008121"
FT                   /db_xref="HOGENOM:HBG178222"
FT                   /db_xref="HOGENOM:HBG333553"
FT                   /db_xref="InterPro:IPR004205"
FT                   /db_xref="UniParc:UPI0000252CEF"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Y1"
FT                   /transl_table=1
FT                   /translation="MGGPHGKAYMGWWGSMGSPKQKYITSYAVSPYAQKPLAGIFHNAV
FT                   FNTFRRVRAQALYVIIPFGLYYAWWANCRDYNEFLYTKAGREELERVNN"
FT   CDS_pept        395600..397921
FT                   /codon_start=1
FT                   /gene_family="HOG000113231" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756919"
FT                   /locus_tag="AEL120W"
FT                   /orf_name="AGOS_AEL120W"
FT                   /product="AEL120Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS52565.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058976"
FT                   /db_xref="HOGENOM:HBG202406"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016241"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI0000252CF0"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Y0"
FT                   /transl_table=1
FT                   /translation="MSNTYNVNPGLKRRDAPTLLQRNFAERVSVDTLISGEAGPPDEGG
FT                   SDGGEHNDEDEDTIYFKPKKIYRMEQESGSRQTLVRVYSETERSNFNEVTGKRMFDDWK
FT                   YRPLYYHEEETRPRCEGVGSVSAGSVRWGDMQDEYVPDLDFAAAVKAWQAEELKEEMPM
FT                   TRYQLWSEDESDFNLDSASSSMIIESSHAQVSPIPFPSSTGKSPVSAAHSLLTLNKALG
FT                   NRVGSRVFSPSNLESKAKHRSMYEWGSLLSISSATSIGDKFTQDDIRAITRKIPDDFLS
FT                   LPYTQRKKILMDIAPDKDYKAIMSVFKKYSLVSSSSFTHLSNHGSRRSRHGSMASQYLS
FT                   SFTPSSASFKPDERGSIVLGHRLGKIIGFGAWGMIRDCYDVKQSFVISPSESQPPASHA
FT                   MKIVRFKNNQKVKEHALREIAIWKKLHHPNILELINWKQEEDYAAYYLTEKIQDGTLYD
FT                   LVSTWGESDGSTIPLDQRCKLTIALALQLISALKYMHSKYIVHADVKLENCLLEKTGSQ
FT                   SWKLYLCDFGMSCQYGKPRNDNEELYSPDEGMDFSPAERKGLKNKRRPSLSKSSSQGVL
FT                   KPLTKLQKIIRSKQQTHDDTPLGITSFPKQYGPSLTSTTMSSSSVWKQASPAGSSSKLD
FT                   KTGRSGTSEEHDAATKAVEPHSHIGSLPYAAPELIDPCPPPLGPSADIWASGVTMYTML
FT                   TGKLPFKHDYEPRLRAMISSGKYDTELLRSVCNISENGLAPQGPGPAFGGLYAAVCGCL
FT                   TKSMVHRWELSEVDNTLRNE"
FT   CDS_pept        398358..398774
FT                   /codon_start=1
FT                   /gene_family="HOG000183702" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081029"
FT                   /locus_tag="AEL119W"
FT                   /orf_name="AGOS_AEL119W"
FT                   /product="AEL119Wp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="AAS52566.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="HOGENOM:HBG384371"
FT                   /db_xref="HOGENOM:HBG594899"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="UniParc:UPI0000252CF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q757X9"
FT                   /transl_table=1
FT                   /translation="MIYLKTILKVIDNSGAQLAECIKVLGKGSPKSAGKVGDKIVCVVQ
FT                   KAKPMNQSITGQSNNNRVKKGDIVRAVIVRTKQKNMMRPDGSTVSFGDNACVLLHKTTG
FT                   EPLGTRIQLNDGVVSRELEAKGYNKICSLASKVA"
FT   CDS_pept        complement(398944..400995)
FT                   /codon_start=1
FT                   /gene_family="HOG000112846" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756920"
FT                   /locus_tag="AEL118C"
FT                   /product="Probable serine/threonine-protein kinase HAL5-
FT                   like"
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS52567.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG124951"
FT                   /db_xref="HOGENOM:HBG202407"
FT                   /db_xref="HSSP:2BRG"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015729"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI0000252CF2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757X8"
FT                   /transl_table=1
FT                   /translation="MPQQVRLSRENSVKRSRSLTKSFRGLFKFNSPGSPPSSAATSDSS
FT                   EMSGAQGGRGNGLLGGRTKKASISPKSEAQFTQRNKSAESVVSDEGVAMVASAGAQFYG
FT                   RGKHESSPNVLMTGGEEAARAAGRASAESIALSEGGPPSIDTKLERVTPSLIYPQNGRA
FT                   KHSSQRSRSASVGRNKERGGPTPAPIGSIREEESKKAHKCIIQQEHFTVDENGNHQHSL
FT                   KVLPLIVQDPESHKPKLFSFSAVFKSHKNGEDEELSDAFSILPDYSTVLEKTLVEPLSE
FT                   VKIFSEAAQPDENGGRTEANQPKDMPKIVNKHAAIGNEELKLINNLSETIHVGMQGPDK
FT                   HSSPPQPFTCKATKSKQVLAEKYGKCIGMIGQGAYGTVWVTCRSLPQDNQTETHYPTET
FT                   YERNGKLFYAIKEIKPRADEPNEKFSTRLTSEFVIGHSLSGGAGGTKRLTSHPNILKVL
FT                   DLMQAHDVFIEVFEFCPSGDLFSLLTRSSKTGSGLHPLEADCFMKQLLNGVRYMHDHGV
FT                   AHCDLKPENILFTPNGTLKLCDFGSSSVFQTAWEKRVHFQTGAVGSEPYVAPEEFIPKR
FT                   EYDTRLVDCWSCGIIYCTMVLGHYLWKIAIKEKDQIYSAFLDDMTTRGEYYVFENMRHV
FT                   NQEVNRCRKMCLYNIFQWDPKKRITIPKLLDTPWMRRTKCCVNYRAAI"
FT   CDS_pept        complement(401437..403272)
FT                   /codon_start=1
FT                   /gene_family="HOG000248187" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756921"
FT                   /locus_tag="AGOS_AEL117C"
FT                   /product="AEL117Cp"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS52568.2"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG058977"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniParc:UPI0001DB2A59"
FT                   /db_xref="UniProtKB/TrEMBL:Q757X7"
FT                   /transl_table=1
FT                   /translation="MLKQRQRQVVGHFLRRHRRALLHEYVLVPIGVICFMALLYGVDRL
FT                   IRNVIKVKFPASVAVMIVNLGVMCTFSAISQPLAERYVAVVDVPLSWSLRWMNLFFTPA
FT                   FVTLPLSEWISAREAMLIMATFVVGYLVGVAVLAYVTVGCQRLFGKSRKSLFTRQHELD
FT                   TGEAEGSRFARPSATGVLDSPARSEDTASVTEYRPAELQDVPLMNLASHSGMLLSRSAT
FT                   QEHTGSSPGMSEGLFTRSSSDTGPAKSQEKQQEQDSSEFTSEPSSMNPATLHEPAPSQK
FT                   AYRDSSALETEDKPAFCERAVTRQVSHQLDRLISVQLLRAHLHHILYGLGFVASMFSYY
FT                   FSWYLMPYHLFTAVCAFMFIADAPLVQNPKYKRFLHPVLCSVALTWLVMLISVLIKHRR
FT                   VSFFISELHDYKTGRTYLHLFDTAAFGARVWPGAGDIFGSCMDVSIVGLSMPMFTYRAD
FT                   LRRHFASMIPAILILSAGTLILYPLIAHLIGIRSDRSLGFVGRSITLALATPVVDNLHG
FT                   SMTLMAVCTVVSGVVGALTGGPHLDLLRIRSDDYVTRGVTLGCNCGAIATAYLLGVDRR
FT                   AAAISSLSFVIFGTFMVILSSIGPVQAWVNHLATL"
FT   CDS_pept        complement(403531..403920)
FT                   /codon_start=1
FT                   /gene_family="HOG000001073" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756922"
FT                   /locus_tag="AEL116C"
FT                   /orf_name="AGOS_AEL116C"
FT                   /product="AEL116Cp"
FT                   /protein_id="AAS52569.1"
FT                   /db_xref="HOGENOM:HBG058978"
FT                   /db_xref="HOGENOM:HBG202408"
FT                   /db_xref="InterPro:IPR007741"
FT                   /db_xref="UniParc:UPI0000252CF4"
FT                   /db_xref="UniProtKB/TrEMBL:Q758E2"
FT                   /transl_table=1
FT                   /translation="MSNVKKQLAFLNRICGTAKPQVLVDTTKVSGLKLTFQAQSHNGHM
FT                   GARKLWREHLPTLQFYNPGLDIQVHRVANSDKKQPVPCVLEVLGHDGNVLHRLDMAHKH
FT                   SDTIIDELLSTVEHTPVPAEQQVRV"
FT   CDS_pept        complement(404268..405428)
FT                   /codon_start=1
FT                   /gene_family="HOG000233033" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624173"
FT                   /locus_tag="AGOS_AEL115C"
FT                   /product="AEL115Cp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS52570.2"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001DB2A5A"
FT                   /db_xref="UniProtKB/TrEMBL:Q758E1"
FT                   /transl_table=1
FT                   /translation="MVETADVTHFVQPRVATEEIVPQQDASSTMPGLSMESRSLCKNIM
FT                   RAEWAQESGRQLRGRKLEGRTTKGKYTLYDFQILRTLGTGSFGRVHLVRSNHNGRFYAM
FT                   KVLKKHVVVKLKQVEHTNDERKMLSVVSHPFIIRMWGTFQDAHQVFMIMDYIEGGELFS
FT                   LLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKLTDFGFAK
FT                   YVPDVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGILIYEMLAGYTPFYDQNTMGTYE
FT                   NILNAEVKFPPFFNAEVRDLLSQLITRDLSKRLGNLQNGSQDVKAHPWFSEVIWDKLLC
FT                   RNIETPYEPPIHAGQGDTSQYDRYPEEDANYGALGEDQYQALFSDF"
FT   CDS_pept        complement(406336..408108)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929710"
FT                   /locus_tag="AEL114C"
FT                   /orf_name="AGOS_AEL114C"
FT                   /product="AEL114Cp"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAS52571.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058979"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0000252CF6"
FT                   /db_xref="UniProtKB/TrEMBL:Q757X6"
FT                   /transl_table=1
FT                   /translation="MKSYIIKPRNCFLHLLSPSVYWRPVLETFTQKKSMTQVSRGGDET
FT                   ATIASDEYMEAEPLLPLSEPRWPTADDSYCETTLGTLYEEEHIKSNASAGVTGQGTVRQ
FT                   AHVQRAEAIEGPTRFPLTQNIYFICFLICVGCGSGGVLLTPTVTLSLDKVCEYLAPDGS
FT                   TIGCDRTQVQEVLSNIDKKVSPIRGILCMLMSAWLGRLSDRIGRKPIFLYMGVIQLMYL
FT                   FLWYIFFFQKAIPFSKSVMIFVRSFDALGGGVMTLLATGNSYVSDFATAETRTVYMTAI
FT                   TSVIYAVAGAGPLFSALFTRITQKYQSISFCVALACCGLFIAASLVIKEPRRSKRWQES
FT                   GSDFAQQGLPLDRQYASFRGFLKHHAMAIVNHVKGLFAPFSSLCAQEGNGSSLLSPWAV
FT                   ILLVLISLVFGPISQSLTSVLVLYAIFEYHWADERLGYFVSLLGICHAVFLWFSPGILR
FT                   AMRRRHSTDPRHLDRIDILCIRGSLWAGLAAAALLAASRHESTLYVYGVVHAFSGLLYP
FT                   TINSALLKFAPPEATGALLGAMSMLISMASMVLAPLFFSLYEHTVAYRPEIFIYLGLIM
FT                   MTLCTASGHFLKES"
FT   CDS_pept        complement(408301..411078)
FT                   /codon_start=1
FT                   /gene_family="HOG000170818" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756923"
FT                   /gene_name="MCD4"
FT                   /locus_tag="AEL113C"
FT                   /product="GPI ethanolamine phosphate transferase 1 "
FT                   /EC_number="2.-.-.-"
FT                   /function="sulfuric ester hydrolase activity"
FT                   /function="transferase activity"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /biological_process="cellular cell wall organization "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS52572.2"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0008484"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG524563"
FT                   /db_xref="HOGENOM:HBG609268"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR007070"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR017852"
FT                   /db_xref="UniParc:UPI0001DB2A5B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757X5"
FT                   /transl_table=1
FT                   /translation="MWNKHRLAFILVGLLFHLFYLRSIFDIYFVSPLVHGMRQFKSNEE
FT                   PPAKRLFLIVGDGLRADTSFDKVKHPVTGKTEFLAPYLRSLVEHNATYGISHTRMPTES
FT                   RPGHVAMIAGFYEDVSAVTKGWKENPVDFDSVFNQSTHTYSFGSPDILPMFKSGASDPT
FT                   KVDAWMYGHEFEDFTQSSIELDAYVFRHMDALFRNATVDSKLRHEMMQDGNVFFLHLLG
FT                   CDTAGHSYRPYSAEYYDNVKYIDSQLERLVPKVREFFGDDDTAFVFTADHGMSAFGSHG
FT                   DGHPNNTRTPLVAWGAGLNRPVLNDVPVYDNYTENWDLAHVRRNDVNQADIASLMSYLI
FT                   GLNYPTNSVGELPLAYVNGTERTKLNALYKNALSILEQYLVKETEMIQSQLVYKEYPKF
FT                   AQKSHSSYIQEIEHLIDRIANGEEDLEPEAIALSEELMKTALEGLQYLTTYNWRFIRSI
FT                   VTLGFIGWITYSFTIFLRLFILEKQYAMKTSPQNLASFGALTAALNYVLYYQRSPFNYY
FT                   MYLLFPLFFWSQILTNSTILHDGIREMFKGVSMLQRIGICALIVSIYEGIVYGYFDRWI
FT                   FTIIFNLLALYPFFCGIKDAKTNMFWGANSMALSIFTLFDAVKIESLTQINVSGLLLVA
FT                   SGLYALWRVSKKINSHTKIVILLQILLLAMMLAVTNKSVTSLQQRAGLPTDAKIAGWVI
FT                   LTLSLSLMPLLHYLKPSNDYQVRVLVIYLTFAPTFLILTISFESFFYLLFTNYLMLWIE
FT                   IESKIKAQNIAKNSQNWLQLLRISIIGFFLLQFAFFGTGNVASISSFSLDSVYRLMPVF
FT                   DPFPMGALLILKIMIPYILLSTALGIMNLKLNIKDYTVSSLILSTSDVLSLNFFYLLRT
FT                   EGSWLDIGVTISNYCLAILSSLFMIVLELFSHFLLKNVRDNGMDIAASKQQKRH"
FT   CDS_pept        complement(411321..412928)
FT                   /codon_start=1
FT                   /gene_family="HOG000113133" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756924"
FT                   /gene_name="JJJ2"
FT                   /locus_tag="AEL112C"
FT                   /product="J protein JJJ2"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52573.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG058980"
FT                   /db_xref="HOGENOM:HBG103537"
FT                   /db_xref="HSSP:1HDJ"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI0000252CF8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757X4"
FT                   /transl_table=1
FT                   /translation="METARIRLDETTYYSLLGLPFGASELHIRKAYMRLARELHPDKSK
FT                   SKEAAELFKVVAHAHSVLTDKEKRLKYDRQLIAKGLHTYVSNSSSSLNYKPPGSRPVTR
FT                   AQQAAVAADKERAAKKAKPYEEQPYGFGTEAESSPQAGDGTPQRSTTATKPFKAKSYQH
FT                   QRNPGTPPETGNKKSSTFSARFISNSVPAAPESKPSDEYPAKKMPRKQATPEPSSSPFL
FT                   SPDHRHYARTKFESRRRGTRSASPLKTMPTSQTDTLDGLKSIINKFSDRVKVNIFGSPS
FT                   TVETEHVTDLSEDQSSVEQDGGDEARLRADMLAGDKATARCAPIPQDGTKEINLEELNT
FT                   SLPPQRETFNMRNVSDTLDRMNVKRQKLNTEATHVPGNIPLPAQRHLSPALDESGSLAE
FT                   PVNKSIPRVYKIDRIPPTEFAMDLSVSDIELPTMPSFHCNILDKSDIKLCREKILEFNT
FT                   KANRLKKQLIQALSLRSSADEALENRVVRVENMAAYVEAKNYDLDVVMKLHEIQNRQRI
FT                   VAESFTNLMRSAYASGTF"
FT   tRNA            complement(413047..413120)
FT                   /gene_name="tRNA-Asn"
FT   CDS_pept        413543..414073
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059091"
FT                   /locus_tag="AGOS_AEL111WA"
FT                   /product="AEL111W-Ap"
FT                   /protein_id="ADJ41771.1"
FT                   /db_xref="UniParc:UPI0001DB2A5C"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGC8"
FT                   /transl_table=1
FT                   /translation="MLIETQVATRRRVPRRRAIGLPHLVKIIRPDTMSDAGEFTVSIDI
FT                   PNRMRQVHESFLCQRAMPSLTSMNSNISDEDYEHDLVLALRESCVCHNPIETIAVEQDF
FT                   TIPTSYFTDEDVFAFGDGFDFPPLFLHNELHSVLVAPADLALGSAGAGFRPYADCPIAM
FT                   LQGAAVSFAAEFY"
FT   CDS_pept        complement(414629..415675)
FT                   /codon_start=1
FT                   /gene_family="HOG000248193" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756925"
FT                   /locus_tag="AEL111C"
FT                   /orf_name="AGOS_AEL111C"
FT                   /product="AEL111Cp"
FT                   /protein_id="AAS52574.1"
FT                   /db_xref="HOGENOM:HBG058981"
FT                   /db_xref="HOGENOM:HBG626440"
FT                   /db_xref="InterPro:IPR000420"
FT                   /db_xref="UniParc:UPI0000252CF9"
FT                   /db_xref="UniProtKB/TrEMBL:Q757X3"
FT                   /transl_table=1
FT                   /translation="MQIKKSALAATALFASSALSSYVAGDPWDTLTPTGTYSGAITSYA
FT                   STFGIAVVPLATEKASKAKRAVPVSQIGDGQIQATTKTTVPAVSQIGDGQIQATKTTVP
FT                   AVSQIGDGQIQATKSTVPAVSQIGDGQIQATTKTTVPAVSQIGDGQIQATKSTVPAVSQ
FT                   IGDGQIQATTKTTVPAVSQIGDGQIQATTKTSVPAISQIGDGQIQATRSTTTLSNPASQ
FT                   IGDGQVQATTAPAHDDKHDSKDPVTAVSCRSEGTLELTLKDGVLYDGAGRIGAIVANRQ
FT                   FQFDGPPPQAGAIYAKGWSITQEGNLALGDNDVFYQCLSGSFYNLYDENIAPQCSPIKL
FT                   QAIDLVTC"
FT   CDS_pept        416817..417563
FT                   /codon_start=1
FT                   /gene_family="HOG000248193" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756926"
FT                   /locus_tag="AEL110W"
FT                   /orf_name="AGOS_AEL110W"
FT                   /product="AEL110Wp"
FT                   /protein_id="AAS52575.1"
FT                   /db_xref="HOGENOM:HBG058981"
FT                   /db_xref="HOGENOM:HBG626440"
FT                   /db_xref="InterPro:IPR000420"
FT                   /db_xref="UniParc:UPI0000252CFA"
FT                   /db_xref="UniProtKB/TrEMBL:Q757X2"
FT                   /transl_table=1
FT                   /translation="MQVRNTIAASTLLASTAMSAYIAGESWDGLMPENVYEGGITDYPS
FT                   TFGIAVVPLTPRVFDGSKKRDLSAVEQIIDGQVQSKSDSVPASGAVAQIGDGQVQAITL
FT                   KQPQNGPESQPDESSDKRCPTPAELENILASASAERDPSDPVNAYSYRYEGTLEMSLND
FT                   SVLRDGHGRIGSIVSSRQFQFDGPPPQSGAIYAKGWSLTPEGNLALGDTDIFYRCLSGN
FT                   FYNLYDQSIGGQCSPVHLQAINLISC"
FT   tRNA            complement(417636..417707)
FT                   /gene_name="tRNA-Cys"
FT   CDS_pept        419410..420699
FT                   /codon_start=1
FT                   /gene_family="HOG000171827" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19776998"
FT                   /locus_tag="AGOS_AEL109W"
FT                   /product="AEL109Wp"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52576.2"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG390350"
FT                   /db_xref="InterPro:IPR002164"
FT                   /db_xref="UniParc:UPI0001DB2A5D"
FT                   /db_xref="UniProtKB/TrEMBL:Q757X1"
FT                   /transl_table=1
FT                   /translation="MASPIKTKNQIDGAPTPQNTPASVLKESYLKNGNPLQTQQATTSV
FT                   PQTINEEEINAALAKNPQLLATIQGKLGSLLGQDSGYIASLPRKVKDRLYALKKLQQDI
FT                   FQLEKEFQLEMFQLEHKYLLKYAPLHARRAAIVKGADEPTPAEVEAGRLIEKENETPAI
FT                   IDDDADEGDESDDAEDETGTPGVPGFWLTALENLPMISQTITDRDAEVLHYLANVSMEY
FT                   LTEGKPGFKLLFDFAPNPFFADPVLVKTYYYQPELGYSGDFIYDHAEGTPIQWASHEAN
FT                   VTVVVEKRKQRNKTTKQVRTIEKLTPVESFFNFFDPPAVPPADESLDADDDDEEVVGLE
FT                   SRLALDYAIGEEIKDKLIPRAIDWFTGVAREFDYDDDEDSDAEGHFDDEDSDVDDDDDH
FT                   PAEAADESEDDDFAASETRPGDNPPECKQQ"
FT   CDS_pept        420989..421975
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624442"
FT                   /locus_tag="AEL108W"
FT                   /orf_name="AGOS_AEL108W"
FT                   /product="AEL108Wp"
FT                   /protein_id="AAS52577.1"
FT                   /db_xref="HOGENOM:HBG058982"
FT                   /db_xref="HOGENOM:HBG104160"
FT                   /db_xref="UniParc:UPI0000252CFC"
FT                   /db_xref="UniProtKB/TrEMBL:Q757X0"
FT                   /transl_table=1
FT                   /translation="MAKTQTLNVAKNSQTASVAKLVADSPTLSHLQRYGAADALGRWLP
FT                   WTLVSTVATLVVAVLATAKQYLVDAPGTPAAVKGAWVRLLAGAQALDAAVSTLVLRDGV
FT                   DAFREQYVQHGTVGLWAAYFALDFTANVSNYVLRGLVRPLRVAYEPRREEATTPASSAG
FT                   SDMPHLRELTNTTNALRRDISSKYIEPTRSMIESYLEPTRTKIEAEYIHPINERVESTK
FT                   TLLNSTYDAAYETVSRTYEGNLSSHESVSRALVSTGVDLGSKTLEKIRAVTRSADGQPT
FT                   ETVNGAGTNGTHKTNGVAHGANGIHRAGIKAHANGNGKAAAGDENAA"
FT   CDS_pept        423112..425781
FT                   /codon_start=1
FT                   /gene_family="HOG000196946" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15757967"
FT                   /locus_tag="AEL107W"
FT                   /orf_name="AGOS_AEL107W"
FT                   /product="AEL107Wp"
FT                   /protein_id="AAS52578.1"
FT                   /db_xref="HOGENOM:HBG266354"
FT                   /db_xref="HOGENOM:HBG317989"
FT                   /db_xref="InterPro:IPR005378"
FT                   /db_xref="UniParc:UPI0000252CFD"
FT                   /db_xref="UniProtKB/TrEMBL:Q757W9"
FT                   /transl_table=1
FT                   /translation="MSYAESVEQATGVIKQQTVLIQRHLAQRKLLDALKHISIMLTELR
FT                   NPSLTPKQYYELYILVYDALSVLSQYLVENHPKRHHLADLYELVQYAGNILPRLYLMIT
FT                   VGTAFLQIKDSPREEILKDMIEMCKGVQNPVRGLFLRYYLSQRTKEWLLPQNGPAGNAS
FT                   EGRSQENVENNVKKFNVEFIINNFIEMNKLWVRLQHYGPLRERELRTKERRELQILIGS
FT                   NLVRLSQIVEDDSKLYAEVILPQLLDQIVQCRDVVSQEYLLDVICQVFPDEFHLATLPT
FT                   LLETTLKFNPDVSINKVVSNLVERFNGYVERQSGDIDSVQNTFRKLCIQGQPTSASGDT
FT                   ISSSGGLFFVFWRYLEKLSEQRPDLPLNDLFPLVQGILKLSLTWYPDVLSNVDCLFKFT
FT                   VRKCQENGGPDANPDYEYLFQDLLLSMTSSSMFYRVLTECESYQKLLSMQPVGLQKLVV
FT                   NCILDTIFKAGITITNRIHLEKILLLCESLIKVNNPKIHNSGEDAEQHSAQDDDPTSCL
FT                   LNIEQEKLAQVVHICRSQSIEKQVELLLTCKSWFYKGGIQMRYTYPAVVTAFWKLIRKT
FT                   DIKKSKYPSREKKYRQLIKQLFKYVSRCLSELGNTVGAPCADLVFKMNLQSAAIADHLG
FT                   LSEISYDFFTQVFTIFEESLSDSRSQFQAIITMAQTLQKTRSLYVENYYDSLITRCTLY
FT                   GSRLLKKQDQCRAVYLCSHLWWATEIPLIGEEEGITDTFYREGKRVLECLQRSLRVADS
FT                   IMDNVQSCQLMVEILNRCCYYFVHGDESATHVGPKYINGLIELIETNLKSLKIEESVEF
FT                   AESKLPKPSYANFVVGVDGSYIQVPTSPTATVAAVMSKPPNITISSLVPIVTGYLQRTL
FT                   NYIEDQKVVDDRFRAIIV"
FT   CDS_pept        join(426105..426128,426177..427472)
FT                   /codon_start=1
FT                   /gene_family="HOG000181112" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929966"
FT                   /locus_tag="AGOS_AEL106W"
FT                   /product="AEL106Wp"
FT                   /function="6-phosphofructo-2-kinase activity"
FT                   /function="ATP binding"
FT                   /biological_process="fructose 2,6-bisphosphate metabolic
FT                   process"
FT                   /protein_id="AAS52579.2"
FT                   /db_xref="GO:0003873"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006003"
FT                   /db_xref="HOGENOM:HBG058567"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR003094"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR013079"
FT                   /db_xref="InterPro:IPR016260"
FT                   /db_xref="UniParc:UPI0001DB2A5E"
FT                   /db_xref="UniProtKB/TrEMBL:Q757W8"
FT                   /transl_table=1
FT                   /translation="MPVYTVSNVQNLKICVVMVGLPARGKSFISQKIVRYLSWLSIKAR
FT                   CFNVGNYRRQAGAAKPSAEFFASDNAMGMKVRRQAVEQAVADMNRWFFEEDGIVGILDA
FT                   TNTTHERRDWILKMCRENGIEPMFLESWCNDQDIILRNILEMKATSPDYEGCDPEDARR
FT                   DFLERIAKYEDVYEPLDETRDQDLTFVRLINVAQQVIINRIETYLESRIVFYVMNLHIK
FT                   PRVIWLSRHGESVYNLEKKIGGDSHLSPRGLEYARKLPELVRESAGNVDLTVWTSTLVR
FT                   TGETAQFLPYKQLQWKALDELDAGVCDGMTYEEIEEKYPEDFKARDEDKYEYRYRGGES
FT                   YRDVVIRLEPIIMELERQENILIITHQAVLRCIYAYFMNVPQEESPWVSIPLHTLIKLE
FT                   PRAYSTKVTRVKANIEAVSTYKEKGTSRVGEPSQDRRPLQ"
FT   CDS_pept        427951..429960
FT                   /codon_start=1
FT                   /gene_family="HOG000142023" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081283"
FT                   /locus_tag="AEL105W"
FT                   /orf_name="AGOS_AEL105W"
FT                   /product="AEL105Wp"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS52580.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG058983"
FT                   /db_xref="HOGENOM:HBG202286"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR012985"
FT                   /db_xref="UniParc:UPI0000252CFF"
FT                   /db_xref="UniProtKB/TrEMBL:Q757W7"
FT                   /transl_table=1
FT                   /translation="MVRGLFGFGKRSGQDRNREPERRKCDEEDMLGEDPKQPILLSGKT
FT                   CESVQSSSIFSRGLRTCGTDISTSGAFSESGARVDKDIGKPLRVTGVGTALGTVAEHEE
FT                   GSQTLGLVPSGTDSTGDAYEETHPDRRGAGQLETELQELGDKLDSVMDEIVQNVTNVSK
FT                   AVIQAIEHFKNFLEQAEGCHYGVSTEHSAAFRRITKIVLHFQDNLLQSDVFSNSRAILL
FT                   RWYIKFLTSLNLEVHDLPPADVKRMPLPSLKIYAIGQDCNLPNRDKISTIIEEIAGAND
FT                   SSISDQEGAFIAPVLRGLDKNSAILTILFGFPRPQQAHYEMVKVLYSLFRDVHFYCVKD
FT                   YITPCAANVAPNVVPSSIPMQAFSPQRTQFIPPYTLPSDVMAPPMSMSLSSEDSVSMTG
FT                   TLGGYLFPQIPESEEHLSGFAGAAFGITCAHVVLTESQDHPYVSVPSRVLQNIYKKTLK
FT                   EELTRYPEGSIERLSFEDEISRIEQNLEWQQENKFGQVVWGERSIVKQKLSDFAIIKLN
FT                   PKIRCRNYLGDDLSGIPDPVLRFKNLYVRKKLMTLRPGLEVFKVGASSKYTRGTVNGSK
FT                   IVYWADGKIQSTEFVISSPQPFFATGGDSGAWLLTKLDDELGLGVVGMLHSYDGEQKQF
FT                   GLYTPIADILERLHDVTGVIWDIDQPPELSKYID"
FT   CDS_pept        430441..433698
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929967"
FT                   /locus_tag="AGOS_AEL104W"
FT                   /product="AEL104Wp"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS52581.2"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058984"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0001DB2A5F"
FT                   /db_xref="UniProtKB/TrEMBL:Q757W6"
FT                   /transl_table=1
FT                   /translation="MSSLNVDGTANFTTPVIEYYAKFMHSPPSRDSVSGTSPTTKFLKT
FT                   LSGGSIRRLSSKFRPHSRNSGLQQQQISYPQPVNRTLPVIHGPSGAAPVSLQKLGSTTM
FT                   QGKKRPTPLNLKMVSQPLAVQKTSSDASKPKLGSPMKLRPPSKMQTNDLRSSGKTLVDD
FT                   QGLRLSIQQSALSNSNRSPDTYAGRISTNYASIHRRHTITSAINGGKRYNSNACSICGE
FT                   NLNALLAGERIVELTCDHQSHYHCYFTLLEVSVQNDKYPRCQLCGQERKPKSDEILTDM
FT                   KSSILLTKPLRSTQGSSISAQVLGPTSATGEKPLVDIYTPCEQLLKSADVGSNGFCSSY
FT                   NDSMYCANTSDEVTLEYPLSATDSNPDSRSPTPSEGDCLKVNVIPQMNKLMVDDTLDEV
FT                   IVPFVLNCFVPGVKKEDIDAECLADQSLRADVNEYISNKFSLHLNGSSPLRLFDRLNYS
FT                   LDGNQWTHVVVYCFEKCLLLVEQEHTDVEPVIIGKIPMEHLSRLYKYNSNTIILDLKSI
FT                   SLPEVYLQDLKGSAALINKWHFYLSNAQSRVPVALQTTNCWQLLPQHILDKVPKELISY
FT                   NQLTGDALGLTASLHNSTISGNRGINSCGKSSKLQIVVAVSLFNCQPELHSNEELLKII
FT                   QQQLRSLKYSLHEDDLLGIVVAAKEGFNNGRFYGMVSKNWELWDEIIDDMRVTESDNGH
FT                   VSDIIDLHYIMEASSRLLSMVEGSSDYIRQLVILSNDYQAHSPAEPSDIPPGIYQRLEQ
FT                   FTSRAIEEYKFSITQLVTKNSHAILRNYVNGAHYNITTEPVEHLTDINCQELIHELHQK
FT                   SVPQVQIELQSFDQNIATFKSVENKGKLVPCLEASLLLQVGCLKPGESRSLIFEMRIDK
FT                   HGLRRFLADKHGLLTSSPDCAESPSLSLVHCHYAPAFSRERRRAACSGVAFSFNFCRRG
FT                   CSPIVSLVASPVSPDPAAAGALEAPEDDLYVDIPLVAPLSPARDAVFVGRQIQLLVVDA
FT                   LGRLGVETPRSMPCVSPARLRELVSVLFGMSRDCACTVPAYVREAHPTLAIHQQTEALC
FT                   KKLEQIVDAYEHGGRDTDAAGIPHWAQLARALYLSLM"
FT   CDS_pept        434357..434932
FT                   /codon_start=1
FT                   /gene_family="HOG000248193" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15757968"
FT                   /locus_tag="AEL103W"
FT                   /orf_name="AGOS_AEL103W"
FT                   /product="AEL103Wp"
FT                   /protein_id="AAS52582.1"
FT                   /db_xref="HOGENOM:HBG058981"
FT                   /db_xref="HOGENOM:HBG626440"
FT                   /db_xref="UniParc:UPI0000252D01"
FT                   /db_xref="UniProtKB/TrEMBL:Q757W5"
FT                   /transl_table=1
FT                   /translation="MQFKTTALSTLLYAAAYVAAQEENSSSWTTLSHTATYTGVAVTDY
FT                   ATTFGIAVQPITTSVSEAPKEHKEKPTSTCDGPVATAKPEIDVKVSACANEGTLRMTLT
FT                   DGILYDGRGRIGAIVSNRQFQFDGPPPQAGSIYAKGWALTEEGNLALGDSDVFYQCLSG
FT                   NFYNLYDQNIAPQCSPIKLQAIKLVDNC"
FT   tRNA            join(435565..435601,435620..435664)
FT                   /gene_name="tRNA-Ser"
FT   CDS_pept        435787..436356
FT                   /codon_start=1
FT                   /gene_family="HOG000183747" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15757969"
FT                   /locus_tag="AEL102W"
FT                   /orf_name="AGOS_AEL102W"
FT                   /product="AEL102Wp"
FT                   /protein_id="AAS52583.1"
FT                   /db_xref="HOGENOM:HBG296796"
FT                   /db_xref="HOGENOM:HBG499799"
FT                   /db_xref="InterPro:IPR006596"
FT                   /db_xref="InterPro:IPR006984"
FT                   /db_xref="UniParc:UPI0000252D02"
FT                   /db_xref="UniProtKB/TrEMBL:Q757W4"
FT                   /transl_table=1
FT                   /translation="MGRAKKTRKFALVKRTLNAKKDTRIKANAEKEAKKDDPELTKHIP
FT                   QVSSALFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCVPLITDCVMA
FT                   ELEKLGPKYRIALKLARDPRIKRLNCSHKGTYADDCLVNRVLQHKCYIVATNDAGLKQR
FT                   IRKVPGIPLMSVGGHSYVIEKLPDVF"
FT   CDS_pept        complement(436424..436963)
FT                   /codon_start=1
FT                   /gene_family="HOG000176500" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081284"
FT                   /locus_tag="AEL101C"
FT                   /orf_name="AGOS_AEL101C"
FT                   /product="AEL101Cp"
FT                   /protein_id="AAS52584.1"
FT                   /db_xref="HOGENOM:HBG058985"
FT                   /db_xref="HOGENOM:HBG395386"
FT                   /db_xref="UniParc:UPI0000252D03"
FT                   /db_xref="UniProtKB/TrEMBL:Q757W3"
FT                   /transl_table=1
FT                   /translation="MMLLASVPLSYLYRRFVGKYKLEMEDPYFEEVEFEKRPFWGGSTK
FT                   VVKRRREKVIPDHIPKRDKNVLQRLKKRAYGMDMAFSLCGLRFGWLGILGMLPVVGDIA
FT                   GVVMSLLTLREANGVQGGLPMGVVLAFLLNIVVDFVVGLIPLVGDMISIAYKANSRNVL
FT                   VLERYLSQKYAKQHAD"
FT   CDS_pept        437279..438136
FT                   /codon_start=1
FT                   /gene_family="HOG000000883" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15757970"
FT                   /gene_name="YNG2"
FT                   /locus_tag="AEL100W"
FT                   /product="Chromatin modification-related protein YNG2 "
FT                   /function="zinc ion binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="meiosis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52585.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0007126"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="HOGENOM:HBG058785"
FT                   /db_xref="HOGENOM:HBG396187"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI0000252D04"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757W2"
FT                   /transl_table=1
FT                   /translation="MSFERPQDPSSALEQATQDVSNLKSESRFLLEEIRASDLEFYESK
FT                   KRFLNKDTQIHKFIKQHGSLVDNPKEAEFQERIKEDLERCHQLQVDKCTVANSLLYMVT
FT                   KHLKKVQANIEALEEDGLLAPLEDDAVELANELSRESSVLSSGTSLERRKRTVAAGTLS
FT                   AGSSLRKRVKKERGRSTQRDGMLSEPPSDEASSHGANFADDLQDFNDELFSLNQQEEDD
FT                   KQLYCFCQSVSYGEMVACDGPNCKYEWFHYGCVNLDEPPKGQWYCPECRQEMANLKLKK
FT                   KKRV"
FT   CDS_pept        438419..440422
FT                   /codon_start=1
FT                   /gene_family="HOG000177026" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081285"
FT                   /locus_tag="AGOS_AEL099W"
FT                   /product="AEL099Wp"
FT                   /function="antiporter activity"
FT                   /function="drug transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS52586.2"
FT                   /db_xref="GO:0015238"
FT                   /db_xref="GO:0015297"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG334116"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniParc:UPI0001DB2A60"
FT                   /db_xref="UniProtKB/TrEMBL:Q757W1"
FT                   /transl_table=1
FT                   /translation="MVGLTETISKAFNDVRPTLRSVGVANNHRHISLGLLPPNRKNPLV
FT                   RKYRKKARLHETDRGSFYSLDEDFGSVMGADPSMLDVTAEEEGVLDGGELSRTVSLPST
FT                   LASEAGPSSALNVDWILEEHERRYSTVNGSAEDIVAVDVEGAAPDMVHYTHFMHRVKQQ
FT                   LPSDKAEVRVLRPRKLSYYSIGSKGGPSSAFRGSEDLDDEPATVKSESLVLLCYSVPLI
FT                   FTFLLEQMFPVVCALVVGHLGKNELAAVSLASMTTNITFAIFEGISTSLDTLCPQAYGA
FT                   RNYYGVGLHMQRCVLFSLAFFVPFAALFWFSEGILPYLIKEKSLVPLTSQFLRVMIVGG
FT                   PGFILFENLKRYLQAQGIFDAGIYVLLICCPLNIVMSYLLVWNPVIGLGFIGAPIAVAL
FT                   NFWCMFLLLLLYCIYFNGSKCWGGLSRKAFDHWKDLSKLAVPGIIMLEAEDMSYEILTL
FT                   FSSYLGTEYLAAQSAVSTTVAMLYMIPFAVGISVSTRIAQYIGARNPDNARLASRVGIA
FT                   SSAVVGIVNCTMLILGRDLIPRIYSSDAEVIRLMREILPLLGLVEIFDALNAIAGSCLR
FT                   GQGMQYVGSVVNLVVYYLFAIPLGMLLSWTFDMKLSGLWVGIGSGMLVIGLIEGYYVLF
FT                   ADWDMLIDRAEMLKETEDDSDEEVDEFSALLP"
FT   CDS_pept        440701..442164
FT                   /codon_start=1
FT                   /gene_family="HOG000246301" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15757971"
FT                   /locus_tag="AGOS_AEL098W"
FT                   /product="AEL098Wp"
FT                   /function="homoserine O-acetyltransferase activity "
FT                   /biological_process="methionine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS52587.2"
FT                   /db_xref="GO:0004414"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009086"
FT                   /db_xref="HOGENOM:HBG055311"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="UniParc:UPI0001DB2A61"
FT                   /db_xref="UniProtKB/TrEMBL:Q757W0"
FT                   /transl_table=1
FT                   /translation="MTSFLYSGKRFIAKAAGRSTNPQMSFPCLDKLDALTAKLKENRIG
FT                   SINGGSTVGDFYGTLADNEPVYGNVKSGYQLYSCEEPLLLDYGGVLLGFRIAYETWGTL
FT                   NAERSNAVLLHTGLSASSHARSSELNGIPGWWEKFIGPGSKILDTNRFFVVCTNVLGGC
FT                   YGSTGPSSADPADGEPYATRFPILSIQDIVRAQHKLVRECFGIEKLYASVGSSMGGMQS
FT                   LAYGQLFPSDVEKIVSISACAQSDPSSIALRHAQRQVLMADVNWNRGLYYPSEKYPDRI
FT                   PPHVGMKLAREIATVTYRSGPEWESRFGTERLDPDGTPTLCPDFLVESYLNHQGEKFSL
FT                   EYDANSFLYLSKTMDLFDLSASHLRRSQQKRMEAAVRLKRGTLSNTSSVYAEPPTKKKS
FT                   RTISIEENHRDLVEGMAPLRDKDILIIGVQSDALFPAAQQRKIVELLGNSRGVHYIELT
FT                   QEQSIFGHDTFLLDTEHIGLPIGKFLSGT"
FT   CDS_pept        complement(442327..443172)
FT                   /codon_start=1
FT                   /gene_family="HOG000248865" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15757972"
FT                   /locus_tag="AEL097C"
FT                   /orf_name="AGOS_AEL097C"
FT                   /product="AEL097Cp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS52588.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG190303"
FT                   /db_xref="HOGENOM:HBG397843"
FT                   /db_xref="HSSP:1AB3"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniParc:UPI0000252D07"
FT                   /db_xref="UniProtKB/TrEMBL:Q757V9"
FT                   /transl_table=1
FT                   /translation="MLSRDLVRMSLSSVRAFSSTSVACSTKAVRALRAQKIRQANQAKQ
FT                   NKLKSSLGAVDPVLGRKDTPFVVRMLAELREPHVLVNDYKTEEVDKMMASIEAARRERM
FT                   QLSGMETFAGSNFDAASIAARREAVMRILNMRNADQATAVKRATRLAMEEFQRFPGDTG
FT                   SSEVQAAVLTINIQKIAAHVKDNKKDNLNTRRLRMLVQQRQGILRYLKRDNPQRYYWTI
FT                   EKLGLDDNAVEMEFNMDRRYMQDYKFFGDRILIKDSKKVASAKRRASRKERKLAAAAMQ
FT                   "
FT   CDS_pept        443823..444461
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20624443"
FT                   /gene_name="GAR1"
FT                   /locus_tag="AEL096W"
FT                   /product="H/ACA ribonucleoprotein complex subunit 1 "
FT                   /function="pseudouridine synthase activity"
FT                   /function="snoRNA binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="box H/ACA snoRNP complex"
FT                   /protein_id="AAS52589.1"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="GO:0030515"
FT                   /db_xref="GO:0031429"
FT                   /db_xref="HOGENOM:HBG058986"
FT                   /db_xref="InterPro:IPR007504"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR021154"
FT                   /db_xref="UniParc:UPI0000252D08"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757V8"
FT                   /transl_table=1
FT                   /translation="MSFRGNSRGGRGGARGGSRGGRGGFGGRQFQQGPPDSVVEMGAFM
FT                   HDCEGDIVCRSINTKIPYFNAMIYLENKTEVGKVDEILGPLNEVFFTIKCAEGVKASSF
FT                   KDGDKFYISPEKLLPIERFIPKPKVAGPPKPKRKRAAGGAPGRGGFGGRGGSRGGFGGR
FT                   GGARGGFGGRGGARGGFGGFGGRGGSRGGFGGRGGARGGSRGGRGGKRF"
FT   CDS_pept        complement(444634..445710)
FT                   /codon_start=1
FT                   /gene_family="HOG000065937" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15757973"
FT                   /locus_tag="AEL095C"
FT                   /orf_name="AGOS_AEL095C"
FT                   /product="AEL095Cp"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS52590.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG124132"
FT                   /db_xref="HOGENOM:HBG203258"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="UniParc:UPI0000252D09"
FT                   /db_xref="UniProtKB/TrEMBL:Q757V7"
FT                   /transl_table=1
FT                   /translation="MAATRRSANCLQQLRSYGIDVKQLVLNTKVNVPSKEATVKPSKVP
FT                   VTLSKPIPKATTSISMQLFEEYNPGIVLPKAADMSLISRFFNSSKVKFEWCAREYLEIP
FT                   GERYKIEQAQLQQQELLDEKSFNESLDIREPTEAYRVSADIKNRPIPNTEQLTRGSFLL
FT                   HDELPEIIFLGRSNAGKSTLLNNLTTNFKQVQLNRHATTSKKAGHTRALYCYNVGNRLR
FT                   LVDSPGYGVMSTQQQGECTMQYIRERKQLRRCFMLISAKDGFTKTDYGMLEFLMNYGIA
FT                   FEVIFTKMDKVRDVKTLRDSISTSGILDAPIRPRLMFLNSVVNKAYPKRLGIAHLRQTI
FT                   FEACNIKPNTLPSKAYKQ"
FT   CDS_pept        complement(445920..449585)
FT                   /codon_start=1
FT                   /gene_family="HOG000248154" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624444"
FT                   /locus_tag="AEL094C"
FT                   /orf_name="AGOS_AEL094C"
FT                   /product="AEL094Cp"
FT                   /function="binding"
FT                   /protein_id="AAS52591.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG058987"
FT                   /db_xref="HOGENOM:HBG397066"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0000252D0A"
FT                   /db_xref="UniProtKB/TrEMBL:Q757V6"
FT                   /transl_table=1
FT                   /translation="MDTNGAGHIVSALEIIYSPKSSNQQRLEAQKFLDQVKEHGESPFW
FT                   GYEIALNNGQNSILKHFGLGLLVHALQRHWKDYDPEKRVALRKWVQELNYHVTPEDPRY
FT                   IKEKLAYLWVEVAKRVWGEALKGDEVSEHALMESWVDMDRNLAELWHMSEASRELTLII
FT                   FRTLFEDTFLLEDLTVLKRISVVQPLCIMILCPLDLFSEHYKHTDKWQLFKSHPEGWFG
FT                   IWVSDLLRSLETSNTQYTLRLLETLKTCLNWPISDVVVRYDILGALLKCLLSDIPRAQA
FT                   ISLDSIHILLTRPYNSHTHFDHIISKVFNSMSLLDKVYENLQFNPQHGVDESKYPIVKK
FT                   FADMITCLHKSILRFSADDKNVELYLRLVLKTTYNPSLIVSGISLDLWCTCIRNDEFLP
FT                   ILEKYVLSDLLEFSANALVHYEQIDGHISKHYADVDFQSISDYNAFCSTYRKRIRDVIR
FT                   LISCIQVDYVYDWLCARLNNYFGSAYGQEILSSTFLNHKAEPYWSSLSQLMIVECFING
FT                   CIRWKIWYTNEEDYNKKLEMILVKVETLSNQLISLNIRDPLLLKKQIQNFALFLTILKD
FT                   NVLFTLLEKIITSATMDYPDINIEDKTEKSDAVRELRYACGIELNRMALLMPDSLKDIY
FT                   SDLENVVAGIMPKLTSHETISFKSFLLSIALTSSMDDKDSRFSAIVDPELAAWSDKSTV
FT                   VGLTDLPWFLERLGIVKITEYFQKRGIDENSNLLAVQIDEEGKQLKVDLAKHWQTLFPV
FT                   RATRMFIHYSMQTVKANEDFLKLQELWKPRIVPIMPYILRLLYQLQSYHDPENWKELPI
FT                   VVQSFINCSTIERFWEAGATNKSKDEFIDEHMKALQTVRDFADSVGHIVRYTREYVLLI
FT                   LSGISSLGSIFYEIEDIPNLLMDSIAIYKPNSDDISPGVSTHGWKHIINVAIRPILKGC
FT                   PEQCAPAFMSRFLPKLFDTMAVILCKKWSAYMNNTNMSPSPVDDDEMTEEILEENLLRQ
FT                   LTTVVVRLLIDCVGQVGTSSQVTKLKLSPHQIKMRRVIFGDINVMASYLKLLNCLISFR
FT                   DSKCSFNAILIMKGSLTETLIKHEDVDNFYITEILPNFLMNVLTQNAFKDSFHEAMYVF
FT                   TVAFLTLCKERESCRTYFYDLSRGYDINSLYENLRRVDNYKDQKVLMVDFIEWIKAVKG
FT                   DPEDVNEDDNKKRERREAVLARANERLIKKNKDQGDMLDDPNTEDGAFGRLFDDH"
FT   CDS_pept        complement(449952..450830)
FT                   /codon_start=1
FT                   /gene_family="HOG000172062" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15757974"
FT                   /locus_tag="AEL093C"
FT                   /orf_name="AGOS_AEL093C"
FT                   /product="AEL093Cp"
FT                   /function="ATP binding"
FT                   /function="aminoacyl-tRNA ligase activity"
FT                   /biological_process="translation"
FT                   /protein_id="AAS52592.1"
FT                   /db_xref="GO:0004812"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG055396"
FT                   /db_xref="HOGENOM:HBG601536"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniParc:UPI0000252D0B"
FT                   /db_xref="UniProtKB/TrEMBL:Q757V5"
FT                   /transl_table=1
FT                   /translation="MAAEDIRIKNKMKRKQLFAELKDKQNKERHKMRRLRAKEERENPA
FT                   LKEERLEKNVPKTIDSMRVFDESIGQDVEGEQDELQAFFNSGEPPKILLTTNVNARKKA
FT                   YEFANVLIEVLPNVTFVKRKFGYKLKEIAEFCNNRNYTDLVVINEDKKEVTGLTFIHLP
FT                   AGPSFYFKLSSYVEVEKIHGHGRPTSHIPELILNNFSTRLGKTVGRLFQSIFPQSPDIE
FT                   GRQVITLHNQRDYIFFRRHRYIFRNEEKVGLQELGPQFTLKLRRLQRGIKEETEWEYKP
FT                   EMDKDKKRFHL"
FT   CDS_pept        451943..453808
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929968"
FT                   /locus_tag="AEL092W"
FT                   /orf_name="AGOS_AEL092W"
FT                   /product="AEL092Wp"
FT                   /function="Rho guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of Rho protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS52593.1"
FT                   /db_xref="GO:0005089"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0035023"
FT                   /db_xref="HOGENOM:HBG058988"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="UniParc:UPI0000252D0C"
FT                   /db_xref="UniProtKB/TrEMBL:Q757V4"
FT                   /transl_table=1
FT                   /translation="MMDHNSDIDRTRREVLQELIHTEGDYVSMFGLFRESYLKVLAREE
FT                   EHVVFRSMEGVVKELVRWHRRMEFDLQRIMREHDPNSVETALRVSKLVVAYMARLEALY
FT                   RSYIYHFRASTRLFAEEAYYGKVMSELMGRLDHGVRTYQRTQFSGLEKRHLWQKDTSYD
FT                   CLSHLPISRLTNYKLFLEVIGKNVTSPVDKRRIAGYTRKASEIIHQINSDNSTMDPVNA
FT                   VIQRRLRFPTVEYAPVSAFGQCLLAGCLNAMWVRRRSSYGFAVTAEPLGAFLFKSYLIL
FT                   ADICHDWWTVKHCVPMVRCNIHDLTDVISVSDRDSPKLREAISEATSGSNTAPVEGTII
FT                   DTGNNPPMALKLEFYFYGQCFELTFAFRHAQEYQVWKQYLETVKELNGPSVSDFEQLTD
FT                   IGESTMVPRDMVPRTTVASRCPKVNELHNLTNAQRDMLKHSPSDYYGENSIQINVSFSG
FT                   SQRTQQKYQTLSRNKSDSNSYSAKFDSGRRLHIEALMFDVWSDALVRTPSLEYIMTSYS
FT                   DTITSVATTRPPSSTRSSWGMFSIRSDNTRATSILEPTNNQDLSSQQNNHNHTQTCNNC
FT                   SNTTNTTNGNNNKSGTIGRLGTINKLRNYLTVKTYNKQFSENQVA"
FT   CDS_pept        complement(454022..455851)
FT                   /codon_start=1
FT                   /gene_family="HOG000167783" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19776999"
FT                   /locus_tag="AGOS_AEL091C"
FT                   /product="AEL091Cp"
FT                   /function="RNA binding"
FT                   /function="hydrolase activity"
FT                   /function="pseudouridine synthase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="AAS52594.2"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG348956"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI00001B2433"
FT                   /db_xref="UniProtKB/TrEMBL:Q757V3"
FT                   /transl_table=1
FT                   /translation="MLKGVPGLLFKETQRHLKPRLVRIMENTSQDESRKRQVASNLSSD
FT                   ADEGSPAVTRPVKITKRLRKKNLGTGELRDKAGFKLKVQDVSKNRHRQVDPEYEVVVDG
FT                   PMRKIKPYFFTYKTFCKERWRDRKLLDVFVDEFRDRDRPYYEKVIGSGGVLLNGKSSTL
FT                   DSVLRNGDLISHELHRHEPPVSSRPIRTVYEDDDILVIDKPSGIPAHPTGRYRFNSITK
FT                   ILEKQLGYTVHPCNRLDRLTSGLMFLAKTPKGADEMGDQMKAREVKKEYVARVVGEFPI
FT                   GEIVVDMPLKTIEPKLALNMVCDPEDEAGKGAKTQFKRISYDGQTSIVKCQPYTGRTHQ
FT                   IRVHLQYLGFPIANDPIYSNPHIWGPSLGKECKADYKEVIQKLNEIGKTKSAESWYHSD
FT                   SQGEVLKGEQCDECGTELYTDPGPNDLDLWLHAYRYESTELDENGAKKWSYSTAFPEWA
FT                   LEQHGDFMRLAIEQAKKCPPAKTSFSVGAVLVNGTEILATGYSRELEGNTHAEQCALQK
FT                   YFEQHKTDKVPIGTVIYTTMEPCSLRLSGNKPCVERIICQQGNITAVFVGVLEPDNFVK
FT                   NNTSRALLEQHGIDYILVPGFQEECTEAALKGH"
FT   CDS_pept        complement(455933..457219)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777000"
FT                   /locus_tag="AGOS_AEL090C"
FT                   /product="AEL090Cp"
FT                   /function="inositol or phosphatidylinositol phosphatase
FT                   activity"
FT                   /protein_id="AAS52595.2"
FT                   /db_xref="GO:0004437"
FT                   /db_xref="HOGENOM:HBG058989"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniParc:UPI0001DB2A8A"
FT                   /db_xref="UniProtKB/TrEMBL:Q757V2"
FT                   /transl_table=1
FT                   /translation="MKRLECHSSEADCFRISLTTSNCAKQIPLGSNDYLLQRAIFERLL
FT                   SAGVDYDLYAIGFQELLPIWDASCPLQTKSCLRRLVPVILQRLNSGVEDTPEVPVDRNV
FT                   QHSEADSLLGSLERQAIGDTEQSTQNAWPSRQVPVSYRFVACNAIGAVGLMLFAKEDLK
FT                   VEVLRTCNVRTGALGSSLKGSTAIQVQLSNSRCSQKFTFITSHFAAKEGPDKLAQRIKD
FT                   YHTTMRTFDKHLDSFQDGHVFFFGDLNFRISPRQPTDLQYSDQPVIDHLLATYDELNRE
FT                   RTAGTVFEGFEEAKINFPPSYKYIFLQDNLNYDYTRQPSWCDRILYKNDPKRVRVHRYA
FT                   SIDRRSILNYTDHEPVTLDVSVSCHTQFVPMAMQNISPQSTMEMYVGDVTDILLMLFSR
FT                   VYYAPTIFDLVVLTIFLCLVLLALFRLTV"
FT   CDS_pept        complement(457490..460237)
FT                   /codon_start=1
FT                   /gene_family="HOG000141709" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624445"
FT                   /locus_tag="AGOS_AEL089C"
FT                   /product="AEL089Cp"
FT                   /protein_id="AAS52596.2"
FT                   /db_xref="HOGENOM:HBG058990"
FT                   /db_xref="InterPro:IPR022596"
FT                   /db_xref="InterPro:IPR023041"
FT                   /db_xref="UniParc:UPI0001DB2A8B"
FT                   /db_xref="UniProtKB/TrEMBL:Q757V1"
FT                   /transl_table=1
FT                   /translation="MEGASQIQCMDSNYTCVFGSYNTTTVNLVLGLPGMFSTFTSSQLL
FT                   KLRILAITASAVSIIAGIIGLEMVACIDRRRKVFRHHMVMFLIVFDLLKAIVLLVYPVT
FT                   ILINNGVYATPAFFNVVGWLTAYAIEGADIAIVIFAIHFGLLIFRPNWKWPNPTTGNME
FT                   GGFYKCRRFMYPIAGLLPMLLASLAFIGYDKKHDPSVSGVVILDNNTYHFPSDPRVGGY
FT                   KPMSAWCYLPPYPYWYKLVLSWGPRYVIFVSICGIYVSIYVYVSSKSQRIKSELGDFHQ
FT                   RTSSRRRVTLSSQETRDPPKTLQQRVVRSATYFADSLGLVWLFRTVKNFFLLTAEDEQF
FT                   ESDPEDSCGDEEVEDFYHGVKSLNYDEEHLAPTTASDGASLGDGILPGPLGSSTGRHFL
FT                   LPPTIANAYGSNTEGASRVSSAYAGDNAALLGVARDQQSLNSENDVKHKPSLGRRESFF
FT                   SNRSSCSRKFPKTAIQPLSPILSPSAMHVSRPLPVEMFEHNMDMKSAMASLHEPLHQYD
FT                   YYYPGALTDLKKDIHSDTYKEFKRRRYQIRKQLKSLFIYPFAYLVVWLFPFIVDCTHYR
FT                   YELRNGPIIWLAYIATFMQPLNCLVDVFVASYRERPWRYTWSSIEKKEILNKYLLKGEL
FT                   GEQTIMELVNSDLGRRGWYYRGRWMKRECWRHKPSRWKRACWYVYRTVKGFIKNDYDFT
FT                   DNCNDHEYWEKYYTLGLSSESSYDTRKNTDNDTNPIGMSGTCPREANTAPVSKQENEII
FT                   RIPIYWRIIHCHPMMRGIDLDELDRKIRLKSKEYNFVTPGLHAALTGSARHCFDPTGDS
FT                   YHQISDPSFPPNYSIGDGNKGTPASFAAPSDSGDLPVSLRVTAQDRAGDNVAFSDETND
FT                   VHFAQGTKGIDGQSVADSGSQMIDLLSFLKGHEDRPSRDTITHQ"
FT   CDS_pept        complement(460837..461904)
FT                   /codon_start=1
FT                   /gene_family="HOG000170673" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15757975"
FT                   /locus_tag="AEL088C"
FT                   /orf_name="AGOS_AEL088C"
FT                   /product="AEL088Cp"
FT                   /function="3'(2'),5'-bisphosphate nucleotidase activity "
FT                   /function="inositol or phosphatidylinositol phosphatase
FT                   activity"
FT                   /biological_process="sulfur compound metabolic process "
FT                   /protein_id="AAS52597.1"
FT                   /db_xref="GO:0004437"
FT                   /db_xref="GO:0006790"
FT                   /db_xref="GO:0008441"
FT                   /db_xref="HOGENOM:HBG426470"
FT                   /db_xref="HOGENOM:HBG599916"
FT                   /db_xref="HSSP:1KA0"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006239"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniParc:UPI0000252D10"
FT                   /db_xref="UniProtKB/TrEMBL:Q757V0"
FT                   /transl_table=1
FT                   /translation="MSYEKELRVAVQAVRKASLLTKRIQSQITSNKGLSSFTKDDNSPV
FT                   TIGDFGAQAVIINAIKVHFPDDKVVAEETSEGYSDELMEQVLSEIRGADSEFGAVLGDV
FT                   ATEVPLTNSRFPLTSGVQVRAAIDAGNHTGGREGRFWCLDPIDGTKGFLRGAQYAVCLA
FT                   LVVEGVVRLGVIGCPNLQLAPFGLQDPAPAPLGYLFKAVDGSGSFYGSTTSDVWSPAAV
FT                   RRLAHSSEMVALEGYEKTHSAHDAQAVIKESLGMTRSHQLDSQAKYCLLAAGLGDLYLR
FT                   LPLSLAYQEKIWDHAAGNVIVREAGGVHTDAVLGQPLDFGAGRTLLTKGVIASCGPASV
FT                   HEHVVSISSDVIKNR"
FT   CDS_pept        complement(462124..463356)
FT                   /codon_start=1
FT                   /gene_family="HOG000218046" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777001"
FT                   /locus_tag="AGOS_AEL087C"
FT                   /product="AEL087Cp"
FT                   /function="transferase activity"
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS52598.2"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG001358"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI0001DB2A8C"
FT                   /db_xref="UniProtKB/TrEMBL:Q757U9"
FT                   /transl_table=1
FT                   /translation="MYKSFIDICARRQTAGYRLPRVPSTHDNIIVAMSGGVDSSVCAAL
FT                   YAHFPKVRGLYMQNWSQTSGSGPVEGKAEPCYEQDWKDIEKVGAYLNIPVERVNFERDY
FT                   WLDVFEPMLQRYQQGYTPNPDIGCNRFVKFGALREHLDKEYGRGNYWLVTGHYARILSP
FT                   QTRRETHLLRSHYAPKDQSYYLSQVGREALADLLMPMGFLTKPEVRQWAAELHLPNATK
FT                   PDSQGICFVNNSQHGRFQNFLQEYLPSSVGHIVTVEEESGTRRIWGQHRGIWSYTIGQR
FT                   VGISLPQGDPKYQGAWYVSHKDPKTNTIEIVKGRDNRALYKDTLSVSDFESLVPPEDLA
FT                   STLEAAMTNGELYMQFRSLQQAVKVTRLQLQDSGFELQLATAQRAMAPGQYCCLYHNDR
FT                   VLGSGTVRATF"
FT   CDS_pept        463726..466608
FT                   /codon_start=1
FT                   /gene_family="HOG000246455" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15757976"
FT                   /gene_name="DBP10"
FT                   /locus_tag="AEL086W"
FT                   /product="ATP-dependent RNA helicase DBP10 "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="AAS52599.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012541"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0000252D12"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757U8"
FT                   /transl_table=1
FT                   /translation="MGLASKRKRDTEEHSDEGEDFDIAGNIALDSEDSDDSVSDSDNEV
FT                   QDIIEFSDDEKQNAPQVSKTAKGAKGAKVAAPRSDAAFPSLELSDGEDADNGDKDDVDS
FT                   YFNTTSQLAASKAKKGSFASFGLSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGM
FT                   ARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSV
FT                   LLTGGDGLEDQFSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGF
FT                   QEQLNELLGSLPTARQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFL
FT                   SVKNDEREANLLYLLQEVIKIPVATEEQLQRFRKQSNDDADDSDDETDKKKKHSKKSKQ
FT                   PLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRC
FT                   GLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTILSES
FT                   ELPYLLDLELFLGKKVLLTPMYEATCDLLKKKWISEGNEGALFQPPKISYVNRLILGSA
FT                   PRLDLEAMGDLFKNLVESNFELQNLKAVSIKAEKLYLRTRQPASAESIKRAKEVIAAGW
FT                   DEQNVRFGKNIEKEKLEFLAKLQNRHNKETVFEFARNHDDEMAILMKRRRRQIAPIQQR
FT                   AKERQQLLEKERQAGLRHTLEDEILKGEENEVGYSVPQELLRDFEDADELAAKRNTKKG
FT                   FRDENFYLSHFAPASDIQDKQLQVASSFTNEVSKATFDLHNDDKVQVHKQTATVKWDKK
FT                   RKKYVNVQGIDNKKYIIGESGQKIPASFRSGKFDEWSKARKLAPLKVGARESSIPANLL
FT                   ADPTGSRLANGKFKHKQIKAPKMPDKNRDDYQSQLKKVNKAMESGLHVKGYNAPGMKQE
FT                   LRTTEQIRKQRSMAEKRKAKNARPAKKRKF"
FT   CDS_pept        466788..468374
FT                   /codon_start=1
FT                   /gene_family="HOG000160935" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929969"
FT                   /locus_tag="AGOS_AEL085W"
FT                   /product="AEL085Wp"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52600.2"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058991"
FT                   /db_xref="InterPro:IPR000690"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001DB2A8D"
FT                   /db_xref="UniProtKB/TrEMBL:Q757U7"
FT                   /transl_table=1
FT                   /translation="MSSLEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQLVNPD
FT                   EKVLDNISKDDINSNRIYVNKKARRSRKQLILQQHEIARFLQRYWKQVKRLNAFKSDDI
FT                   ESLRDPNMNFETFEADIKELQERQAEGADSESAISSLERKRREYSMFSASSGADQTILS
FT                   NVGQFIDVNKLFMWEEHYGEYLFLERLHQDWLNVVKDGSVTLLQFIAFLESFAGTGYLT
FT                   APPVDRNSKRYQVFIQKLVTYLEGAFRNTYPLLNHRLLENRISQSFESYIANPVEDPPR
FT                   GLLCIACGKHFKVGTVFAGHLLGKKHAQSVTTKVATLRAEHTLHYLVIYLATSIENTRA
FT                   LVERKYAFTSGERNREMATIRDAYDAPAYSSGEPEDVIETPQQQQNAHPDDVNPLNLPL
FT                   GPDGYPIPYWLYKLQGLDIEYACEICGNHVYKGRRIFERHFQEQRHAYGLRCLGIEPSP
FT                   AFKDIYNIAEAQQLFQSLQSSTGPAGLATRRAGAISSSANTRKLEVEVEDEDGNVMTHQ
FT                   VYEDLKKQGLL"
FT   CDS_pept        468542..469843
FT                   /codon_start=1
FT                   /gene_family="HOG000209582" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15757977"
FT                   /locus_tag="AEL084W"
FT                   /orf_name="AGOS_AEL084W"
FT                   /product="AEL084Wp"
FT                   /function="transferase activity, transferring phosphorus-
FT                   containing groups"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS52601.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016772"
FT                   /db_xref="HOGENOM:HBG027485"
FT                   /db_xref="HOGENOM:HBG629124"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="InterPro:IPR016720"
FT                   /db_xref="UniParc:UPI0000252D14"
FT                   /db_xref="UniProtKB/TrEMBL:Q757U6"
FT                   /transl_table=1
FT                   /translation="MTDKDSRKEDMGENLTSDGEVASVKDKVATNPNGDPRLLEDSKVY
FT                   NFVVRTIWTLIMIAGFFITLAMGHFWCVILILGCQIATFQECIAVTAESGREKNLPLTR
FT                   TLNWYFLFTTIYYLDGKSLYKLFRHYTINYRVLGFIAANHKFISYCMLVFGFVVFVCSL
FT                   RKGFLKFQFASLCVTHMVLLLVVFQAHLIINNVLNGLIWFLLPCGLVIVNDIFAYLCGI
FT                   TFGRTKLIAISPKKTLEGFLGAWFFTGLAALVLTRLLTPYTYMTCPVQNIHTNVFSPLN
FT                   CETNPVFIPQTYRLPPIIFDRFNVSTITFKPIYMHAFNLATFASLFAPFGGFFASGLKR
FT                   TFKVKDFGHSIPGHGGITDRVDCQFMMGSFMNLYYETFISEKRITVETVLSTILMNFDE
FT                   RQILQLIAALNRVLWENGKMAGDNYERISELYNI"
FT   CDS_pept        470172..471782
FT                   /codon_start=1
FT                   /gene_family="HOG000233033" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15757978"
FT                   /locus_tag="AEL083W"
FT                   /orf_name="AGOS_AEL083W"
FT                   /product="AEL083Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS52602.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="HSSP:1APM"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000252D15"
FT                   /db_xref="UniProtKB/TrEMBL:Q757U5"
FT                   /transl_table=1
FT                   /translation="MALFKFDEEISRRTSNCSGAILLDEFEDSHSEPSHDVDSDDFGQH
FT                   HEQDLPWYKNLMSLNPTATAPKDFVSSPLVHSSISAREPAYTPARSRRRSSLYNKFAVS
FT                   TPPNTTRFPVSVDAEAFLDPTLPEGMSPSFQKRQTPRKLEDFKPVRVLGRGAYGKVLLV
FT                   KDQLTSKLFAMKQLKKAEIVVTAPEEESTDGEDAVLLPAVVEKRVERTFAERTILSQLE
FT                   HPNIVKLFYSFHDHHKLYLVLQYIPGGELFYHLKEQGTLDEVTVSFYAAEISCALKFLH
FT                   SKGIVYRDLKPENCLLDDKGHLVLTDFGLSKRGVNQADSPLGGEQVEELYSIIGTPEYC
FT                   APEILCGQPYTQNCDWYSLGSLTYDMLIGKPPFTGANHKVILSKIKQDKGIKIPHYLSD
FT                   GMKDYLNALLKKDIGKRWDVDRFWDKEGTKTKKKKAGQAKTSCYQSHFIFRKINWKLME
FT                   NGDLQRTTYGPIIPVITDWELAENFDSEFTGMRLESEDIQENGIRIQNNRDGSSGGMRN
FT                   DVFKGFSFVASTSYLDRYF"
FT   CDS_pept        complement(471962..472540)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059092"
FT                   /locus_tag="AGOS_AEL083CA"
FT                   /product="AEL083C-Ap"
FT                   /protein_id="ADJ41772.1"
FT                   /db_xref="UniParc:UPI0001DB2A8E"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGC9"
FT                   /transl_table=1
FT                   /translation="MEKGDKIYSSVTQRISGELNINIDINIERGQELGVRLNKGKVMKY
FT                   WSTVKRYLIDTGDIYEDEHLVHSECGLLLRDHAQAGSVYEPNSSDEFINKKLFQKSLTA
FT                   AQWQRRKQEALESQVRNEIISETSEQRLKRFTRGYRRSQNMEIAPVSRGPIAERSRSSE
FT                   STGSDRETRRGRSHKWGSLQLKTVIVPID"
FT   CDS_pept        473280..475325
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624446"
FT                   /locus_tag="AEL082W"
FT                   /orf_name="AGOS_AEL082W"
FT                   /product="AEL082Wp"
FT                   /protein_id="AAS52603.1"
FT                   /db_xref="HOGENOM:HBG058992"
FT                   /db_xref="InterPro:IPR022751"
FT                   /db_xref="UniParc:UPI0000252D16"
FT                   /db_xref="UniProtKB/TrEMBL:Q757U4"
FT                   /transl_table=1
FT                   /translation="MASEQSTKPAHGSLRLATYARQLCHVWRRKFGMHTLVLAGLSMLA
FT                   STAFLLVYNRVYEGAQHGLFRSRVDVEVPTNIWQYADEALPDRRTFVEEILRTVQAYPP
FT                   GAALQVQADCLLERVRATDERKFGSLTASKLQGCVDLSGDAFAHAKEQHALMMKVIQKS
FT                   LPEHLSDLDHYPYISDGIVILGGGHKTIAAIPAIRSIRENSGITVRNSMPIEVVIPGPA
FT                   DEEKVFCSKILPVLDPSGLTRCVHLGDTISSSLLSKVKPSDHRTLALLASSFSRVLYLD
FT                   SSVQVINAIDGYFHHELFNERGLVLWPDYWRRLHHPKLYELAGSKVDTGRRERYSIDKG
FT                   SPIELYGGKDGEWPMHDCKDSIPDASSSSGVLLIDKKKHFKTLALALYYNVHGEPFFYP
FT                   LLDPKAPREAEKDTIVFAAHVLSRGGGPLYHQVTTPKRSEGHRKDKASSKPILEDTVDT
FT                   STIITSTYRHGAASYHDFFADHNFELLAGEIINSNFDSRRLAYVKWWRQNHSDDTTYKD
FT                   KSDEDLSNDASVKADFYTSFHGNYTLAEYLNFFEFTPVSFVETDVLTCNPWIVAQSRDL
FT                   TFDGASAVGAQPANQQTQYKAGPPTHHRLFSDHFQKLTTYDLELATWSAYAEFLCSKFS
FT                   YKDYPYLKEHLGLTDSPTTAYKMMCKYISARVSHLQSTSWHTMGNK"
FT   CDS_pept        475573..476703
FT                   /codon_start=1
FT                   /gene_family="HOG000294683" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15757979"
FT                   /gene_name="ETR1"
FT                   /locus_tag="AEL081W"
FT                   /product="Probable trans-2-enoyl-CoA reductase,
FT                   mitochondrial"
FT                   /EC_number="1.3.1.38"
FT                   /function="trans-2-enoyl-CoA reductase (NADPH) activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="AAS52604.2"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0019166"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001DB2A8F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757U3"
FT                   /transl_table=1
FT                   /translation="MQALNTTKRLMSTKQFPLFKSLLYSSHDPADCTQVLKVHSYTPKV
FT                   GADESILLRTLAFPINPSDINQLQGVYPSVPEKTLDYSTEKPAAIAGNEGVFEVMSVPQ
FT                   GERRLAVGDWVIPLYSNTGTWTNYQTCRDAGTLVKVNGLDLYTAATIAVNGCTAYQLVN
FT                   DYVQWDPSGNEWIVQNAGTSAVSKIVTQVAQARGVKTLSVIRDRENFAEVAKELEERYG
FT                   ATKVISETQNNDKDFSKDELPVILGPNARVRLALNSVGGKSSGAIARKLERDGTMLTYG
FT                   GMSRQPVTVPTTLLIFNGLKSLGYWITENTKRNPQSKIDTISALMRMYGDGQLQPPEAD
FT                   IKKIEWDVQKMNDEQLLEAVKNGIQSNGKSVVVLKW"
FT   tRNA            476920..476993
FT                   /gene_name="tRNA-Asn"
FT   CDS_pept        join(complement(477253..477511),complement(477075..477202))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777002"
FT                   /locus_tag="AEL080C"
FT                   /orf_name="AGOS_AEL080C"
FT                   /product="AEL080Cp"
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52605.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG058993"
FT                   /db_xref="InterPro:IPR001092"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniParc:UPI0000252D18"
FT                   /db_xref="UniProtKB/TrEMBL:Q757U2"
FT                   /transl_table=1
FT                   /translation="MATGKVTKKRVAPAILDNGIAAPSLVFQARPNVSREKLTGTQKRE
FT                   NHVTSEQRRREILREYYDELVRLVPDLQESENRSEWQIYMKTRNYLCWLYKRNAQLRRQ
FT                   LKLTNVKYPEYLVWKCPNALNGPG"
FT   CDS_pept        478162..479163
FT                   /codon_start=1
FT                   /gene_family="HOG000065992" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777003"
FT                   /locus_tag="AEL079W"
FT                   /orf_name="AGOS_AEL079W"
FT                   /product="AEL079Wp"
FT                   /protein_id="AAS52606.1"
FT                   /db_xref="HOGENOM:HBG190593"
FT                   /db_xref="HOGENOM:HBG202948"
FT                   /db_xref="InterPro:IPR013861"
FT                   /db_xref="UniParc:UPI0000252D19"
FT                   /db_xref="UniProtKB/TrEMBL:Q757U1"
FT                   /transl_table=1
FT                   /translation="MTLSNKYIEIPGPPPLSWQTIPTATRYLSFAYVLFTVALWSTRRT
FT                   ASSTVEDPQLVICPIVQLVPSQILKFPYSLLLSNLVDVELWKFVVDLLNLIIGGTYIES
FT                   YWNSPQEMLKYTLMIGTATNLVMCLVTFVLSFFITSIRLEYPLDGNYTMLIGFAIVYKQ
FT                   LLPETTIIEIRNVPFISKNFRFKLYPIFLLCTLTLSQVFWYHNISELISIWTTFFTCWL
FT                   YLRFYQVLPSAVTGNVTADQVVGDASDTFQLLYFFPDIIKPVLRPIFDKSYNLAIEKYR
FT                   WRTPFMPNDIELGNSLTESRVKSDITVTEERRKQLALQVLEQRINSDKEQPQ"
FT   CDS_pept        complement(479288..480163)
FT                   /codon_start=1
FT                   /gene_family="HOG000231264" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20624447"
FT                   /locus_tag="AEL078C"
FT                   /orf_name="AGOS_AEL078C"
FT                   /product="AEL078Cp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="AAS52607.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="HOGENOM:HBG058994"
FT                   /db_xref="HOGENOM:HBG396265"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="UniParc:UPI0000252D1A"
FT                   /db_xref="UniProtKB/TrEMBL:Q757U0"
FT                   /transl_table=1
FT                   /translation="MFSLLTVRLGSLRGLSSPVQQPARFMSLLGSLRPSEGSTKTYKRV
FT                   GRGPSSGKGKTAGRGQKGQKARGHVKSWFEGGQTPIYKLFPKLGFTNVHSLQLRTLNLE
FT                   RIMWFHRKGRLPLEEGEVLDMKKMKDFGLVTGTFKDGVKILANGKENFNIPIQIEATRA
FT                   SSEAIKAIEAAGGGFTARYFNRLSLRAHLSPHWFLEKRGRIPLPARPTKKKDINYYSDM
FT                   NKRGYLVKEQHPLYLEIQRLRALGTVSGGSKRAKKTALEIQLEAMEESAAVAPSAPSKS
FT                   AIISLQELQQ"
FT   CDS_pept        482236..483246
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15757980"
FT                   /locus_tag="AEL077W"
FT                   /orf_name="AGOS_AEL077W"
FT                   /product="AEL077Wp"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS52608.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058996"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000252D1B"
FT                   /db_xref="UniProtKB/TrEMBL:Q757T9"
FT                   /transl_table=1
FT                   /translation="MIFPIRYLYVSLAQFSAHENRALVALGYLQEEHTLGVEPQIVMFH
FT                   EPVSHPRSDYAFSDSVKLLPCMSSHTQGRHCQWYHQQQGPHMQGVYHGRSIRRLLDHIT
FT                   DLKYMLLDSMQNGMDVEEHCFVREQLMHLIQIVPHVHLSPTPNRMQLQVVEEHKGLERL
FT                   APAVQVQLPSIRSLIPGNEGTESVPQAPVTPEDISPSTSVTHAQHAHGDNVPRGEGFQF
FT                   RAHVPPPPFSAAMSASSAKADTASTAIATSAAVYADIEQLSSADKRQKGVRNQCPVCGK
FT                   VCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYRLHQLQRGKEGQV"
FT   CDS_pept        complement(484363..485310)
FT                   /codon_start=1
FT                   /gene_family="HOG000258174" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15757981"
FT                   /locus_tag="AEL076C"
FT                   /orf_name="AGOS_AEL076C"
FT                   /product="AEL076Cp"
FT                   /function="pyridoxal kinase activity"
FT                   /biological_process="pyridoxine biosynthetic process "
FT                   /protein_id="AAS52609.1"
FT                   /db_xref="GO:0008478"
FT                   /db_xref="GO:0008615"
FT                   /db_xref="HOGENOM:HBG096859"
FT                   /db_xref="HOGENOM:HBG661459"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="UniParc:UPI0000252D1C"
FT                   /db_xref="UniProtKB/TrEMBL:Q757T8"
FT                   /transl_table=1
FT                   /translation="MPRVLATQSHVVHGYVGNKAATFPLQYLGWDVDCVNSVQFSNHTG
FT                   YGIDKVFGSVTSSSELECLFNGVLSLASTGSQYDGILSGYLPNSHSVRTMGYYYQQLKR
FT                   QNSRLLWLMDPVMGDEDQLYVDKDVVPAYRELVESGSVDILTPNQFEMELLHGRKIASL
FT                   QELEGAIKSIHRHVPIIVVTSLSPSVFADPDHVYCVASVRGSACNFYRVPLIDSYFTGV
FT                   GDLFSALLLHSAYGSLLQKQRNFAEDINWALNIVQQVLENTRQMSAVKSRAVIGHAPSM
FT                   LKMELRIVESRNFFRWRDSWSAEERDFKWFPCTS"
FT   tRNA            485973..486044
FT                   /gene_name="tRNA-Met"
FT   CDS_pept        486221..487324
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624448"
FT                   /locus_tag="AEL075W"
FT                   /orf_name="AGOS_AEL075W"
FT                   /product="AEL075Wp"
FT                   /protein_id="AAS52610.1"
FT                   /db_xref="HOGENOM:HBG058997"
FT                   /db_xref="UniParc:UPI0000252D1D"
FT                   /db_xref="UniProtKB/TrEMBL:Q757T7"
FT                   /transl_table=1
FT                   /translation="MSDSIQEFLNVQLIQNCQLATVTDLADKFGLDAGAAKSALLAYHS
FT                   ATKNKEVHRLIVCVYSTGTIRVVCDDDDVPREDLADVFLYGLSPSSSLAISANVRSNPT
FT                   LRNPYTLVAVPDDEAAAEPPQRSRTQAADAGPRPNLRGNQTYPAAAKPSPSKAGTAQAK
FT                   AGKFDSGLRSTAIIARMREDREKKERERQEELKKRRQKSTIVTEEKKLQIAKLAQLFDG
FT                   DSDSGDEEMDGRDEETVLAPLPPVSAPDVAAPAAAPDQTLDLEALLDTTADESLLSIHP
FT                   DQNSPTRGSQDHASTLTSLDAQPQSTTDEDGYLVTTKILPSAPPAALPSGAKRPAQRAG
FT                   GPPSKSAKTAPASKKVQSSLMNFFKKK"
FT   CDS_pept        487577..488059
FT                   /codon_start=1
FT                   /gene_family="HOG000056520" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19777004"
FT                   /locus_tag="AEL074W"
FT                   /orf_name="AGOS_AEL074W"
FT                   /product="AEL074Wp"
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="proton-transporting V-type ATPase, V0
FT                   domain"
FT                   /protein_id="AAS52611.1"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0033179"
FT                   /db_xref="HOGENOM:HBG211385"
FT                   /db_xref="HOGENOM:HBG325773"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR011555"
FT                   /db_xref="UniParc:UPI0000252D1E"
FT                   /db_xref="UniProtKB/TrEMBL:Q757T6"
FT                   /transl_table=1
FT                   /translation="MSELCPVYAPFFGAIGCAAAIVFTSFGAAYGTAKSGVSICATCVL
FT                   RPDLLFKNIVPVIMAGIIAIYGLVVSVLVCYSLGQKQALYTGFIQLGAGLSVGLSGLAA
FT                   GFAIGIVGDAGVRGNAQQPRLFVGMILILIFAEVLGLYGLIVALLLNSRATQDVTC"
FT   CDS_pept        complement(488315..490471)
FT                   /codon_start=1
FT                   /gene_family="HOG000113893" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15757982"
FT                   /locus_tag="AGOS_AEL073C"
FT                   /product="AEL073Cp"
FT                   /protein_id="AAS52612.2"
FT                   /db_xref="HOGENOM:HBG058998"
FT                   /db_xref="InterPro:IPR011502"
FT                   /db_xref="UniParc:UPI0001DB2A90"
FT                   /db_xref="UniProtKB/TrEMBL:Q757T5"
FT                   /transl_table=1
FT                   /translation="MSKMANEMLLDIDGMDFVEDEDMGAEGELQFSFDPVSNAPMVSFP
FT                   STQQPDLEKLRFKFAPVLSRSFAFNGGSRTGTLYGVQVPYVDNSKEFSQYAAKLFEVYK
FT                   SLGADKQFAVPTIGLINHTSTLEHNQTVNLALEAIVSELELFIESLKYSGRQQRLVDLE
FT                   ECLSILNCLKTVQFTLDSEEENSRAKFIDSLISWVNRTDGEPSEAVIAKVLGDGKQTPI
FT                   LENPYFWRLLCQLIIRGLFDQAVAAIEKSELLSYLADKCSATHTMVQDMVNLLQGYPRE
FT                   LEPVYREWKDLVLQLHLNWSQSEHKISIELASSLEDCLLIMCGNKSKIIYYSKTWYECY
FT                   CGLMLYYIPSLQLSEEYLQLVLKEHPLDVTSPWEQACVSIITGKIYSILPVLDSLDSCT
FT                   AAFTAAICEAKGLLENDLLDDGGLEVSNTGDEMFGLGNTMASYLLNQFALSIVTYEDKN
FT                   LWAVAIGIIYLTPNYSDAAKRMMIAELLPHYPFQTNDDIEWMLTICAKWKLPQIARTIY
FT                   RVLGQEALYLNNIIEAISNFSKAGEFEWVKHYSWMIFEASILQGAPLEDEVVNSIVTGE
FT                   YESAIPKELVEVMVTPAMKQSLSPYAVLFNFFRATEDGRWAEALELLLSLIEFTYLPPQ
FT                   YLILLIGRFLYPLFLQDESKMFKEQDVLRVIKALEQFHDRPDEITTAMYKELLVKVDTL
FT                   PKDPLNLINAIRTKLSLKLCHQFM"
FT   CDS_pept        490812..494228
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624449"
FT                   /locus_tag="AEL072W"
FT                   /orf_name="AGOS_AEL072W"
FT                   /product="AEL072Wp"
FT                   /protein_id="AAS52613.1"
FT                   /db_xref="HOGENOM:HBG058999"
FT                   /db_xref="InterPro:IPR018849"
FT                   /db_xref="UniParc:UPI0000252D20"
FT                   /db_xref="UniProtKB/TrEMBL:Q757T4"
FT                   /transl_table=1
FT                   /translation="MALDSAEAISKYLRSKSITTDELCDVCQDLEAGRYSVFFPSAHIF
FT                   VLELIIDRWNDPKHESYRTNWRVWDLFNRMWQRVEQEDHKKRLSKRLRFSVVLLQGIES
FT                   VKQDYDSFSKAVLETMQLINSTSAIHCSVETAMKLLGETVNLLNRCDGTDASGRRAMLN
FT                   ELLTLSNIESVADVGSKIATLYSGHLLSPTLTYMQLYGGPDSNDAGSNILRKLMSKFLY
FT                   GPSVIPLRHIEKFLSDYELPKEQVQVFFRTTIQFLSSSDFATLESIFKILLKIAPEMSA
FT                   AMLHDLSLEKKTMSQEFLENMFNEAFSQENWALVANVLILDVDVGIKNAQKILNVLSQG
FT                   KINGHLINMWKALIDCHVIAREFPQFLEKWKSHCSQSSCKVLLENEQYYAVVAGNIPLL
FT                   SVSQIRDLLEELLDQVSKDSSEEAINVATIIVLGLRKLPYNLLQEFKLSLLKFFELHHI
FT                   RTTAFWDLKHHILELYDDVASAELLSGKDIPAMLVELETAPMNLYFTIFKIRELIEFEM
FT                   DSVIENFIRRLEILSNQRYILLQLFSRWSTIVDLTFNQSQMEHLLEISLKPDNIEIYNE
FT                   ILKYDDFFEETNIIHTLVRLLGAKIEHATCRSLLCQFPVQCIGKNVRVDVINRILAQEQ
FT                   LHSDEPHLVEHLLKNPTFKSAIETDCKALAKVISQESDYYALDNPLFTTVWGNHLNNMK
FT                   SEQCQTFISELIESISNGLTEQFEFATYKLAFYIVTSTPHKFDKVKEVAQTYVRNVMDI
FT                   LKQQQNILDNVKLSSWLMGSLYRVFCQFELSQPIDFLRSFLLSVSQQMKACNDHQLLET
FT                   RFQLHCLCYEDNLEGLLACYVLLREIGVQKNRLLPAVSSAVKLKSVSDHTSFNRAFFSI
FT                   ISSFSELSVVQAEGVLELYGVFVPLLSKENTIGTRLFVRSVLEFHTYSERILAQKKALL
FT                   KVLVLYKDTLVSKPWLFTQYAVESLFPLCTKLNISICHSDYPGQDEVFVSSTQLLSSVL
FT                   LFHRYKLSNRHHLVTSTLCCYMGLLAESERYRLSVLSAKSFSRLVINFCEPSHSPNNSN
FT                   KDSLNSRVTVAKRSLRKYLPIILLNYVNKVISHNFKETIRKEITPCIFSVFDVLSRSEL
FT                   AVITSSLDNPGRVYFKNLYAEYQKLGRWHEE"
FT   CDS_pept        complement(494324..496582)
FT                   /codon_start=1
FT                   /gene_family="HOG000164493" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15757983"
FT                   /locus_tag="AGOS_AEL071C"
FT                   /product="AEL071Cp"
FT                   /function="voltage-gated chloride channel activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS52614.2"
FT                   /db_xref="GO:0005247"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG052910"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniParc:UPI0001DB2883"
FT                   /db_xref="UniProtKB/TrEMBL:Q757T3"
FT                   /transl_table=1
FT                   /translation="MSYQPVGPRQEAEHQAEVRNFDQFTTIDWILEEKSQRNSGARDVG
FT                   YSGRWRRYLEEVWHRGQAFFTLTAIGVTVGCIAGFIQVLTETLVNWKTGYCARNWLLNK
FT                   SFCCQRIAEDTRKFLVIEGAQCVEERLWVPWSNSVLAYFTFITLSVAFAMLSALMVKCL
FT                   APMATGSGISEIKVHVSGFQYKKEFFSLTTLAVKSVALPLAISSGLSVGKEGPSVHYAT
FT                   CCGFLIVQFLLRNTLKYAEQAEYLVASSAAGVAVAFGAPIGGVLFGLEEMSSSPHFNLS
FT                   TLWKSFYVALSAVSTLQYLDPFRNGKIVLFEVKYDRDWHVEEIPIFILLGIFGGLYGHY
FT                   IGNLNIWFVTFRRNYLSKWPLREVFVLALATTCLSYFNEFLKLDMTESMSLLFHECVEE
FT                   KSGMNFEHRLCQLDGKFSFLSFLTLYCSLMFATVVRALGVVVSYGARVPAGIFVPSMAV
FT                   GATFGRSISVLVENFITGPHVITPGTYAFLGAAAALSGITNMTLTVVVIMFELTGAFIY
FT                   IIPTMIVVAITRIVYSSFSKEGGIAEKMIMVNGFPFMECPQEHRDFLDEYCAADISTTD
FT                   VVTIKESMHLSDLESLLEEVGNSYKGFPIIRNDDENEQEKRCIGYVTLQHIRSQLGMYT
FT                   NDNTARNTVVDFTKKFLPDDENLIQFSDLVNYTPFTVDKSLSLSLLYQMFHKLGCKVVI
FT                   VEDAGFLVGIITKKDFLRFQRTKRTELYGSINTFDEQSAERLWNLIMRVIRKLRSKQL"
FT   CDS_pept        497043..497426
FT                   /codon_start=1
FT                   /gene_family="HOG000055226" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15757984"
FT                   /gene_name="SNU13"
FT                   /locus_tag="AEL070W"
FT                   /product="13 kDa ribonucleoprotein-associated protein "
FT                   /function="RNA binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="AAS52615.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG125288"
FT                   /db_xref="HOGENOM:HBG739027"
FT                   /db_xref="HSSP:1ZWZ"
FT                   /db_xref="InterPro:IPR002415"
FT                   /db_xref="InterPro:IPR004037"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR018492"
FT                   /db_xref="UniParc:UPI0000252D22"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757T2"
FT                   /transl_table=1
FT                   /translation="MSSTPNPKAFPLADAALTQQILDVVQQASNMRQLKKGANEATKTL
FT                   NRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASIT
FT                   TNDASAIKSQIYAVKDKIETLLI"
FT   CDS_pept        complement(497453..500689)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059093"
FT                   /locus_tag="AGOS_AEL069CA"
FT                   /product="AEL069C-Ap"
FT                   /protein_id="ADJ41773.1"
FT                   /db_xref="UniParc:UPI0001DB2884"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGD0"
FT                   /transl_table=1
FT                   /translation="MLVQLASPDVLDYSVCQGLLSGREERVLDVYNNGSSASNTFIVVC
FT                   ERSLWVLQATGKGLRRRRIASCETPVQKSCVSEGAVLVVRDNWVYQYGDEGPAGDVAMP
FT                   VHAYSRGIRIAGDAERYYVDSRHSRYLWGPYRASALPLAVFALADPILDFQFEGSRVFS
FT                   VKRLSHGRGYYVERVDSVSCGAGARRDVLHISDDIKHAPIFSAGGGSSATYVFVAYHYT
FT                   WVVAKDTLGVRKFPNPPFIKRSVVRGAALYVEPWPRGPAPRGNAETLVLRVCTGYGAAY
FT                   KATVDANADKTLRWNKLHYGTRSDTFNGCWYLGSERYLYSTGRKLVSKDFSSGTELSIR
FT                   HVSASDIVHDLCILQLLPMLDDGIFSIETLTCGSYTQYDNKGFIGTAYDELSVDGLRSL
FT                   TLPVAVAPDTWRSMEDFWLSSTTSASVSASDIAYPREGESLKPRLDLFQDILFCTLVQN
FT                   PSGVPTKYLILRADGKLVCHHLGESIEPAFEFPTSCGLNERTLLSSFEDGNQMHIVAAT
FT                   DGIITVFELQDALIENVCTVSKVYLLATIPEVICSIHSSKDGVFVLTKTQLYNFTLAEM
FT                   QCRPCNRTSITIASPPKFCVNSYGRAVLYHDKDYLYQYRDGQILRTKLPHRCDTVLQKD
FT                   ENTVYMLATDSKLWEMKVMRKSKMHTHIEDGTVFTKVTTCIGSTKAIICAETGEANIQE
FT                   KLVLYDFGSRRKLAECELDPKECVINLYSFFAPMSDSDLNNSKQLCIATTYTATNQYVR
FT                   LFAVDGSSLFAEDRKEVKWIVTDIKVYGNMIVASGERLAVYFLQEENGELTLCECGNRC
FT                   VQLSGSLTMGTVIHEDNIFLFDAHKGITVFRLHKDGLNGANIMRSTDAAGYPSIEHNTI
FT                   THVASTSVPWSRLFNLNAAAYNAQGDVCFEDRKELWHSTVTFAAVCDASGCVTLFQFSP
FT                   ASIERGTDICRFEIKQTILKLVSIPTSLSEHITELPPACTPLFALYLEDGSVRIISNGK
FT                   VTPNAQPIESSHNLRACRYSVPNPAATQSLSGVSGDVFSFRRQRVVPEPSKSVPQPLAG
FT                   PPCIRIFVSGPPSPPPLQRTFSPPELDLTL"
FT   CDS_pept        complement(501030..504221)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15757985"
FT                   /locus_tag="AGOS_AEL069C"
FT                   /product="AEL069Cp"
FT                   /protein_id="AAS52616.2"
FT                   /db_xref="HOGENOM:HBG059000"
FT                   /db_xref="UniParc:UPI0001DB2885"
FT                   /db_xref="UniProtKB/TrEMBL:Q757T1"
FT                   /transl_table=1
FT                   /translation="MPATLALTDVRKPKQFVGGYHWRNDEEILIVEWDGLSIRNMSSPH
FT                   DIISASSFPLDILSASSYVQPLTKRNYLAVFERDGACRIINEKLEIVDTYTVENPVRSP
FT                   CCCFDERLSRMFLVWDGYSIYQCELDGEKELFFRNMRAIYASAEEILQIALRWDITDVD
FT                   GSQLSIGILSKGQYAGPYYYEEIQEPLDQSHATPWAVSTDMLEVGVFSRPPFLLALSSV
FT                   GSFVLTPSETHYYAAPYLAARTVAKQAKSSATEAGPFPTILDPKLQITNAYVLYGEDSP
FT                   KICAVTNTGMYFELLSKLAFDSSGAMLSRSPLVLGKNRLEFGPELDYFSPIGKDLILVH
FT                   SRLNGLVLRRRRDNFRLFSESTRTDSILFAGVAGPEMTSYMFFCGGTSLNNGLLELYRM
FT                   GFPNEFIRHDPIDFGSSVEKMWPTTEGIYWLDPAGDLHQNSRKVLSKADVQDILPNGQM
FT                   ILRELDTIAVCTLDENIYVRLDSKYELHWSDHSASIKLSVETQPPTRTFMSADSGYLGL
FT                   SLDNNVYLIDKDKHVQMLRVDAKDPIFSFKVKMTERGVRIMYCDIMGSLVIYKGQKLLA
FT                   KLKVHSKGLHICPIASSDKVLLYHETSVYLFSLNDLSIGHLPFPCHPREIKLASDDSFL
FT                   VTDANGHMLVVHCKEMRKWKPQLVRTSDTTPGLISKCVVPTHNPSFIVATLVADHFDRE
FT                   LSKTEYSSQLAVFSCLDGKFTSFYDLYERYPNAIITDIISMNAQRQNDADDLFEQMSYA
FT                   KKLALSRCVFVSVSYETSEEDGDNIFLYSVDDFTGNLELQMKYNTHFHVSLLETYRDNT
FT                   ILAIGECLQAFVLDYSVKDNRFMLQPLSDAVDVGGVPKDCSVLCIPDARDCKRKRRAES
FT                   HQAKLVIHNTMKGFQQFEILDRKSKRHSQAHSDRTAVQIFFRPVPIGELDAILKPAAEL
FT                   SAISASAISFEGAGYIPVSAIADVDNTVILIRQDAADVKICQLEIPHRVTSITAARRSP
FT                   SSGRQPHQPPLFNELDPLFIISTVAGGCYLVSGLSARSPVAVNTRIPGVSIDSDSELQM
FT                   YPCRPSIFSDPKFIK"
FT   CDS_pept        504513..507032
FT                   /codon_start=1
FT                   /gene_family="HOG000246763" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18929970"
FT                   /gene_name="HUL4"
FT                   /locus_tag="AEL068W"
FT                   /product="Probable E3 ubiquitin-protein ligase HUL4 "
FT                   /EC_number="6.3.2.-"
FT                   /function="acid-amino acid ligase activity"
FT                   /biological_process="protein modification process "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52617.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016881"
FT                   /db_xref="HOGENOM:HBG059001"
FT                   /db_xref="HOGENOM:HBG398466"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="UniParc:UPI0000252D24"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757T0"
FT                   /transl_table=1
FT                   /translation="MSFFSRNINSKDRHKIQIISNSTAPSFEPNNEFVTSSCCCCGTIL
FT                   QHPKNISKFRCSVCYVTVVLQGTAFTQDKTELFDLDDMRELLSSCNNTYRELDKDEKRL
FT                   RKHEVFHLLEDYIATRMVTIFPLNASFESSNPREMLDYDQVKEFYRILMELPTKKPFYS
FT                   FLVACNELLKRPHVALNTPTPTNPKYKRIGLFRWILIILEVPIFKQTLANAEARCNTPH
FT                   FRAISYEVLKKAVGYMSCLDEASAKELVHFLKYMQKDIFASKVELVNMYITFHFARILH
FT                   TIGKETNNGKYSPQLEDFEHSEKLNPSLNQGSAKKLVHTNMNIFFGGIVRPMTSSANSK
FT                   DILALNYRFSPEDYGNEWHIKTGARLLLCLYVANQSAYKCPVSNFYNTMIDFVDYKRDF
FT                   ELWQDLSKLSASHEKENSGSSGPRYSPVQFTICQCPFLFSLGMKISILEYETRRLMEYS
FT                   AEQAFLKALDRKQVVDVYLKIRVRREFVTTDSLRSIQNQQKDLKKSLRIEFVNEPGIDA
FT                   GGLRKEWFLLLTRDLFNPNNGLFVYVPESRLCWFSIMESIEHELLQGEGSSSELYYLFG
FT                   VVLGLAIYNSTILDLKFPRAFYKKICGEVLSVNDFLELYPETGTNMLKMLEYDGEDFED
FT                   IFALTFETCFPDRFDESKIHYRQLCPDGSTQAVTRENKHEYFRLWMDFYLNRSIAPGFE
FT                   SFRNGFFHVIEGNSFRLFGSEELEQLVCGSNEQSLDVSMLRSVTRYQGGFDDNSPVVQW
FT                   FWEILSEMEYPQQRKLLHFVTGSDRVPATGVTTIPFRISRIRSGADRLPLSHTCFNEIC
FT                   LHEYKDKETLRNKLIIALEESQGYGFR"
FT   CDS_pept        507373..508011
FT                   /codon_start=1
FT                   /gene_family="HOG000255193" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20624450"
FT                   /locus_tag="AEL067W"
FT                   /orf_name="AGOS_AEL067W"
FT                   /product="AEL067Wp"
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="ubiquinol-cytochrome-c reductase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS52618.1"
FT                   /db_xref="GO:0008121"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG047215"
FT                   /db_xref="HOGENOM:HBG668715"
FT                   /db_xref="InterPro:IPR004192"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniParc:UPI0000252D25"
FT                   /db_xref="UniProtKB/TrEMBL:Q757S9"
FT                   /transl_table=1
FT                   /translation="MLGLRNSVTALRAASQARLLSCSSVAAKSTYRTPDFSDYLKEKND
FT                   SNKGRSYAYFMVGSLGLLSSAGAKSTVDTFISSMSASADVLAMAKVEVNLASIPEGKNV
FT                   VVKWQGKPVFIRHRTASEIDEANGVQMSSLKDPQTDADRVKKPEWLVMLGICTHLGCVP
FT                   IGEAGDFGGWFCPCHGSHYDISGRIRRGPAPLNLEIPAYDFDGEKLIIG"
FT   CDS_pept        complement(508432..510504)
FT                   /codon_start=1
FT                   /gene_family="HOG000066107" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929971"
FT                   /locus_tag="AGOS_AEL066C"
FT                   /product="AEL066Cp"
FT                   /protein_id="AAS52619.2"
FT                   /db_xref="HOGENOM:HBG059003"
FT                   /db_xref="InterPro:IPR018712"
FT                   /db_xref="UniParc:UPI0001DB2886"
FT                   /db_xref="UniProtKB/TrEMBL:Q757S8"
FT                   /transl_table=1
FT                   /translation="MTDRSGISDSAKTPLRKPKNLVLCFDGTDQNFGPDPFTNVLKIFR
FT                   MLESNDDSIQMCYYQPGIGTSMSVRGGDKSSTRCALENTFDSMFAFSLDHHIISAYLFL
FT                   VQYYELDDKIIMFGFSRGAFIARVLTGMLERVGILKRGLENIVPMAWKIYAAWEYACQP
FT                   SQPDYTTTLIDEFRNTFARNIPIRVHFEGLFDSVNSCGIIRDRLFPYTSRSGIVDHVRH
FT                   ACSVDERRGKFKQQSFSPNPYTQKLFSFVYRNYMIEPQHYSPLQYGYTDSERFSNPFIN
FT                   STLVRTSSIPQLTDRSPDAGLFADGMKPDSDSAAVLLRNVADYLEGVGQETQGSWFRRR
FT                   LSSLSKQRVEGVFQHYSPGNESSDRSTFVSSDLVEKWFPGDHSDVGGGWAPDIETEQFL
FT                   SNLSLRWMLSEAIKHGVHFKKGIIHQFANTYDSSSSVLSASHDMLSLKKGQFTMQSPFT
FT                   NSSNPSKVDLDKFHGLLKVPRKVSSMLRVFKKKSGSTLQSASSLGHSPRAFPPRCIIRP
FT                   AKNDGHGTKSIFQVIAWWIVEMMFIGIRIEDKNCQWKNVYVPNLGRHRNIPAYGELHWS
FT                   VYWRCKYVGDYRPKNLPPYAEKLIEHYIGVSLNNGKEHRRKKMASSIPSKQVSYPTQES
FT                   SPLLSPAGNFTCARSSLEVDILAQADEDRIRKWIAEDWRNVPDELHELLQRNPDL"
FT   CDS_pept        complement(510722..513799)
FT                   /codon_start=1
FT                   /gene_family="HOG000170952" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929972"
FT                   /locus_tag="AGOS_AEL065C"
FT                   /product="AEL065Cp"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="AAS52620.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG054410"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI0001DB2887"
FT                   /db_xref="UniProtKB/TrEMBL:Q757S7"
FT                   /transl_table=1
FT                   /translation="MSADDELGELGLEVVPHSELEQQIESNAQTLLDQKQYKLEQDRLE
FT                   RYEEKLKVLRQQQSSLGRKLRAATRISVRKKLQEQLDRLEAEDLPPVLQDIRDIKRRLR
FT                   EIGQDQKTDEPRSGGVRQAGESEKDYLVRTGRLTAFGNRTEFTLADDSTRADNRQASHG
FT                   EEDGADATPESVPFPYTDEEDNSDSDSSGASAEGTADAAEDDGNELHYQRRLSGWLEQR
FT                   KRSRGHDPHPGIPEWEKPHPTLPDAKLYDDFKIPADIFDKLFSYQKTCVQWLYELHQQN
FT                   CGGIVGDEMGLGKTIQIVSFLASLHHSGKLKGPVLVVCPATVMKQWCSEFQTWWPPFRA
FT                   VILHSIGAGMITRKKMTEEQLEELLMRDESNEFSYEQYANLGRTKKQLEARRGIESLVQ
FT                   KVVDDGHILITTYLGLQIHSDLLLHVNWDYAVLDEGHKIRNPDAGISLTCKRLRTPHRI
FT                   ILSGTPIQNNLTELWSLFDFIFPGKLGTLPVFQQQFANPINAGGYANATNIQVQTGYKC
FT                   AVALRDLISPYLLRRVKNDVAKDLPKKNEFVLFCKMTQFQKEKYLQFLNSEDMIKIKNG
FT                   RRQVLYGIDILRKICNHPDLLERDFRKHEPSFGDPRRSGKMTVIKQLLLTWKKQGHKAL
FT                   LFTQSRQMLDILEAYISHKDPELAGLQYLRMDGTTNIAHRQALVDRFNNGPYHLFLLTT
FT                   RVGGLGVNLTGANRIIIFDPDWNPSTDLQARERAWRIGQKRDVTIYLLMVAGSIEEKIY
FT                   HRQIFKQFLTNKVLSDPKQKRFFKMNELHDLFSFGPGAASDSFASEIEQQTASLRRQPA
FT                   AHGTDDYDSVQRFEGVSKLEGFFNAKDRADREKDEDARLMDGLLGGGSLATAVHHDSVV
FT                   QAHATPSDDIIAREAALVARNALAALRKSRALTKNYDVSTPTWTGKFGQAGRVKKKRRQ
FT                   PATSSAAIITALGNPPPATTPASTMSEEHARSLAQMRDFLQAQPGYFSTSVALIEHTGL
FT                   KILTKQDLTQTRALLRTIATFDKTRSGWILKEEFRD"
FT   CDS_pept        complement(514092..514418)
FT                   /codon_start=1
FT                   /gene_family="HOG000173745" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777005"
FT                   /locus_tag="AEL064C"
FT                   /orf_name="AGOS_AEL064C"
FT                   /product="AEL064Cp"
FT                   /protein_id="AAS52621.1"
FT                   /db_xref="HOGENOM:HBG178448"
FT                   /db_xref="HOGENOM:HBG737843"
FT                   /db_xref="InterPro:IPR018793"
FT                   /db_xref="UniParc:UPI0000252D28"
FT                   /db_xref="UniProtKB/TrEMBL:Q757S6"
FT                   /transl_table=1
FT                   /translation="MGASCKDQRKAVAICLQRSPCVMIERNTPKKCLEDPELRKQMPDL
FT                   CIAQMRSFLECKRGMVDMTKRFRGNGAMSTGRYDQQYENLSTGNFNARAEMQKLEELDE
FT                   SNKT"
FT   CDS_pept        514598..518539
FT                   /codon_start=1
FT                   /gene_family="HOG000093808" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15757986"
FT                   /locus_tag="AGOS_AEL063W"
FT                   /product="AEL063Wp"
FT                   /protein_id="AAS52622.2"
FT                   /db_xref="HOGENOM:HBG059004"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR022033"
FT                   /db_xref="UniParc:UPI0001DB2888"
FT                   /db_xref="UniProtKB/TrEMBL:Q757S5"
FT                   /transl_table=1
FT                   /translation="MLNFLPGQPNSSLHTVCQKCWNNRTIIAYCSGNNLIIMSNRFSRL
FT                   QTIYFEKDATAVDICEQTGNLAVAVGNTVYVYGPEYELREHRWAEHGQFYHDDSQVNCV
FT                   RWVGKTELVVASSYMSLWRIRAGLGTFNKHLLWSQRQPAPVYNCAVTEDAEYIATVGKH
FT                   DARVKVWRRLSNAAEQAEFDLTVIPHGGSVTMLRWRRSEEPSHCKILYVLGTDSKLRIW
FT                   SNYEMENKNNAQDWGTVELDRKAQERFVVILDSRLLAAALPTKRRSELLQYLASQQPEL
FT                   VGLVSRSGRLRMLALEHLSQDPPRMASTKPLLTIDLLSEWFESPPQVLYFCEPQIYEAS
FT                   GGQLSLVIHDLRGSIKHVLLPLDKLARPTSLGDILEHRFTGHSKSIQRLWRSSDGEAIL
FT                   TISRFHENAIWIPQNLHAGVSLQMQNIIETDSPIHLALVHEKGALVITFLKSFKLQAWG
FT                   CSANSSQRAHLLAEVTISKSRGYPILMSNTPEKKHHHERHFITLLYDSGHVDAFLATPN
FT                   EIKPVESGSIDLEGEDMIYRASTIDPVQPSSGGDRDLITLITRTGTIRTYKAVVASDLS
FT                   RVQWMLTHILDTNIEDCSLIAGSSINKTCVIDSTKKEITIWDLKRGVLEYTHLFQDTVR
FT                   DIDWTSTNSGQSIISIGFNSHVLLLTQQRYDYTNKLPTFLPIKRLDITKHTTHEIGDST
FT                   WMKDGTIVVASGNQLFVEDKQLDLTDSFTLQSIGSRCITSNDLLHLTSVLNGPLPVYHP
FT                   QFLIQALYFGKLNLVKEIILNLFLQIREREYNPDVTEPLPSSLCIPYHKFLLPDDENYI
FT                   FDHHPEPYSSYNIALSALLREKLTKFPLPYLTRHQQITLITVLEAIESVEKNNSIVDSS
FT                   GLKFILGMKLFLSHKMTQSSVTMRDVMWAVHSENKHLLQSLVFADITSTARLREYKVCY
FT                   WVKQDGLVRIFESLARYEFTKNDRRDPSACAIFYLALKKKKILLSLWRVAARHPEQAKM
FT                   LNFLEHDFTQARWRTAALKNAFVLASKHRYLDSACFFLLADSLKDAVNVLVRKLEDLDL
FT                   AIGVCRVYSGDSSPELHHLLTNHVLPGAVVDNDIWTMSYVYWRLKNENLAIKALLGRYV
FT                   HEQSEHAFHDKSPINKSFLMEDPALLHLYSWIRLKSTCKNSTRWDSNEQEEYLLMNKVA
FT                   DIYRRMGCDYLSLSLLRNWKFTANAKGNADDRSNAPSWSSSQLHFSERAPGSFGNRTFD
FT                   SPSSLFDKSENRSGYTDTATPRNMLDDFMNVDSYRARSSVPEAQELWEETPDALSSGYS
FT                   THTQNKMKGTSGHPPVKVPKVRNLLDDFM"
FT   CDS_pept        complement(518615..519766)
FT                   /codon_start=1
FT                   /gene_family="HOG000065980" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15757987"
FT                   /locus_tag="AEL062C"
FT                   /orf_name="AGOS_AEL062C"
FT                   /product="AEL062Cp"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="AAS52623.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG022580"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="HSSP:1A58"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR008940"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR023114"
FT                   /db_xref="UniParc:UPI0000252D2A"
FT                   /db_xref="UniProtKB/TrEMBL:Q757S4"
FT                   /transl_table=1
FT                   /translation="MSGVTRVYIDIEIGGCKSGRIVFELFQDKAPLSAQNFKQLCCGGI
FT                   ELDGKHVSFRGNRFHRVIKNFMVQAGDIMYGMEGADEENLGKGGCSIYSQQDEEGPCRG
FT                   AFADENTGEFSEPFLLAMANMGAPDSNSSQFFITTTAAPHLNGKHSIFGQVIHGKAVVR
FT                   EIEKEAVDSDGVPEKAVRIAGCGEWTQDMPVPLYNACNDPIGGDIYEEYPTDNTLFGGE
FT                   EFGKAYAAAVLIKESGTQLLKRKDFQNAFFKYRKSLNYVNEYIPDVDIDAEQFEKFNVL
FT                   KQKLYLNMTLALFNMGSYDSAISYTNYVLEMDRVPSMDLAKAYYRRGNCYLAKNLLEEA
FT                   LSNYKRCKEHNSDEAVDMKIASVESKLAARLEKTKKSISKFFQ"
FT   CDS_pept        520000..524181
FT                   /codon_start=1
FT                   /gene_family="HOG000248822" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15757988"
FT                   /locus_tag="AGOS_AEL061W"
FT                   /product="AEL061Wp"
FT                   /function="ARF guanyl-nucleotide exchange factor activity "
FT                   /function="binding"
FT                   /biological_process="regulation of ARF protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS52624.2"
FT                   /db_xref="GO:0005086"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032012"
FT                   /db_xref="HOGENOM:HBG059005"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001DB2889"
FT                   /db_xref="UniProtKB/TrEMBL:Q757S3"
FT                   /transl_table=1
FT                   /translation="MARQDVAVNPVTIVIKECITLSTAMRKYTRYTSQLGVAALLGGGS
FT                   DIFSNQDDSLADAFSNLASKTNDPLLSGFIQLRLMLNNLKTLDEVDALTVLQPFLLVIS
FT                   TASTSGYITSLALDSIHKIFRYNILNEHSKNYVAAFRQTVHSLTHCRFEGSEQTSDDSV
FT                   LLKVLSLIETIVVSSCGDVLSDSLMSDVIQTVMSLACNKRRTEVLRKAAEMSMMSITVK
FT                   LLAKLRAIEPTNTEKYINDESFATALLKEDIIGTMPRATTDVSVENGTLVATEAKKHED
FT                   APVDDTTLEENYGLPVVKDYLGILISLIVIENSHKQNNSTKVFGLHLLNMTVELAGDLF
FT                   PKHPRLFSLVSDPIFKNILYLIQNTDKLSLLQAALQLFTTLTIILGDCLQSQIELTLKT
FT                   IFSILLDEKKGNDNKIRPSAVKELLVEQISILWTRSPSFFTSIFINYDCDLERSDLAIN
FT                   FLKKLTKLALPESALITADSVPPICLEGFISLIDDMHANVQRSGEKFDSDLQVDILVQR
FT                   ERKNEFIRCVEEFNKKPKVGIPLLIEKNFIKSEDESDIASFLFENNTRLNKKTVGEYLA
FT                   SPDKVSLLRKFIDLFDFENLRVDEALRILLTKFRLPGESQQIERIVEAFSAKYVSSQHY
FT                   DESKAGKDIEDDYSTVQPDSDSVFILSYSIILLNTDLHNPQVKKHMTLDDYTYNLKGCN
FT                   NQKDFPMWYMERTYYSIRDKEIVMPEEHHGSDGWFDDVWNNLISSNTVLTELNTPRHNS
FT                   IEDMDPAYTLHFDRAIFQNVGSQIVSTLFKIFAVASDDNISTRMLSTIDKCSQLASFFG
FT                   FTKLYNGILTETIKFTTLTGETKNARKLYDFNDVPVVLIHLEDTMEVITVSSQSVRLGQ
FT                   DFKGQLATVVLSRILGNTGKNTISKEIWVQLLNILLVLYEGLVIPPDLCPQVQRELALG
FT                   PLPKPSAEYNINKTKFTKGLLSTFASYLKGDEEPTEEEIAWSVKGMETIENSQLISSIL
FT                   GASQETEAELISHILGAVKLEKNGDNSRFFEQEILFLCELAISMLVRCQNKSTGRQILT
FT                   QLKIFAEINGISKAFRQRLLSYNIFVIKQLETPEAIISLIDKEMLFNNEIYDSEFFESD
FT                   PGMSVLNSLLSLSQQDAFTSELLANEGFWKLLRRYAPLKKCTLAVYNFLDNFIITNQGL
FT                   ITDENFMWMLGLLDEISSTGAVGGRWEEEFDRLVKSGRAVEKENPYQEIVDLSLKSINL
FT                   TSQLIKVRTNLTKTEIVALIQALAHQCLNPSYQLRLYALSSLEDAMTKGILVSNDTITV
FT                   SELFEHGLFPLIDNSKNINALPLLDIMSTLSRIYLYYLECGKTTNDTYMKVQNMFNKYV
FT                   ENPTMEQKLQELITAKKEIEKNINGPSRPHTVADNKETSMEEAPGPVEEK"
FT   CDS_pept        complement(524268..525557)
FT                   /codon_start=1
FT                   /gene_family="HOG000209080" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20624451"
FT                   /locus_tag="AEL060C"
FT                   /orf_name="AGOS_AEL060C"
FT                   /product="AEL060Cp"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS52625.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG059006"
FT                   /db_xref="HOGENOM:HBG396555"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0000252D2C"
FT                   /db_xref="UniProtKB/TrEMBL:Q757S2"
FT                   /transl_table=1
FT                   /translation="MDKEHVIDADKAGYSPSSSLIGMVTAGGRSMVYQFTSFYLRAPMK
FT                   LFRPARYDYTHYLRILLTGEDKVSQPQRPKPSGQWFRNPAYTYYLENSSVGVLTRALNK
FT                   YGWKVLPDRVLPPLVLNSAAGVVLYTTYLSSLSFLRGPLGAGGEHGQSPPRISDVVCAG
FT                   FMAGVAQAVASAPIDAIYTRSTANDLLSSAKKYNSLWLYGIDKLKEIGLVGCFGGFGLS
FT                   LVKESVGFAVYFTTFELLKGQVCNKTIEYLEAHKKLKATGAQSANEGSEQYLPAKTTSE
FT                   GYMSQREKQWLQRSFVFGAGVTAAFALQLVQYPMLKLQKTHLSRLEAFDIYQKAIANLK
FT                   DQSTIEPKISKIRLRGGNTRLLHLYFNSYIDTLEHVASISKSTGTARWLYKGFLRNTLA
FT                   IIPGTATGLLLLEYMRTSLDGSAQYSSPLE"
FT   CDS_pept        525979..526782
FT                   /codon_start=1
FT                   /gene_family="HOG000213905" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20624452"
FT                   /gene_name="URA3"
FT                   /locus_tag="AEL059W"
FT                   /product="Orotidine 5'-phosphate decarboxylase "
FT                   /EC_number="4.1.1.23"
FT                   /function="orotidine-5'-phosphate decarboxylase activity "
FT                   /biological_process="'de novo' pyrimidine base biosynthetic
FT                   process"
FT                   /biological_process="pyrimidine nucleotide biosynthetic
FT                   process"
FT                   /protein_id="AAS52626.1"
FT                   /db_xref="GO:0004590"
FT                   /db_xref="GO:0006207"
FT                   /db_xref="GO:0006221"
FT                   /db_xref="HOGENOM:HBG052872"
FT                   /db_xref="HOGENOM:HBG326699"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniParc:UPI0000252D2D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757S1"
FT                   /transl_table=1
FT                   /translation="MSTKSYAERAKAHNSPVARKLLALMHEKKTNLCASLDVRTSRKLL
FT                   ELADTLGPHICLLKTHVDILTDFDIETTVKPLQQLAAKHNFMIFEDRKFADIGNTVKLQ
FT                   YSSGVYRIAEWADITNAHGVTGPGVIAGLKEAAKLASQEPRGLLMLAELSSQGSLARGD
FT                   YTAGVVEMAKLDKDFVIGFIAQRDMGGRADGFDWLIMTPGVGLDDKGDGLGQQYRTVDE
FT                   VVSDGTDVIIVGRGLFDKGRDPNVEGARYRKAGWEAYLRRIGETS"
FT   CDS_pept        527133..527396
FT                   /codon_start=1
FT                   /gene_family="HOG000185786" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15757989"
FT                   /gene_name="TIM9"
FT                   /locus_tag="AEL058W"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit TIM9"
FT                   /function="metal ion binding"
FT                   /biological_process="protein import into mitochondrial
FT                   inner membrane"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="mitochondrial intermembrane space
FT                   protein transporter complex"
FT                   /protein_id="AAS52627.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0042719"
FT                   /db_xref="GO:0045039"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG371100"
FT                   /db_xref="HOGENOM:HBG628226"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="UniParc:UPI0000252D2E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757S0"
FT                   /transl_table=1
FT                   /translation="MDALNSREQQEFQRVVEQKQMKDFMRLYSNLVERCFSDCVNDFTS
FT                   SKLTSKEQTCIMRCSEKFLKHSERVGQRFQEQNAALNQSMGR"
FT   CDS_pept        complement(527582..529255)
FT                   /codon_start=1
FT                   /gene_family="HOG000246660" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624453"
FT                   /locus_tag="AEL057C"
FT                   /orf_name="AGOS_AEL057C"
FT                   /product="AEL057Cp"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAS52628.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG059007"
FT                   /db_xref="HOGENOM:HBG626269"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000252D2F"
FT                   /db_xref="UniProtKB/TrEMBL:Q757R9"
FT                   /transl_table=1
FT                   /translation="MMGGTKQPLVSEQLRGFPWAQISLVMFVRLSEPVAFMSLFPYMYF
FT                   MVRDFDVSSNESQIAAYSGWLGSVFALCQVVSAMNWGHFAERYGRKWALILGQLGTCCS
FT                   LLLLGFAGNYYQALLARSLMGLLNGNAGVVRTVVGELASQERHQALAFSTMQLLWQFGA
FT                   VLGPMIGGYLSFPKGQNKIPEWYPPWLSKMVSLFPYSLPNLVISVLLLGSVLTTALFLE
FT                   ETHPHLKHSRDRGLEVGSWLLRHFWPWYTARSSSTERALVTDEEVQSDTEERTHLLSDG
FT                   RRTSGEDYAYSRVTGKDAAPGETQNKAVATGTQLGTEFVEEGIPPPLEQTAMRHMIYAD
FT                   VFYPIISHLCLELHLTPTVEFLPVFLSTALATEERPDGTVGLASRFPWKIVGGIGMSSE
FT                   RAGDLLSTTGIVGCLVMFFLFPLITQRYDPISIYRSGLSLFPIVYVLVPYIVFLQKDSI
FT                   PKWCTYVYLYSLTSAKTTICCLTMPQMLLIIHRTCHPRYRGVVNSAVISLGAGARFIGP
FT                   LLGGYILAWSQAHEVAWLLWWLLAALAVYAGYQAYKIRAV"
FT   ncRNA           complement(529328..529816)
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNRRPR1"
FT                   /product="AgSNRRPR1"
FT   CDS_pept        530788..532752
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15757990"
FT                   /locus_tag="AEL056W"
FT                   /orf_name="AGOS_AEL056W"
FT                   /product="AEL056Wp"
FT                   /protein_id="AAS52629.1"
FT                   /db_xref="HOGENOM:HBG059008"
FT                   /db_xref="UniParc:UPI0000252D30"
FT                   /db_xref="UniProtKB/TrEMBL:Q757R8"
FT                   /transl_table=1
FT                   /translation="MTQYKVEDYLNLDEGQFSDSAEETGIYLTQAAYDEGFSTTAASVP
FT                   VILAEVPKLARLSELSLLPQYNSSTGNRVEKKSVQRNRRDRVIRSFVKAFDKTLETSDS
FT                   SLLSATPSPKSIFSYGFSSSQDEERAFSVVEGHLQIPQDDAYINDGGTMFKLALENSPS
FT                   VSPEELELLETAPFANNNSDDILSFSQVIEQHANMEQDMVQLEPDASRQVFDYLANLER
FT                   SVELTSLTFEDQFDVPISVFSQMPQQMHVHMQAQLPGEDEDNEEEEEEAYEEEEEDEEE
FT                   EETYTEEPSSNFTMPIPLQLTPQPVFHRLQEVRPETLGSSPRMNNFVPEKKRRKLSIQP
FT                   LTFDQIRLTHGLLRKTMIRHYDTEDLKLQIKKEIAKEQKAVKDALKRPDKAQCPKKRTI
FT                   SKTRLQDVSINFHQALTGLRDLEVVFAQNHILSSGYWSAKANALGVTEMRSIVSVIRQQ
FT                   YENHITFEFVDDDVNPNTIPDGMKLLKFSVISRYCEHLENDRYVNDWVHLITYNDLSEL
FT                   LGFALDISDEMIVVNDDSLIFETQNEPWKRLLMRWRSIYDKKLFIISESKEMMQLKIEK
FT                   AKSRGKPFNLDEREKKLKEDLFNQLMSYKGLLGAPSKTAKDQALIKTNKLQALIKIVLE
FT                   KYCWVDPSKVPEGGYRRLF"
FT   CDS_pept        complement(533101..534738)
FT                   /codon_start=1
FT                   /gene_family="HOG000053808" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18929973"
FT                   /locus_tag="AEL055C"
FT                   /orf_name="AGOS_AEL055C"
FT                   /product="AEL055Cp"
FT                   /function="magnesium ion binding"
FT                   /function="thiamine pyrophosphate binding"
FT                   /function="transferase activity"
FT                   /protein_id="AAS52630.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0030976"
FT                   /db_xref="HOGENOM:HBG316485"
FT                   /db_xref="HOGENOM:HBG460149"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="UniParc:UPI0000252D31"
FT                   /db_xref="UniProtKB/TrEMBL:Q757R7"
FT                   /transl_table=1
FT                   /translation="MGIQVSDQIAIALKQHGIEVVFGIVGIPIVELAEKLAEHGVRFIA
FT                   CRNEQSCSYAASVYGYLTNKPGALLVVGGSGVVHALAGIHNAWVNKWPLLVIAGSTEDE
FT                   YKGGFQELDQLRIVAPWTSFKGRLSLDNVNYMVYTAVKTAVLQHGVSYLDVPGRLINMD
FT                   AVGPLASKPVDIQHVRSGPDSSRVQGAAKLLQDGRNILVVVGRGCAEYPGVVRSFLERY
FT                   RLPFLPVPMAKGIVPDSHELNVNGCRSLALKRAEIVLVLGARLNWILHYGSAPKWNADA
FT                   TFIQVDRDPATLGHNNSSGVNYSVLSDVELFINAITAVLPQSWQYRGVDNEVLDKIREN
FT                   GVKLQRKAQLTPGSPLNYHAVYSLLRKLIDDKNTILSAEGANTMDNSRLWFGTDYPKRR
FT                   LDAGTGATMGLGVGYALSAKLANPDKFVVALEGDSAFGFSCMELETAVRNKVGLVVVVM
FT                   NNGGIYHGNPGSGPVRTTDLSPECAYHLVGQGLGCNGVLIRTLDELKKEFPRALQNSMK
FT                   SITTVLNVILEPGTQTNVSFGWQAKSNM"
FT   CDS_pept        complement(534932..536365)
FT                   /codon_start=1
FT                   /gene_family="HOG000226033" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15757991"
FT                   /locus_tag="AEL054C"
FT                   /orf_name="AGOS_AEL054C"
FT                   /product="AEL054Cp"
FT                   /function="ATP binding"
FT                   /function="asparagine-tRNA ligase activity"
FT                   /function="aspartate-tRNA ligase activity"
FT                   /biological_process="asparaginyl-tRNA aminoacylation "
FT                   /biological_process="aspartyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS52631.1"
FT                   /db_xref="GO:0004815"
FT                   /db_xref="GO:0004816"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006421"
FT                   /db_xref="GO:0006422"
FT                   /db_xref="HOGENOM:HBG370907"
FT                   /db_xref="HOGENOM:HBG745843"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniParc:UPI0000252D32"
FT                   /db_xref="UniProtKB/TrEMBL:Q757R6"
FT                   /transl_table=1
FT                   /translation="MLAPFRPRRYSAITSPLRTITVRDLLQLQDAPKQPLDVQGRVRSF
FT                   RAMKNASFLDLEDGSSKNALKVVISHHGRPNPVTLKTGQSVAVRDAMWKWTPDRQQAFE
FT                   LACQPTDVQVIGDVTDEYPLQKKYVSLKHLRQWPLWKHRTQYLGGLLRFRSHIEATLTQ
FT                   ILTQEGIYKVPPPVVTSGDCEGAGELFHVEANSLRASQRKYFGTNAYLTVSAQMHLEVI
FT                   ALALGRVWALTPCFRAEESDTSRHLSEFWMLEAELCFVQDVTQLTGFVQKLIQELARTL
FT                   LQRQDELLPGMVPQEGAESRETVLARWQSLIEHPWHTVTYTEAIQVLQRQHDLSPFVHA
FT                   PQWGAALQSEHEKWLAGAHFGGPVFVTDYPRECKAFYMRLNDDKKTFACFDLLFPEMGE
FT                   VMGGSIREERYDALLREMTSRNMNIAELDWYLQLRRQGSAPHGGFGLGMERLISWLYGN
FT                   HNVRDAIGFYRSATSTIEL"
FT   CDS_pept        complement(536582..537217)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15757992"
FT                   /locus_tag="AEL053C"
FT                   /orf_name="AGOS_AEL053C"
FT                   /product="AEL053Cp"
FT                   /protein_id="AAS52632.1"
FT                   /db_xref="HOGENOM:HBG059009"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0000252D33"
FT                   /db_xref="UniProtKB/TrEMBL:Q757R5"
FT                   /transl_table=1
FT                   /translation="MPRELIDSISAQYRELLAIARQMASRDAHLERSKADYKAQSDQCE
FT                   PIKLQTWDGYQQGELTAPSLAEIYAQEDAGEEARAPAEHEDQLQRLFTALPYIWNDPTA
FT                   MVPDQAASRQEDEELKISGGTIELTCPITCQPFVRPMISRKCGHVFDEVGLRRFLERQT
FT                   KPCPQGACGHNLSMKDFVPDLVMQFRCLLHEARGPLTRNASEDPADIV"
FT   CDS_pept        537446..538213
FT                   /codon_start=1
FT                   /gene_family="HOG000000838" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18929974"
FT                   /gene_name="EAF5"
FT                   /locus_tag="AEL052W"
FT                   /product="Chromatin modification-related protein EAF5 "
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52633.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG059010"
FT                   /db_xref="HOGENOM:HBG103462"
FT                   /db_xref="UniParc:UPI0000252D34"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757R4"
FT                   /transl_table=1
FT                   /translation="MPMHAQRLIIEQAFMTKTGASHPPSSPQRTANSLMNISKVLILET
FT                   LYELLLNGQTNRVSLVRLQADVNDHPMTKQLAHQWQTLKINDILDVIKLLFPKQTSLSD
FT                   GQIIFYNLQIVEIRDTLLDVVRECQDTLVKDVKQLEQQYQAIKSHDDMKIRRERIMGMY
FT                   RDTILAKLQSFQHFHRLYSKLDPSPVVRDMMDLERIKATSIENLSHLQHILQKCVTDSV
FT                   MTTKAGSDRYREIILSQGELDDTVKFVRYAMDN"
FT   CDS_pept        complement(538296..538409)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059094"
FT                   /locus_tag="AGOS_AEL051CA"
FT                   /product="AEL051C-Ap"
FT                   /protein_id="ADJ41774.1"
FT                   /db_xref="UniParc:UPI0001DB28A6"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGD1"
FT                   /transl_table=1
FT                   /translation="MLPRGVILVLVIVGLVGIGLAVIFAVRRGWFNTLRQK"
FT   CDS_pept        539150..540052
FT                   /codon_start=1
FT                   /gene_family="HOG000142050" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15757993"
FT                   /locus_tag="AEL051W"
FT                   /orf_name="AGOS_AEL051W"
FT                   /product="AEL051Wp"
FT                   /protein_id="AAS52634.1"
FT                   /db_xref="HOGENOM:HBG103461"
FT                   /db_xref="HOGENOM:HBG124040"
FT                   /db_xref="UniParc:UPI0000252D35"
FT                   /db_xref="UniProtKB/TrEMBL:Q757R3"
FT                   /transl_table=1
FT                   /translation="MTATLQHLKKFELALLAEKLKIKHPAKLNKPALVALIQEHLRALK
FT                   EPLDVLEYPELSEYYDSAGESEGETDAEISGEEDGDESGEDADSAGEQEGESGLQWFSK
FT                   LRFDKMRPASSQFSFQFHELLTDVQSNIADVNESIQDTLSTIPAISAIFYALEAYMYII
FT                   QPFFSFDWSRRPYFVHCTLSHTQLISLLAFWGTFSFCVPAVAAYYINFIRYDLPQVEID
FT                   PLVFHVTKSLLALFVGHYWRPGLVSEATYVVKDSFGRAKFSELIRHGLAFAQLQWALNL
FT                   QQWPLIFGITGVILCLYVL"
FT   CDS_pept        complement(540314..542467)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15757994"
FT                   /locus_tag="AEL050C"
FT                   /orf_name="AGOS_AEL050C"
FT                   /product="AEL050Cp"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS52635.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG059011"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniParc:UPI0000252D36"
FT                   /db_xref="UniProtKB/TrEMBL:Q757R2"
FT                   /transl_table=1
FT                   /translation="MQSADHKAHCGGMNDQELEEAYDYNSVLDELDYMTAPGARTAWHK
FT                   RWMQQARGTWYKWRTPRRLAGSQRGVELYRLDRAGEGTMLLEDEARELEGKRWGSWART
FT                   LVPLVMLAALLPVYLTILAPWIRFAKLAPTEPAASPRWNNGTHDFVGLTLLVSIDGFHP
FT                   SYINNESTPFINELYSGTYAKSGVLTTPYMRPSFPSETFPNHWTLVTGRRPGHHGIVSN
FT                   VFYDDTLKKEFVFVDSPQDPAFWKGGDPIWFTAQKAFGISEFSAAAHFWPGSETVYEED
FT                   DPERETRTPRYVDKYDGLESMDHKLDRIFEFIDMPLGERPGLILSYIPEVDSVGHRYGN
FT                   AWTNPVLQKALRDTDDFMRRLFQGLEQRNLTSFANTVIVSDHGMAKLNWTKDVLFLEDI
FT                   FSSDDVSRLERISGHVNCGVYPKDSHDVHYFHQTLKEHLKGLPYDVYLREQLPAEYELQ
FT                   GRYDHRLAPIWILSHPGKYIMDNRKTAPPNEIFGMHGFNNSHVDMRATFIGVGPFFGRS
FT                   GVTSYLAPFDNIEVCQLLSDVIGLAEPAETDATWPWPFSHMTLKEWTNIALPYGWHEDS
FT                   EYLAYRYPGSTFNKLWNHFKRPAAQEQVTTTLSSPSDHPPSSAAAPTTTLSSPSDHPPS
FT                   SAAAPTTTLSSSSDHPTSSSAAPTTETTEWYSGIMDGAAHIIDDTEQLINSIMPQEVGD
FT                   FVGGLVHDVLGGVEHFLDGLSSE"
FT   CDS_pept        542959..544566
FT                   /codon_start=1
FT                   /gene_family="HOG000246503" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777006"
FT                   /locus_tag="AGOS_AEL049W"
FT                   /product="AEL049Wp"
FT                   /protein_id="AAS52636.2"
FT                   /db_xref="HOGENOM:HBG059012"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR019050"
FT                   /db_xref="UniParc:UPI0001DB28A7"
FT                   /db_xref="UniProtKB/TrEMBL:Q757R1"
FT                   /transl_table=1
FT                   /translation="MSQFQGFKVQVELKDGKVITGTISKCNSKSLTLQDVAFSDGGISQ
FT                   LFKVKASRLRDLKVTGAPKGGKKWLANNAANGSPSNGAQSGGNGGTQSPGSGEEAAADG
FT                   RSSSSSHGQHSGKDATWEHDDDLERLKNEDFDFQSNLRMFNKQDVFAKLKQQDTVNPSE
FT                   RLVSHNKLRKEKIHFENDEMVIPNAKDDDWDEPGSGSAGSEKQKAAAAPAEYLPITKSI
FT                   NITHLLQQSSKDAPSEDEVLVKLQNVLSPPSRSQSLSKMPGFRTLKTDIAVPLATPVQL
FT                   LEMERLAEDAFLFPPALALEHSAVHLARFMRQKLGGAARLHTANNNAQPLVVLLASENR
FT                   CGARALATGRCLAQNSHVRVLAVLAADPHAPGADASFRTQLDMFSRCGGRVVDSVVALS
FT                   AALEGLNSPPELIVDALQGFDCSLADLVDDAPGAGAARLRTLIAWANAQNCPVWSLDIP
FT                   SGIDAGSGAHTFEPCVRPDAVVCSSWPLVSLALLDCPELYLCDSAIPHQCYAMRSSLRK
FT                   FAAVRDVFVTEGVVQLTR"
FT   CDS_pept        544884..546590
FT                   /codon_start=1
FT                   /gene_family="HOG000177331" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15757995"
FT                   /gene_name="VAC8"
FT                   /locus_tag="AEL048W"
FT                   /product="Vacuolar protein 8"
FT                   /function="binding"
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="AAS52637.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="HOGENOM:HBG055740"
FT                   /db_xref="HOGENOM:HBG327627"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0000252D38"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757R0"
FT                   /transl_table=1
FT                   /translation="MGGCCSCLKESQDDATVLPIAENEREAVTSLLGYLEDKDNYDFYS
FT                   GGPLKALTTLVYSDNLNLQRSAALAFAEITEKYVRPVDREVLEPILILLQSHDPQIQIA
FT                   ACAALGNLAVNNENKILIVEMGGLEPLIEQMKSNNVEVQCNAVGCITNLATQDDNKAKI
FT                   AHSGALVPLTKLAKSKNIRVQRNATGALLNMTHSGENRKELVDAGAVPVLVSLLSSSDA
FT                   DVQYYCTTALSNIAVDESNRRKLSQTEPRLVSKLVVLTDSPSARVKCQATLALRNLASD
FT                   TGYQLEIVRAGGLSHLVKLIQCNSMPLVLASVACIRNISIHPLNEGLIVDAGFLKPLVK
FT                   LLDYNDNEEIQCHAVSTLRNLAASSEKNRQEFFESGAVEKCKQLALVSPISVQSEISAC
FT                   FAILALADNSKLELLDANILEALIPMTFSTNQEVAGNAAAALANLCSRINNYEKIIESW
FT                   TEPSKGVCGFLIRFLQSEYPTFEHIALWTILQLLESHNETMLGLIKSNKEIVKSIKRLS
FT                   DINYENAQKASSLHSRLQQVNGGSVASGSEQYEHASLELYNITQQIMQFLN"
FT   mat_peptide     544887..546587
FT                   /gene_name="VAC8"
FT                   /locus_tag="AEL048W"
FT                   /product="Vacuolar protein 8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757R0 "
FT   tRNA            547545..547616
FT                   /gene_name="tRNA-Met"
FT   CDS_pept        complement(547669..548007)
FT                   /codon_start=1
FT                   /gene_family="HOG000000898" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15757996"
FT                   /locus_tag="AEL047C"
FT                   /orf_name="AGOS_AEL047C"
FT                   /product="AEL047Cp"
FT                   /protein_id="AAS52638.1"
FT                   /db_xref="HOGENOM:HBG059013"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI0000252D39"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Q9"
FT                   /transl_table=1
FT                   /translation="MQENRGERPKSCRRRRGDGSMASELAQIDLNDLLGATLRVEVGPD
FT                   RVLYGVLVALDCHANYLLDRVVERRGGRERELGLVSVPSEAVGNVKIEAATLRRVREAK
FT                   SAFRRAVA"
FT   CDS_pept        548086..548292
FT                   /codon_start=1
FT                   /gene_family="HOG000000899" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929975"
FT                   /locus_tag="AEL046W"
FT                   /orf_name="AGOS_AEL046W"
FT                   /product="AEL046Wp"
FT                   /protein_id="AAS52639.1"
FT                   /db_xref="HOGENOM:HBG059014"
FT                   /db_xref="UniParc:UPI0000252D3A"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Q8"
FT                   /transl_table=1
FT                   /translation="MTHPEPKINLKTITAHQVLSHREKMCELFQLLDDSERHELIIGTA
FT                   EQRERRLNEFRERRDALRRELGK"
FT   CDS_pept        join(548573..548577,548641..549271)
FT                   /codon_start=1
FT                   /gene_family="HOG000233452" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15757997"
FT                   /locus_tag="AEL045W"
FT                   /orf_name="AGOS_AEL045W"
FT                   /product="AEL045Wp"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="AAS52640.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG492183"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="HSSP:1AYZ"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR015581"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI0000252D3B"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Q7"
FT                   /transl_table=1
FT                   /translation="MSSSKRRIETDVMKLLMSDHDVELVDDNMQEFHVKFHGPKGTPYE
FT                   RGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDAASGSICLDVINSTWSPLYDLLNIVE
FT                   WMIPGLLKEPNGSDPLNNEAATLQLKNPQMYEEKIQEYIDKYATEERYVQQFGGAGGDA
FT                   GDGSEDDEDADENPSDGMDYDEDDEELSEIEVEEEDEEVHISDSDLLD"
FT   CDS_pept        549753..551864
FT                   /codon_start=1
FT                   /gene_family="HOG000175159" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20624454"
FT                   /gene_name="GLC3"
FT                   /locus_tag="AEL044W"
FT                   /product="1,4-alpha-glucan-branching enzyme "
FT                   /EC_number="2.4.1.18"
FT                   /function="1,4-alpha-glucan branching enzyme activity "
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="glycogen biosynthetic process "
FT                   /protein_id="AAS52641.1"
FT                   /db_xref="GO:0003844"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005978"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG021253"
FT                   /db_xref="HOGENOM:HBG302308"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000252D3C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757Q6"
FT                   /transl_table=1
FT                   /translation="MAGVPDNVKGVVELDPWLAPYGDILSARRFLADKWRHDIEHAVPG
FT                   GRRSLVEFARDAYKSYGLHADAQSKSITYREWAPNATRAFLVGDFNGWDETSHELQNKD
FT                   EFGVFTGVFGPGADGDFMIPHDSRVKVVFELADGSRIHRLPAWIKRATQPSKETAKEWG
FT                   PSYEARFWNPASPYKFKHERPRLDPNVESLRIYEAHVGISTPEPRVGSYSEFTKDVLPR
FT                   IRDLGYNAIQLMAIMEHAYYASFGYQVTNFFAVSSRYGTPEELKELIDTAHGMGIQVLL
FT                   DVVHSHASKNVSDGLNMFDGTDYQYFHSISSGRGEHPLWDSRLFNYGSFEVQRFLLANL
FT                   AFYIDVYQFDGFRFDGVTSMLYHHHGVGERGAFSGDYNEYLSDHSGVDHEALAYLMLAN
FT                   DLIHDMLPANGVTVAEDVSGYPTLCLPRSVGGCGFDYRLAMALPDMWIKLLKESKDEDW
FT                   SMGHIVYTLVNRRYKEKVVAYAESHDQALVGDKTLAFWMMDAAMYTDMTVLKELTPVVD
FT                   RGIALHKLIRLITHSLGGESYLNFEGNEFGHPEWLDFPNANNGDSYQYARRQFNLVDDG
FT                   LLRYKHLYAFDKAMQEAEGKHKWLNTPQAYVSLKHETDKVISFERNGLVFIFNFHPTQS
FT                   FTDYRIGVDEAGAYRIILNSDREEFGGHRRIEEENSVFHTTDLEWNGRRNFIQVYLPSR
FT                   TALVLARNP"
FT   tRNA            complement(551994..552066)
FT                   /gene_name="tRNA-Lys"
FT   CDS_pept        552909..555767
FT                   /codon_start=1
FT                   /gene_family="HOG000196377" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929976"
FT                   /locus_tag="AGOS_AEL043W"
FT                   /product="AEL043Wp"
FT                   /protein_id="AAS52642.2"
FT                   /db_xref="HOGENOM:HBG053978"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR019402"
FT                   /db_xref="UniParc:UPI0001DB28A8"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Q5"
FT                   /transl_table=1
FT                   /translation="MTSVNGKHIVHLHSLFASSAFICALVVGYQLHFHKIVRNAHYGYP
FT                   DEWFPSVSATIGDRYPERSLFQVLIAVTAFPRFLLLLMHWVRSRSALGVMAGFTRTMTC
FT                   GGWVYITSSDDHDAHDVFMIAYIVLTIPWCVFVVRHATHNRALRKVVGGAFFGTLVPLI
FT                   YWFIQHNVKKRAGAYSIYAYFEWSLIILDILFDGLSYADMEDLTITFGTQGSRPSVGVL
FT                   QSKTSTLLSSAGKGLGGGAMEEMLEEVIITQEHEKLVYLPDEPITNQASLFYIVVSTFD
FT                   SFMFWTNLTALLCMIWFFPLWYMGISGYEAVIAAVLSPVLLYVPFFPTLIQQYGPLLAN
FT                   VIGIGAYIVEKPEWRLMTVAVATGLSTMNFAVTLKSIVKDNARVAQFAITWSLGLVASV
FT                   VLKMAFYSNNPLWPIMKEENGGWNKTGLAIATAFAMITPYVNRCHYARKKSSEPSGQTY
FT                   TILPLYKRALASVGFGALVFAIHQSLTESSTLIYWCWEGWSQSAKMGPLAWPFTGLTCV
FT                   AMVVGVHLSKRFAESPGSTSRWLLALSTAVLSTSHITGWYKFVFGGLPYAVSIMLFIPN
FT                   YFITMNKASYFSLVGSFVVYILLTLSHVWTVAYAFVPFGWVLRERLHWVLTASTMCILL
FT                   GSCDYPLSVPISAAFMKRVTIVLVGVMVAIAYSVEQLKPTGVPQPYHPDANLITAGIWT
FT                   IHFGLDNDLWASENRMIDLIRDMELDLVGLLETDTQRITTGNRDLTARMSHELQMYADY
FT                   GPGPNKHTWGAVLLSKFPIVESTHHLLPSPVGELAPVIHAVIEAYGELVDVYVFHSGQE
FT                   EDVLDRKLQSEALRDIMGARDRPAILLSYLVTKPNEGNYHTYVGEASGMQDIDFEDDDR
FT                   WCQYILYKNLKRTGFARVSRSTITDTELQVGKFQVHNGVSQGLKRVEKSQVNDTLRFPD
FT                   KFLGDGVRGHRYHVFNEPRYYE"
FT   CDS_pept        complement(556385..558028)
FT                   /codon_start=1
FT                   /gene_family="HOG000202869" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081286"
FT                   /locus_tag="AEL042C"
FT                   /orf_name="AGOS_AEL042C"
FT                   /product="AEL042Cp"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS52643.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000252D3E"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Q4"
FT                   /transl_table=1
FT                   /translation="MTLVDKLLLRNIEYKGTAYDYFPKVYNVYLVAVVACISGMMFGFD
FT                   ISSMSSMQDFEPYKDYFKHPNELTQGGITASMAAGSLLGSILSPGISDAFGRRVSLHMC
FT                   SSLWIIGAVLQTAAQNQAMLFVGRIVAGLGVGFGSSVAPVYTAEVSPPKIRGAVGGLFQ
FT                   LSVTVGILVMFLIGYGSVSLNSVASFRVAWSMQLVPGVVLLLATFLLPESPRWLANHGR
FT                   WDETTLVVEKVGRSVNVSDEELRIHINEIRERVALDEMARDFTYADLFRRKTQRKIFIG
FT                   MAAQMWQQLCGMNVMMYYIVHVFKMAGFSGNQNLVSSIVQYVLNVGMTIPSLFLVDRAG
FT                   RRPVLIIGGVLMFTWLYAVAGILATYSVPRPNGVEGNTTVRIEIPPERSSAAKAVIVCS
FT                   YLFVCSFAPTWGIGIWVYCAEIFNNIERARGSALCTSVNWAFNFALAMFVPTAFKNITW
FT                   RTYIIFGTFSVALTIHAFLSFPETKGKTLEEIDEMWDAHIPAWRTASYKPELAQMAAPK
FT                   LSSGSISDATGGLHEKKAAAGSPGASAGSS"
FT   CDS_pept        complement(558296..559015)
FT                   /codon_start=1
FT                   /gene_family="HOG000057124" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081287"
FT                   /locus_tag="AGOS_AEL041C"
FT                   /product="AEL041Cp"
FT                   /protein_id="AAS52644.2"
FT                   /db_xref="HOGENOM:HBG059015"
FT                   /db_xref="InterPro:IPR019327"
FT                   /db_xref="UniParc:UPI0001DB28A9"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Q3"
FT                   /transl_table=1
FT                   /translation="MSHVPAWKRIQIRQQQQQLSTDEEDALNVTTHLATGRPRGQHRAA
FT                   DPAQRIRKPAKREKLPSSERKQRTATVLRDQLRYLLDFYLEKVPDEPLPAALLQQPAVA
FT                   AYVDARPSAEEAVVAPSWKFSKQKQNWLIKHLHDIDALPSAYDPLLRLYLRGLGDRARA
FT                   AVIARCTDTLRSWEDYTAAEEEHARRVVDATAPADGASEPTAAPTPPCSVAVKDRCAGL
FT                   FEALSAQSSPSAAPDNI"
FT   ncRNA           559176..559235
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR33"
FT                   /product="AgSNR33"
FT   CDS_pept        559534..560013
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929977"
FT                   /locus_tag="AGOS_AEL040W"
FT                   /product="AEL040Wp"
FT                   /protein_id="AAS52645.2"
FT                   /db_xref="HOGENOM:HBG059016"
FT                   /db_xref="UniParc:UPI0001DB28AA"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Q2"
FT                   /transl_table=1
FT                   /translation="MARPGFYAACALFAATHVLSLGWSREYIARVSRVPPAQIRCNALE
FT                   RAGARYTGRFTRGVVTGYDKYVILGHLVAAVGGADVWYVGDSESDLPCVLRPDVTGVLI
FT                   YTSDAQLQRLAALLGARAPSGAWRHVQLLHGVWCVRDWGALAALVQQSDRSTTTV"
FT   CDS_pept        560028..561554
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15757998"
FT                   /locus_tag="AEL039W"
FT                   /orf_name="AGOS_AEL039W"
FT                   /product="AEL039Wp"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /biological_process="DNA repair"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS52646.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG059017"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR002008"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR018944"
FT                   /db_xref="InterPro:IPR022312"
FT                   /db_xref="UniParc:UPI0000252D41"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Q1"
FT                   /transl_table=1
FT                   /translation="MFKDHSFVFLPNGSTPRARIVAQVLRRHGGSLQEGAGDSPITYLV
FT                   PDQYLTATGEVKNRELFELEEQRPGTWRKGAVRLSWVSDCVKAGQLLNKENYAVKPPQR
FT                   AEGKRLGKRRRESEHSAAAAAARPATPLEGNAKVACALQQLAERCRLQGEAFRNRAYLL
FT                   AREAVLELPYSIQTYEQARSLPNVGDGIAQKIALLAAGGSVPGLELELTPDERIVRYFA
FT                   ACHDVGPGRAQQWRALGFESFADVLRASPQWRLPWAMLYGMRFYEDWQLRIPRDEVGEH
FT                   AAVLEQCAPAGMSVVIAGSYSRGSTTCGDIDVVLYREGCDDPEVLADDLTALVQRLVSI
FT                   GYVECPLHLSKRLQPLFDPAVHSLARGLGVSVSGRLSEKDTLARFYSGVRLPGKAPVPP
FT                   GAPAIPYVAQDRELFAPHASGSARPCRRLDLLTCKWSERGACLLYFIGNDTFNKALRTR
FT                   ASAQGMTLNQHGLFDKSSGACVESADEYRIMELLGFPRLEPTDEQRNRRI"
FT   CDS_pept        complement(561627..562973)
FT                   /codon_start=1
FT                   /gene_family="HOG000227107" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15757999"
FT                   /gene_name="PGK1"
FT                   /locus_tag="AEL038C"
FT                   /product="Phosphoglycerate kinase "
FT                   /EC_number="2.7.2.3"
FT                   /function="ATP binding"
FT                   /function="phosphoglycerate kinase activity"
FT                   /biological_process="glycolysis"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS52647.2"
FT                   /db_xref="GO:0004618"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="HOGENOM:HBG003915"
FT                   /db_xref="HOGENOM:HBG453500"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015901"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="UniParc:UPI0000186188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757Q0"
FT                   /transl_table=1
FT                   /translation="MGRSWGLLWMACLLYGVFTECRRSSQHAHTGKMSLSSKLTVKDLS
FT                   LAGKRVFIRVDFNVPLDGKTITSNQRIVAALPTIKYVLEQGPKAVVLASHLGRPNGERN
FT                   EKYSLAPVAAELEKLLGQKVNFLDDCVGEHVTAAVNGAAAGSVFLLENLRFHIEEEGSR
FT                   KVDGEKVKASAEDVQKFRQGLMSLADVYVNDAFGTAHRAHSSMVGFELPERAGGFLLSR
FT                   ELEYFSKALENPTRPFLAILGGAKVADKIQLIDNLLDKVDSIVIGGGMAFTFKKVLENM
FT                   EIGNSIYDKAGAEIVPKLAEKAKKNGVKIVLPVDFVIGDDFSQDANTKIVSASEGIPSG
FT                   WEGLDCGPESRKLFSETIASAKTIVWNGPPGVFEIPKFSEGTQAMLAAAVKASEAGSTV
FT                   IIGGGDTATVAKKYGVVEKISHVSTGGGASLELLEGKDLPGVTFLSSKQ"
FT   CDS_pept        563288..565171
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059095"
FT                   /locus_tag="AGOS_AEL037W"
FT                   /product="AEL037Wp"
FT                   /protein_id="ADJ41775.1"
FT                   /db_xref="UniParc:UPI0001DB28AB"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGD2"
FT                   /transl_table=1
FT                   /translation="METEMESALRCVMRYREQEDVDLRYMAVRELCGELRNRQDHVLQG
FT                   LDGLPGTLKAVTHEVIVRSLDDQSEVQGMVCRELLAGIGDCAVPYVVAQLVGELGGSGQ
FT                   GRRWEVVLQYLRAVLGGGGRRARDVDEGDVAAYVRALAREREPSALWHRVLAALCSGGT
FT                   VQSDELVDAVYAEARRAGSADARGAVVAVVGGVGGARAARVLARCEDAELLEQVARAHA
FT                   LKFGRVWPAVVRRWAVGELGSGPAGFRLVRHLCVLMLRADAELLRAVCARCAEALATAA
FT                   SWHAEPTVGGGAAEDDADDLQLSDEGSELMLSEDEDQGAARQRDCVQLGAAAVALLGAL
FT                   PALPAETVQAVQRLPAPFAAELQPQLVALTARHAAFVDWTIRQFGDVAQEALPALSPAQ
FT                   AAELAAARPERSRFLAPGDGIPAELRAAVYAHANSGSVPTELLQQWQNRRVASKPYVDS
FT                   TLRLVADLLALDSVSLNVHQWCIEMLAWVGDEYAFYRATVIPLMIPPLKPPKRFVHVMQ
FT                   VGTMKQREDESTHIRALVARALLSWLEDAAVSWDYNQVTHLLELLKYPLRDVPLKGISL
FT                   EILDMAVERYGGLLAHYDAELVQSVIDQASVQYPAETAHLAARFALIASSL"
FT   CDS_pept        565382..565807
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758000"
FT                   /locus_tag="AEL036W"
FT                   /orf_name="AGOS_AEL036W"
FT                   /product="AEL036Wp"
FT                   /protein_id="AAS52649.1"
FT                   /db_xref="HOGENOM:HBG059020"
FT                   /db_xref="UniParc:UPI0000252D44"
FT                   /db_xref="UniProtKB/TrEMBL:Q757P8"
FT                   /transl_table=1
FT                   /translation="MSAPSEDFTCLDEPPAPQSTPLACVSQFSRFPTSHYRDELLSRDR
FT                   STAAGLPKSSVASGADHPQAIENMVQPRASPRRLQDLLRSASADALVAEEHENESHTQQ
FT                   QAQDSLTGRDRPLLKRRPSLYEDFKKNVYQRLHMFSK"
FT   CDS_pept        566014..567252
FT                   /codon_start=1
FT                   /gene_family="HOG000210004" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929979"
FT                   /locus_tag="AGOS_AEL035W"
FT                   /product="AEL035Wp"
FT                   /function="L-ascorbic acid binding"
FT                   /function="iron ion binding"
FT                   /function="trimethyllysine dioxygenase activity "
FT                   /biological_process="carnitine biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS52650.2"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0031418"
FT                   /db_xref="GO:0045329"
FT                   /db_xref="GO:0050353"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG523230"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR012776"
FT                   /db_xref="UniParc:UPI0001DB28AC"
FT                   /db_xref="UniProtKB/TrEMBL:Q757P7"
FT                   /transl_table=1
FT                   /translation="MEIKSLKKADTIFDSYVELALCAESSVFHWIYLRDNCTCTECFHD
FT                   ATVQRTLDTFDELPWKVCRQSYSAEAPKEAEFEIREGKLRVRWPDEHVSEFSEDWLRRH
FT                   SYQPPLSTKPKALSLPAKSHWDRAEFNKLLGDGAHFCTRYDNLPSELPTVLREIYEFGF
FT                   TFVRNVPVSIEATKTVSELISIIRPTHYDTGVWEFTSDLAKHDTAYTTVGISMHTDGNY
FT                   WHELPGLQLFHLLEHSGGEGGETQIVDVAKVVDQLRELAAQDESWRTTYKVLTEHPLAF
FT                   HQSGELDSVFYQADYPTLTLDATGELEQCRWNTSDRISQAPLAPGSPYTVPQVYQALFR
FT                   LDSLIKDEKNYVQFKMQPGTIFIFDNWRVLHARTSFTGCRRLCGSYLTRDDFLARFRSI
FT                   VFDREAIKDEIYQ"
FT   CDS_pept        567441..569456
FT                   /codon_start=1
FT                   /gene_family="HOG000076906" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758001"
FT                   /locus_tag="AEL034W"
FT                   /orf_name="AGOS_AEL034W"
FT                   /product="AEL034Wp"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS52651.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG141178"
FT                   /db_xref="HOGENOM:HBG635083"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="UniParc:UPI0000252D46"
FT                   /db_xref="UniProtKB/TrEMBL:Q757P6"
FT                   /transl_table=1
FT                   /translation="MFLLRRSTSVVSRQLLAPGRHAWAPIQPVAWTASRQYAKRPKKAK
FT                   LKRPKAKLKPLTFPIPPYISANNLANLLKMNINTLIGDLKKLGFEKAKADYIISRDYIE
FT                   LILEEYSYQLPSGREIVTPENVYDELKQPADPKALKDRPPVVTIMGHVDHGKTTILDYL
FT                   RKSSIVSQEFGGITQHIGAFQVVTPVSKRKITFLDTPGHEAFLKMRERGANITDIVVLV
FT                   VSAEDSIKPQTIEAIKHVKKSGNELIVAITKVDKLRSAKEKETVINKIMNDLLQHEIHA
FT                   EDLGGNVPVIPISAKSGENMDLLEENIILVSDGMELQAEVGKNTLVEGWILESEVQKTL
FT                   GNVSTVLIKKGIIRKGAVLLSGNTYCKVRNLIGENGASVAMATPAQAVEVTGWKQLPMA
FT                   GDQVIQVDSEAIAKKYVGKRLHLIELEKEASTVDKMNEARALVHETPTDLGTDDTEPEP
FT                   VVPEGPRSVNFIVKADFYGSLEAITESISHLGNDEVICKVVEASVGIPTINDLSLARIT
FT                   DSVILCFNLGNLPGDVLNNKEKIEIRQYTVIYKLIEDVTERLTENLEPIYEDKVIATAD
FT                   IKEIFMFDLKHKVIRIAGCKVNNGKLTRNSLVKITRGPEEKVIFDGKLATLKQGKEAAK
FT                   EVTKGNECGVTFDDFEDYLAGDKILVYEKVKVPRYL"
FT   CDS_pept        complement(569586..570872)
FT                   /codon_start=1
FT                   /gene_family="HOG000196221" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758002"
FT                   /locus_tag="AGOS_AEL033C"
FT                   /product="AEL033Cp"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS52652.2"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG435361"
FT                   /db_xref="InterPro:IPR007320"
FT                   /db_xref="UniParc:UPI0001DB28AD"
FT                   /db_xref="UniProtKB/TrEMBL:Q757P5"
FT                   /transl_table=1
FT                   /translation="MHINLKELQRTRGFHPVMSNVEEHASDNESDYGSQPGAVYLGIVD
FT                   TSIKESDEVTIEDTFIGGEPVWLAEDSVPKEELLRCGACKSGKNLKLLLQAFAPLDPEQ
FT                   TTTICQRKGIKLSTTECINADDDRVIYVFYCTACPRKGNSVISIRGVRRKDAPNDLSAK
FT                   MDIASPGRDFQLNPFGVGSEHGTGSKNSSANPFSISAAGGNPFASEAANPFSAVDATSR
FT                   DDSNKRELKPSTLRKLHEAQPDKVFEASKAFPGFFLFVEEESFKNRTPDHLQLPKNLKI
FT                   DKTAFEVAPETDELESNPVKLDPRTEKLAKFLDDDVFQKFQEIVGYNPYQVLRYDYGGK
FT                   PLYYAQAPNNFEDLVPRPSYNPSSARIFELQLMPKMILDLEEEVSIESGMDWGTIMVFT
FT                   DIENYIPDFDENGVGYVSECVRVQWEPRS"
FT   tRNA            571199..571269
FT                   /gene_name="tRNA-Gly"
FT   CDS_pept        571391..573652
FT                   /codon_start=1
FT                   /gene_family="HOG000271637" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081288"
FT                   /locus_tag="AEL032W"
FT                   /orf_name="AGOS_AEL032W"
FT                   /product="AEL032Wp"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="AAS52653.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG543560"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI0000252D48"
FT                   /db_xref="UniProtKB/TrEMBL:Q757P4"
FT                   /transl_table=1
FT                   /translation="MSANISAQVRRATSGVDSVVTDYVTGYFNHLSNATFDAVLAKRLD
FT                   LEQEIFFITELLIDAGADKEKISKLVTEVKAQLLEQLKQNEAKVELTGDTSKRLLDINV
FT                   LQNHNSKTNINSSLAMLGVTGDIEHTGRKMETRVDLKKLKKAEEKIAKKVAKRNNKFVK
FT                   YEASKLINGAKEEDYDSFYMKINPLDFGSGAGKSKDIKIDTFDLYVGDGQRILSDAQLT
FT                   LSYGRRYGLVGQNGIGKSTLLRALSRRELNVPKHISILHVEQELRGDDTKVLQSVLDAD
FT                   VWRKQLLSEELKINERLQDIDKLRAEFDEDSLEVKKLDNERDDLESHLQQIAEKLADME
FT                   SDKAEARAASILYGLGFSTEAQQKPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNML
FT                   DVPSIAYLAEYLKTYPATVLVVSHDRSFLNEVATDIIYQHNERLDYYRGQDFDSFYATK
FT                   EERRKNAQREYDNQMAYRKHLQEFIDKYRYNAAKSQEAQSRIKKLEKLPVLEPPEEEKS
FT                   ITFKFADCEKLSPPIIQLQDVSFGYDESQLLLKDVNLDVQMDSRIALVGANGCGKTTLL
FT                   KVMMEQLRPITGHVSRNPRLRIGYFTQHHIDSMDLNASAVDWMSKTFPGKTDEEYRRHL
FT                   GAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNSPHILILDEPSNHLDTAGLDALVQAL
FT                   KNFSGGVLMVSHDISVIDSVCDEIWVSESGTVKRFDGNIHDYKKYILEAADAAGVVKRH
FT                   "
FT   CDS_pept        complement(573729..576722)
FT                   /codon_start=1
FT                   /gene_family="HOG000191945" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758003"
FT                   /locus_tag="AEL031C"
FT                   /orf_name="AGOS_AEL031C"
FT                   /product="AEL031Cp"
FT                   /function="RNA binding"
FT                   /function="ribonuclease activity"
FT                   /protein_id="AAS52654.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004540"
FT                   /db_xref="HOGENOM:HBG211083"
FT                   /db_xref="HOGENOM:HBG434190"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR006596"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI0000252D49"
FT                   /db_xref="UniProtKB/TrEMBL:Q757P3"
FT                   /transl_table=1
FT                   /translation="MRDEVQNYRHSTVKAQGQSMTTGRKRLSEGLSVTQKVFVRSRNGG
FT                   ATKVVREHYLRNDIPCLSQACTACPAVVAPDAQNELPRFVLSTEPSGGRYVVVDTNIVL
FT                   QAIDLLENQKCFTDVVVPQVVLEEVRNQSYPVYMRLRTLCRDSDETKRFAVFHNEFCES
FT                   TYVARAADESVNDRNDRAIRRTVEWYSEHLRERGIVAVLVTNDRENLARAVGAGLEAQS
FT                   LTEYVESLPNADEIRDAVPNLEPPAVGRDDMARAGFTYPEYYATGRLMGGLKNGSLYQG
FT                   VVQISEYNFLEGTVSIPNFSKPVLVRGLKNLNRAFNGDQVVLELLPQSEWKAPSMVTMD
FT                   SEHFDVNDNPDSDEENHEVTVISDKQRRLLAQDAINAQKTTKVQPTARVVAITRRSWRQ
FT                   YVGQIATNTLDLQDSSTQNVFVILMDKCLPKIRIRTRRAKELLNKRIVVAIDSWPATYK
FT                   YPLGHFVRELGEVESVEAETEALLLEHDVEYRPFSKKVLECLPAEGHDWRAPADLSDPE
FT                   AISKDPLLPKRRDLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIADVTHFVKP
FT                   GTALDTEGASRATSVYLVNKRIDMLPMLLGTDLCSLKPYVDRFAFSVLWELDADANIVN
FT                   VDFTKSVIRSREAFSYEAAQLRIDDVNQNDELTNGMRALLELSKKLKQKRLDAGALNLA
FT                   SPEVKVHMDNETSDPNEVEIKKLLATNSLVEEFMLLANISVARKINDAFPQTAMLRRHA
FT                   APPSTNFEALNEMLQVRKKMAISLESSKALADSLDRCIDPEDPYFNTLVRIMSTRCMMA
FT                   AQYFYSGAFSYSDFHHYGLAVDIYTHFTSPIRRYCDVVVHRQLAGAIGYEPLDLTHRDK
FT                   QKMEMICKNINRRHRNAQFAGRASIEYYVGQVMRNNHSVETGYVIKVFNNGVAVLVPKF
FT                   GVEGMILLENLTDDFSSAEFVEEEYTLNFKDKTGKTRTVHVFDKVEVEVKSVLDPVTSK
FT                   RKAQLLLK"
FT   CDS_pept        576998..578746
FT                   /codon_start=1
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758004"
FT                   /locus_tag="AGOS_AEL030W"
FT                   /product="AEL030Wp"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS52655.3"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0001DB28AE"
FT                   /db_xref="UniProtKB/TrEMBL:Q757P2"
FT                   /transl_table=1
FT                   /translation="MTHQKDVEKAASELSDTSAVQRVLKKRSSVLEESRLLEESKTNKR
FT                   GLVRRCIDSFKPPVDGSFDPDNLKRTLKSRHLIMIAIGGSIGTGLFIGSGKALATGGPL
FT                   AVLIGWTLAGTQMVGTIHGLGEVTVRFPVVGAFANYSTRFLDPSVSFVVSSIYVLQWFF
FT                   VLPLEIIASAITMEFWTTSVDPVVWVAVFYTLIISINLFGVRGFGEAEFVFSVIKIVTI
FT                   CGFIILCLVLILGGGPTHEFIGARYWHDPGALANGFKGVAAVMVTASYSLGGSEMTCLA
FT                   SGETDPKEIPHAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQLLGGSNVNNSPFVIAIKM
FT                   HNIRVLPHIINGVILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGI
FT                   LTNSLFGLLAFLVKSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLD
FT                   ELEFVSAVGMWGSVYSGVMNVVVLVAQFYVSLWPIEGWKDPRGRTEAFFQNYLCALILL
FT                   FMFVAHKIYYRSTTGQWWKILPLAEIDLESGRKNIDIEVVKHEVAARKKYISEQRWYIR
FT                   YYHYWC"
FT   CDS_pept        join(579017..579032,579138..580597)
FT                   /codon_start=1
FT                   /gene_family="HOG000202292" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081289"
FT                   /locus_tag="AGOS_AEL029W"
FT                   /product="AEL029Wp"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="AAS52656.2"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG027359"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI0001DB28AF"
FT                   /db_xref="UniProtKB/TrEMBL:Q757P1"
FT                   /transl_table=1
FT                   /translation="MGDFEFSIKHAGKVLPIKLPAGSTGADLRKAVEELVQIPADRQKY
FT                   MVKGGLGDETAVADVVKPGSSVLLLGTPDKDMVVKPRTAEKFIEDLGADAQSGQLSRVP
FT                   MGIVNMGNTCYMNATLQGLYGIVPLREQILAFDDKKATAEGMDLYHVQLIREIQATFRK
FT                   LRDKKGEAITPMLLLEILRRVFPQFSEMDRQGGFYKQQDAEELFTQLFHTMQTVFGEEL
FT                   IDRFKIGFKTTIKDTMNEGDVTEKTEDDLKLRCHITGATNFMKAGIKESLKETIEKRSD
FT                   VTGASSTYSVEKKITKLPEYLTVQYVRFFWKKSTGKKSKILRKVQFPFQLDVADLLTPE
FT                   YAQTKIQVREAFREVDKERAESIRERKRSKFNPAPAEGGSTPAEAAEIARSLEESTREK
FT                   WARAFAAKTPADLGRGENPSCVYDLIGVITHQGANSESGHYQAFMRDEFDDDKWYKFND
FT                   DKVTAIEKEKIESLAGGGESDSALILIYKGFGL"
FT   CDS_pept        complement(580758..581456)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758005"
FT                   /locus_tag="AGOS_AEL028C"
FT                   /product="AEL028Cp"
FT                   /protein_id="AAS52657.2"
FT                   /db_xref="HOGENOM:HBG123835"
FT                   /db_xref="InterPro:IPR012471"
FT                   /db_xref="UniParc:UPI0001DB28CC"
FT                   /db_xref="UniProtKB/TrEMBL:Q757P0"
FT                   /transl_table=1
FT                   /translation="MRAGCRRAERQAGRAGQYAGRAGQRAGRAGSAAIGRRAALTQSAQ
FT                   GAGFSGQKISPMAGRGIVERGLRLLHGTPRSTAQHSGMGFFSRQPTETKVFTPSSPVNI
FT                   SPGLLSQLVSTKETDFTRQQLNDKFLEEKVAQRYAQREEETLKKFEVKLNSALLKDSAA
FT                   DEQELSSSAVQQKVASLTERLAQLETRTKPKANKEVADARGQVARCLAANEGRPLNCYE
FT                   EIQQFKKVAL"
FT   CDS_pept        582081..584108
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929980"
FT                   /locus_tag="AGOS_AEL027W"
FT                   /product="AEL027Wp"
FT                   /protein_id="AAS52658.2"
FT                   /db_xref="HOGENOM:HBG059022"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniParc:UPI0001DB28CD"
FT                   /db_xref="UniProtKB/TrEMBL:Q757N9"
FT                   /transl_table=1
FT                   /translation="MGFRFGLSGLIWLAQTAALAFLVVSCITAPVVSDLGLADADGVQY
FT                   GVFGYCIQDRGCSPVSASYGPERVFSGTQWAMGQDMRRVLGRILVVAPVAAGLTLLAVV
FT                   SNFVSQFSGVHRHAGIFVSNLLWTILAFFSSALLCIVVWLLFWPHLTWCAYVLLAAAVI
FT                   HLFCVPLTFLAHSQVCQDSDDESLHGALSSQKLMKREDDYANSFNMNELHKTAIDSDVK
FT                   QPGYYKVAPVTTGDVTDSTKTDYTDIYGSQQAPPPQPYLRSTPQNRNSYVATEPQTTSA
FT                   GGNGEESGKWEQPTLAPYPMTGGFSAQGYNRPSGPPIPPYPSTGSTKDRTANYDRERHD
FT                   ARSGMGPTGDPSYYPAGMEGVQQPYSAINDASKNGIPAGSTGDHAKNKLPYATSTTARN
FT                   ADPSASGVRGPYAEGLPTASSSNYEVTQLSSGRITARPAQSPAYPSSAGEPVKQQPYPR
FT                   QSRNLDYPNQQDFDDEEFVRQNTVDPEERPPIEEDDGIKDDDSDFTSVSQRGINPNYYT
FT                   IAGKQAPYPQTFSAPLPHNQAIYPDQPYAGPPPPDAYQTSNSLGMSRQGAHQQYVSQGY
FT                   TPQPQGYQASGYYSAPSTSQPRAPDTSDMLLQNNPDFMIGGAASNKAARFGGPGQRVQQ
FT                   SAGSTTAPATLYKPAYKKRMQKSKGMVAASLSRDSPYGGR"
FT   CDS_pept        complement(584558..585607)
FT                   /codon_start=1
FT                   /gene_family="HOG000190358" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929981"
FT                   /locus_tag="AGOS_AEL026C"
FT                   /product="AEL026Cp"
FT                   /function="SNAP receptor activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS52659.2"
FT                   /db_xref="GO:0005484"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG059023"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="UniParc:UPI0001DB28CE"
FT                   /db_xref="UniProtKB/TrEMBL:Q757N8"
FT                   /transl_table=1
FT                   /translation="MYRDRTNLFLSYHRTFPHQRHWRSQQGPGAGGEPGDVEAVGEIGA
FT                   AEEAHPMLEMAQKQAAQLPPGFFEEVQRIDAELAGNDVHMVALAKLYRKNALPGFVDKT
FT                   ADEREIEALSFKTIAGLQRCYEAIKRLQAGREAQRFQGRALGRGELAILENCCRAYAAK
FT                   IQAASHRFRVMQNNYLKFLNNDDFKPLPAATNDQETLQLLEEEGEREAQQELDSYSQQT
FT                   LQKQRQKQRETQYLEDRDAEITQLAKGVLEVSTIFREMQTLILDQGTVVDRIDYNLENT
FT                   NIDLKQAQRELDQAVGYQKRTQKCKVIMLLSLLVVFFFFVVLLKPRSSGTPDKGAGARP
FT                   EDRPAEDRN"
FT   tRNA            join(585729..585767,585778..585813)
FT                   /gene_name="tRNA-Tyr"
FT   CDS_pept        586077..587687
FT                   /codon_start=1
FT                   /gene_family="HOG000198341" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758006"
FT                   /locus_tag="AGOS_AEL025W"
FT                   /product="AEL025Wp"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /function="protein tyrosine/serine/threonine phosphatase
FT                   activity"
FT                   /biological_process="protein dephosphorylation "
FT                   /protein_id="AAS52660.2"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008138"
FT                   /db_xref="HOGENOM:HBG182084"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="UniParc:UPI0001DB28CF"
FT                   /db_xref="UniProtKB/TrEMBL:Q757N7"
FT                   /transl_table=1
FT                   /translation="MGKRVYLDNTIEFLKGRVYLGAYDYAPQDSEEVVFFTVEDTLFYN
FT                   RFHLDFGPMHIGHLYRFAVIFHEILNDPENHGKAVVFYSSTSTRQRANTACLLCCYMVL
FT                   VQGWTPHQVLQPLAQVDPPFMPFRDAGYSNADFEITIQDVVYGIWRAKETGLVDLNTFR
FT                   LEVYEKYERVENGDFNVLTPDFIAFASPEEDMRRPYVSGRTRLNQPFKRVLEFFKDNNV
FT                   QLVVRLNSHLYRAQHFEDVGIKHLDMIFEDGTCPDLSIVKNFVGAAETIINQGGKIAVH
FT                   CKAGLGRTGCLIGAHLIYTYGFTANECIGFLRFIRPGMVVGPQQHWIYLNQNTFREWKY
FT                   TMKLSIEPSDLICGLYPLVTLEEYKLQKKALRKSKADHEGDYTVDENTVTPPNKTLASR
FT                   NNEFSHTNAVPQESPGQPRKGQDGSNTIEDINNKTKPVSSNGKPPRKVDENTSRVHHSN
FT                   NSDNEEDSMLIDSSNATTKSPLSSMTKKQTTNTSMDDEFALRQILPKNRRLASSGLATT
FT                   DKRSASGAGVRKVSGTAKR"
FT   CDS_pept        complement(587963..588763)
FT                   /codon_start=1
FT                   /gene_family="HOG000093358" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758007"
FT                   /gene_name="ECO1"
FT                   /locus_tag="AEL024C"
FT                   /product="N-acetyltransferase ECO1 "
FT                   /EC_number="2.3.1.-"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /function="N-acetyltransferase activity"
FT                   /function="damaged DNA binding"
FT                   /function="metal ion binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52661.2"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG059024"
FT                   /db_xref="HOGENOM:HBG395827"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0001DB28D0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757N6"
FT                   /transl_table=1
FT                   /translation="MAGVKKNRSPRKPTKLLQSRLKFAHSSATLKKCTECQMSYIIDSP
FT                   ADCAEHKKYHDLHLYGKKWLASWGTAIQDTCSSQYITPPSTSGGNASGNGAKADREDYI
FT                   VYITPGKTAEVKAMMEIMYIVNNELTAPHDENDFWSEEGTSSMGRAFVYIKDGRAVGAI
FT                   TVEYLKEDDSRGRWMRVSTRELVPEVVPRVRLGISRIWVCRKQRGQGIATRLLECVRKY
FT                   AILGNEVARWEMAWSQPSESGGKLATRYNSVRHKSGELLIPCYI"
FT   CDS_pept        complement(589141..593517)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758008"
FT                   /locus_tag="AGOS_AEL023C"
FT                   /product="AEL023Cp"
FT                   /protein_id="AAS52662.2"
FT                   /db_xref="HOGENOM:HBG059025"
FT                   /db_xref="InterPro:IPR018789"
FT                   /db_xref="UniParc:UPI0001DB28D1"
FT                   /db_xref="UniProtKB/TrEMBL:Q757N5"
FT                   /transl_table=1
FT                   /translation="MQFKKASTVALSGWLLPALAAAQGPGTANHANLVPRTAIGGAGVQ
FT                   VTPYDNCPQYDFTWKAKNSGYAPYKVSVEKVEWEYDNVYTVTIRAKGTDPTPLKSLWSL
FT                   KIIGVDSPDGSSFQLFGYNEHTFLIDNPSDYQATFRVYAQDGGDGKVCMPEYKIQYEYC
FT                   QGHTDCSDWKYGTTAIDLEMGCSNVDNMNHSQKDSPAYCWPRGELPHTKPPHSTEPGTE
FT                   TGTTTTVPVTPTSVLPKTSDSMSSESVSSTTSCSKTTKSKVPPSSAPETPTSVLPKTSE
FT                   SMSSESVSSTTSCSKTTKSKVPPSSAPETPTSVVPKTSESSVPPSSAPETPTSVVPKTS
FT                   ESSVPPSSAPETPTSVVPKTSESSVPPSSAPETPTSVVPKTSESSVPPSSAPETPTSVV
FT                   PKTSESSVPPSSAPETPTSVVPKTSESSVPPSSAPETPTSVVPKTSESSVPPSSAPETP
FT                   TSVVPKTSESSVPPSSAPETPTSVVPKTSESSVPPSSAPETPTSVVPKTSESSVPPSSA
FT                   PETPTSVVPKTSESSVPPSSAPETPTSVVPKTSESSVPPSSAPETPTSVVPKTSESSVP
FT                   PSSAPETPTSAVSKTTESVSTHRSSSQSYTASTVTTTVSGSVVTLSTTVPCEPTGTTSV
FT                   PPSSAPETPTSVVPKTSESSVPPSSAPETPTSVVPKTSESSVPPSSAPETPTSVVPKTS
FT                   ESSVPPSSAPETPTSVVPKTSESSVPPSSAPETPTSVVPKTSESSVPPSSAPETPTSAV
FT                   SKTTESVSTHRSSSQSYTASTVTTTVSGSIVTLKTTVPCEPTGTTSVPPSSEHKPSGST
FT                   NSSIPVTTGTSVLPKTSENVSSTTGSSAESYTTQTVTTTVSGSVVTLKTTVPCTPTGNT
FT                   SVPVSSAAKPSASTSVPSSSGKVPSGSAGSSIPATGTSVLPKTSENVSSTTGSSAESYT
FT                   TQTVTTTVSGSVVTLKTTVPCTPTGTTSVPPSSEHKPSGSTNSSIPVTTGTSVVPKTTE
FT                   NVSSTTGSSAESYTTQTVTTTVSGSVVTLKTTVPCTPTGNTSVPVSSAAKPSASTSVPS
FT                   SSGKVPSGSAGSSIPATGTSVLPKTSENVSSTTGSSAESYTTQTVTTTVSGSVVTLKTT
FT                   VPCAPTGTTSVPPSSEHKPTGTTSVPVSSGQKPSGTTSVPVSSGQKPSGSAVSSTPVGS
FT                   APPKPSGASESIIVITSDDITTTYTSVIEQVVTITNCDNGECETVTTFAPATEPTPVSA
FT                   SASASASTAPVTTSPVHETGSSVPASKAVPSVPVTHAFVHNTGSSVSAPPNATPTPVPA
FT                   AEDDTTTIIVQDIVVTVTYNEAYAESTTTHMVNGTTSVATHTTKVKELPPVVTGTGTNS
FT                   NGLTTVTATLGNKTTKTVCPEGGCQLSTPTTVPPATETPVGGQPTGNKPGAQCPEGNCH
FT                   TSAPPHPSVTSSSGYPSRVSSSATAPSSSISVFDGAGVKKHPSLLALAIPFFYLLG"
FT   CDS_pept        594169..595203
FT                   /codon_start=1
FT                   /gene_family="HOG000170774" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758009"
FT                   /locus_tag="AGOS_AEL022W"
FT                   /product="AEL022Wp"
FT                   /function="histidinol-phosphatase activity"
FT                   /biological_process="histidine biosynthetic process "
FT                   /protein_id="AAS52663.2"
FT                   /db_xref="GO:0000105"
FT                   /db_xref="GO:0004401"
FT                   /db_xref="HOGENOM:HBG176125"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniParc:UPI0001DB28D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q757N4"
FT                   /transl_table=1
FT                   /translation="MCRRTSQRNLRMFSHHSHSGEYVAHGADTLEAVVAEALRQGFHTY
FT                   CLTEHMPRLDEAYLYPEERSGAAARDLRGLAELFGRYVEHAARLRQHVDGMAVLVGMEA
FT                   EACDRQHVAYAKRLLQDFGSHVQFCVGSVHHVYGIPIDFSQTLWDSALQQAGGNLKRLL
FT                   ADYFDWQYYMLRELQPEVVGHFDLIRLYLPRDRFWVELGTGAVSDTYLGGNWTHIALVS
FT                   ARIVSLWEDVQSRVVRNLEYIASYGGLVEINSAGLRKGLADPYPHRDVALLVKRYAGAR
FT                   FVLSDDAHSVSQVGTEYVRTLEYVENVLQLEGLFYLAEASSGPTALEAKYMSLQEIKES
FT                   RFWK"
FT   CDS_pept        complement(595323..597335)
FT                   /codon_start=1
FT                   /gene_family="HOG000167538" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758010"
FT                   /locus_tag="AEL021C"
FT                   /orf_name="AGOS_AEL021C"
FT                   /product="AEL021Cp"
FT                   /function="ATP binding"
FT                   /function="proline-tRNA ligase activity"
FT                   /biological_process="prolyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS52664.1"
FT                   /db_xref="GO:0004827"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006433"
FT                   /db_xref="HOGENOM:HBG052301"
FT                   /db_xref="HOGENOM:HBG334108"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="UniParc:UPI0000252D53"
FT                   /db_xref="UniProtKB/TrEMBL:Q757N3"
FT                   /transl_table=1
FT                   /translation="MPLNEQFALLALDAECAAPVKQLVFKPKVAKSAIAVPVVVVALQS
FT                   TTTPVGVVAHASGSKDPRLARDELFQSHFGVETAKAFDLSHLEQAQHGFQLLVDRELAA
FT                   LADEAAVGLSGVAVEKGALMAYLQKHGAVEVDFAQEVQAAAPKAKKGAAVVKESAALAD
FT                   AKLIGITVDKALDFPGWYQQVLVKGDLLDYYDISGCYILKPASYCIWERIQEWFNGKIR
FT                   SMGVQNVCFPMFISSRALEKEKDHIEGFAPEVAWVTKAGSSDLEEPIAIRPTSETAMYP
FT                   FFAKWVQSYRDLPLKYNQWTSVVRWEFKHPQPFLRTREFLWQEGHTAHLTKEEATDEVM
FT                   QILDHYEQVYVELLAVPVVKGTKTENEKFAGADFTTSVEGYIPQTGRGIQGATSHHLGQ
FT                   NFSKMFNICVENPLGPQHPKVHAYQNSWGLSTRSIGVMVMTHSDNKGLVIPPRVAQHQV
FT                   VILPVGITAKTKEDVRSKIHDSARAIENRLHKAGIRVLGDYADNYTPGWKFAQYELKGV
FT                   PLRLEFGPKDMEKAQVTAVRRNDGAKISVPLADLEERIPQILDEMHQLLYQKAKKSFDD
FT                   HLITVTEWKDFVPTLNKKNIILSPWCGVPECETDIKASSAKKDDGDEYEVDEKAPSMGA
FT                   KSLCVPFEQPVLAPGQKCIKCDKPAVNYCMFGRSY"
FT   CDS_pept        597558..599213
FT                   /codon_start=1
FT                   /gene_family="HOG000226035" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081290"
FT                   /locus_tag="AGOS_AEL020W"
FT                   /product="AEL020Wp"
FT                   /function="ATP binding"
FT                   /function="asparagine-tRNA ligase activity"
FT                   /function="aspartate-tRNA ligase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="asparaginyl-tRNA aminoacylation "
FT                   /biological_process="aspartyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS52665.2"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004815"
FT                   /db_xref="GO:0004816"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006421"
FT                   /db_xref="GO:0006422"
FT                   /db_xref="HOGENOM:HBG370907"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniParc:UPI0001DB28D3"
FT                   /db_xref="UniProtKB/TrEMBL:Q757N2"
FT                   /transl_table=1
FT                   /translation="MSIYINELTGADEAGRGTEEAPFKSAAFGLFAQQDGEEPKVFTYK
FT                   SDEGAGGYVEISASGLKKARKGAEGLRKAAAKEVEQQRRRAEQEARDAAKKLELMSIKI
FT                   EEDASLPPAVGLKVGKAHGAVGTRVKVSGWIHRLRMGKAVVFLVLRDGTGYLQAVLSKD
FT                   LARAYQTSTLTLESTVTLYGTVKQLPEGKTAPGGVELDVDYYEIVSLAPSGDDSFSNRV
FT                   QEGADPSLLMDMRHLMLRGESLSAVMKVRAAFLRAIRRVYEDEGLLEVTPPCMVQTQVE
FT                   GGSTLFKLDYYGEEAFLTQSSQLYLETCLPALGDVFCIQESFRAEKSHTRRHLSEYTHI
FT                   EAELGFVDFDQLLRHTERVITSLVRYVLEDPVAGPLVKQLNPDFVPPQMPFMRLEYKDA
FT                   ITWLNEHGIKNEEGEEFKFGDDIAEAAERKMTDTIGKPIFLTRFPLELKSFYMKRCADD
FT                   PRVTESFDVLMPTVGEVTGGSMRIDSLDELMAGFKREGVNPEPYYWFSDQRRYGSCPHG
FT                   GYGLGTERILAWLCNRYTVRDCSLYPRYTGRCKP"
FT   CDS_pept        599599..601008
FT                   /codon_start=1
FT                   /gene_family="HOG000242744" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20624455"
FT                   /locus_tag="AEL019W"
FT                   /orf_name="AGOS_AEL019W"
FT                   /product="AEL019Wp"
FT                   /function="argininosuccinate lyase activity"
FT                   /biological_process="arginine biosynthetic process via
FT                   ornithine"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS52666.1"
FT                   /db_xref="GO:0004056"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0042450"
FT                   /db_xref="HOGENOM:HBG433052"
FT                   /db_xref="HOGENOM:HBG539632"
FT                   /db_xref="HSSP:1K7W"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR003031"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniParc:UPI0000252D55"
FT                   /db_xref="UniProtKB/TrEMBL:Q757L9"
FT                   /transl_table=1
FT                   /translation="MSSGKQKLWGGRFAGDTDPLMHLYNASLPYDYKMYKADILGTKVY
FT                   TEGLQKTGLLTKDELESIHEGLKQVEQEWEQGVFVKHVDDEDIHTANERRLGEIIGRHI
FT                   SGKVHTGRSRNDQVATDMRLYCREMLQDKVEPALFELIKVLLHRAREEIDVLMPGYTHL
FT                   QRAQPIRWSHWLSCYATYFVEDFKRLKEVIARLNQSPLGAGALAGHPYGIDREYLACEL
FT                   GFDGVIGNSMTAVSDRDFVVEIMSWGSLFMNHISRLAEDLIIYSTAEFGFVKLADAYST
FT                   GSSLMPQKRNPDSLELLRGKSGRVFGQLAGFLMSLNSIPSTYNKDMQEDKEPLFDCLLT
FT                   LEHTSLIATGVLSTLSVVKEKMFQALTVDMLATDLADYLVRKGVPFRETHHISGSCVAL
FT                   AEQLALSGIDQLTLEHYKGIDPRFEEDVFDVFDFELSVERRQSTGGTARAAVLKQVDNL
FT                   EEQLKRMHNNT"
FT   CDS_pept        complement(601134..602285)
FT                   /codon_start=1
FT                   /gene_family="HOG000074712" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624456"
FT                   /locus_tag="AEL018C"
FT                   /orf_name="AGOS_AEL018C"
FT                   /product="AEL018Cp"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS52667.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059026"
FT                   /db_xref="InterPro:IPR013952"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000252D56"
FT                   /db_xref="UniProtKB/TrEMBL:Q757L8"
FT                   /transl_table=1
FT                   /translation="MAERWINACFEAYDTTIRHAEDVGAQAVQSARAVYNVACETVSEI
FT                   ARRAGTEERGVAVLAEKPAGGVAAAREHILAAVVGLAGRPRVRAAAAAAAAGLLVYVAG
FT                   RALVPAVAARVVGERETVLVLGEMTDPITRALVYDLHRRGFCVFVCSTSEKRDRQLEDE
FT                   YEKVPSPWDQEGGVCHMAATPEAVARLTEFLQREERRLRGVLVVPSSCFFTSGMFTNIP
FT                   EGQVRSELQENLVNTWAVVTRLLPQFDSASRDKLQVVVFNPSLSQKLNLQYHSLELLMS
FT                   STMESLYRILANECGYLADVYQCHLGILNIAGNASNYKYLTINGSHITKALCEPIYELL
FT                   LSRDNMWVRFKRWLQGPVLYCGKGSRLACWLRSYAPLWLLEFI"
FT   CDS_pept        join(602492..602538,602640..603843)
FT                   /codon_start=1
FT                   /gene_family="HOG000215564" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777007"
FT                   /locus_tag="AEL017W"
FT                   /orf_name="AGOS_AEL017W"
FT                   /product="AEL017Wp"
FT                   /protein_id="AAS52668.1"
FT                   /db_xref="HOGENOM:HBG056492"
FT                   /db_xref="HOGENOM:HBG656384"
FT                   /db_xref="HSSP:1AWX"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniParc:UPI0000252D57"
FT                   /db_xref="UniProtKB/TrEMBL:Q757L7"
FT                   /transl_table=1
FT                   /translation="MGLNNPLPRSLTAETKKAAKVLASFVKPDQMLGADEVIPPHVLKN
FT                   AKGLAIITVLKAGFLFSGRAGSGVIVARLADGRWSSPSAIALAGAGAGGMVGVELTDFV
FT                   FILNTADAVKSFSHAGSITLGGNISVAAGPLGRNAEAAATASLGSVAAVFSYSKTKGLF
FT                   AGVTLEGSVIIERREANRKFYGSNCTAKAILSGSVSPPPGVDPLFRVLRSRAFNHTSSR
FT                   SGTEEPYFRDDDYYGDIPSNLDSEGNSRRNSWRNSFRRSRHGVEGYHDDVGGYDGCSDD
FT                   DNVSDYYTNRRRGDGSALSNSTLSGNLRSSTKWEDDEYDQGIVNTSGKPEQNSQRRAPA
FT                   RPTSAKPDFGSHSTSSGAIPKAVALYTFKGEQKGDLPFRKGDVIMILKRTESQDDWWTG
FT                   RINGQEGIFPANYVDLV"
FT   CDS_pept        complement(604193..606229)
FT                   /codon_start=1
FT                   /gene_family="HOG000000869" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758011"
FT                   /locus_tag="AGOS_AEL016C"
FT                   /product="AEL016Cp"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAS52669.2"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG059028"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0001DB28D4"
FT                   /db_xref="UniProtKB/TrEMBL:Q757M4"
FT                   /transl_table=1
FT                   /translation="MASSEANSATPLNSISLNVQRQSNIQDKSTNHHNMANSIVKHVKI
FT                   TINNHDVLPGEEDDDDDNKDEEGSTEVTKVEKNESRSISSQSTSSSGTDGTDIVKLGRS
FT                   KDSPTLTSKKLVALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLN
FT                   FSNEEDAERVIEEFNYIPIFGREVRIMPSLRNSFYRKNIGTNVFFSNLPLENLALTTRV
FT                   FYDAFKKFGKILSCKLDRRKNIGFVYFEKDSAAKQAIAEYNGKEFFGNNILCGIHFDRN
FT                   VRKSPEFEKRKARLEDMTLVKESLVMDNNQEIPSGSKMKGPHPNAVFIKNLPLNPDSDL
FT                   LLDYFSQIGPVKSIFTSNVSKLNSAWAFITFKKGSDAQDAIDNLNHSQLLGRTIELSRA
FT                   QKNFQTDIDAANAGAGNNSSTTRSNDSDPCSTQHSSSYKLTVYLSSLSSICSEQFLQCF
FT                   CAEERIKTKRISIRFYDEATLTFSGFVQCQTRNDANRLFELLNNKLLGDSTVKASWKPS
FT                   KEAKPINTAVATVPLTPHLKLQQHNHKKPATSVNIRREPYIYRAPAPEYRGYNPLKNKM
FT                   LQQQVLMAPLNVKAVAKDPNAKEALAALKKEVRRYIDFLKFPLATREQNLSIISKYILE
FT                   VFYQNRVEAITRVLLMKQNHNYFERQFQEQVEESIAQLGLEGR"
FT   tRNA            complement(607290..607362)
FT                   /gene_name="tRNA-Ala"
FT   CDS_pept        607707..609074
FT                   /codon_start=1
FT                   /gene_family="HOG000113886" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758012"
FT                   /gene_name="NUF2"
FT                   /locus_tag="AEL015W"
FT                   /product="Probable kinetochore protein NUF2 "
FT                   /biological_process="cell division"
FT                   /biological_process="mitosis"
FT                   /cellular_component="condensed chromosome kinetochore "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52670.1"
FT                   /db_xref="GO:0000777"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG059029"
FT                   /db_xref="HOGENOM:HBG202970"
FT                   /db_xref="InterPro:IPR005549"
FT                   /db_xref="UniParc:UPI0000252D59"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757M3"
FT                   /transl_table=1
FT                   /translation="MSSDNFPLLDIPELVTCLQECDFSLATIQNVERPSSQFVITLYKQ
FT                   IIDTFMGVSPDSLLEDSRNFVENGDTSEQEVYDASLVYHDTLKILALNKICYKFFLDIG
FT                   VSDFNVMDLYKPDPHRTRRFLSAVANYARFREEAMLELDGDQHPDGVRYLEQTDKLLKE
FT                   LRLKFDANNLLHSRVQKYKEFQKSDDLEALESDNKNMESELRHLNQVQETLTVDYERYK
FT                   AEKQRHLSELETLGYELIELESERDKLRKYSQTDAEVLRKGVRELSLLLEQQQVQLEKL
FT                   EQKQKNLQISFETFQASTQELYEVLQIVSTDLQDSHLKESTLLDAKHKLMQNHKNLNNL
FT                   LSAGIMAKITLLQEQLDSQKRKLAELELNTQAKESENSATLKRLRKQHTDDVLPEVRNI
FT                   EQRYKTKVADTITNYESQMRNIKVDFDNEVALIENECSLLFNHIKNYMTTIGEKLG"
FT   CDS_pept        complement(609119..609886)
FT                   /codon_start=1
FT                   /gene_family="HOG000191688" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929982"
FT                   /locus_tag="AEL014C"
FT                   /orf_name="AGOS_AEL014C"
FT                   /product="AEL014Cp"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS52671.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG267939"
FT                   /db_xref="HOGENOM:HBG523795"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000252D5A"
FT                   /db_xref="UniProtKB/TrEMBL:Q757M2"
FT                   /transl_table=1
FT                   /translation="MDYQNRAGSKKGGGGIASQSQQNVHRRKQVEDLLRGGEDVPYTFQ
FT                   HDSADKADDEAKLKRNPYIYKNHSGKLVCKLCNTMHMSWSSVERHLGGKKHGLNLLRRG
FT                   GSTAGADDDALSKQDREFHTKVEEMRQQIKHNGVVPKVQFTKVKDPETEHIGIAVRVDY
FT                   KVEGTAASGDEEEPPCLRILSGLELPGAEDDDKKYLVVAYEPFENIAIEIPDKEIVMSK
FT                   RQSAVESIDELNGRCSYWDRDDKAFYVQLFFKQ"
FT   CDS_pept        complement(610209..611888)
FT                   /codon_start=1
FT                   /gene_family="HOG000191845" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081291"
FT                   /gene_name="SIR2"
FT                   /locus_tag="AEL013C"
FT                   /product="NAD-dependent histone deacetylase SIR2 "
FT                   /EC_number="3.5.1.-"
FT                   /function="NAD binding"
FT                   /function="NAD-dependent histone deacetylase activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin silencing"
FT                   /biological_process="protein deacetylation"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52672.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006342"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006476"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0017136"
FT                   /db_xref="GO:0070403"
FT                   /db_xref="HOGENOM:HBG191410"
FT                   /db_xref="HOGENOM:HBG203103"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR007654"
FT                   /db_xref="UniParc:UPI0000252D5B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757M7"
FT                   /transl_table=1
FT                   /translation="MSESASMLQGSKRGTDSSVDVGGAKRTKVDMDDGSSSNNDEKELL
FT                   EATKADELDEVVDDYAEQNDHSAQEVAGEYVPKKPEQPIMLTKDSNSGKYVFPPISKED
FT                   SLNARYFLKYHGSAQFLDSYLPEDLNSLYVFHLIKLLGFQLKDRELLTAVQKAVQNDVT
FT                   SGVSSVVGTNPMVERVSPPQLSASTPSGDGYDDPLEKKHAVRLIKDLQKAMNKVLSTRI
FT                   RLANFFTLDHFISKLKSAKKVLVLTGAGISTSLGIPDFRSSKGFYSQVTNLGLDDPQDV
FT                   FNLDIFMENPSVFYTIAEKILPPEHKFSPLHSFIKMIQDKGKLLRNYTQNIDNLESYAG
FT                   IFKENIVQCHGSFATASCVTCHLKMPGERIFQQIKDREIPLCAYCYPKRQEEYPTVSDD
FT                   PGTKNGQQSSHNSSSIFHMSRSFGVIKPDITFFGEALPLEFHTNIRQDVLQCDLLICIG
FT                   TSLKVAPVSEIVNMVPAHVPQVLINRDPVKHAEFDLTLLGLCDDVAAFIAQKCGWDIPH
FT                   ENWPQLKQRNIQYDELERGMYYVYDPVKEQAKDTGQRQVQAP"
FT   CDS_pept        complement(612182..612748)
FT                   /codon_start=1
FT                   /gene_family="HOG000141752" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758013"
FT                   /locus_tag="AEL012C"
FT                   /orf_name="AGOS_AEL012C"
FT                   /product="AEL012Cp"
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52673.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG059030"
FT                   /db_xref="HOGENOM:HBG202971"
FT                   /db_xref="InterPro:IPR001092"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniParc:UPI0000252D5C"
FT                   /db_xref="UniProtKB/TrEMBL:Q757M6"
FT                   /transl_table=1
FT                   /translation="MTSFPGSIPSSVLSSCTIASERSERKRRDNINDRIQELLNVIPEE
FT                   FFQDYYQKKKDQESESGTPGALPKNKGTGTRDGKPNKGQILTQAVEYVTYLQNQVDLRN
FT                   REEVELILKVKELCRQTGSIVNDVNLENTSAELALAKIGVGPLAGVLGEYCGTQGSSTQ
FT                   GSSKPPQERNNNFEYGGYAEYGDGA"
FT   CDS_pept        612964..614277
FT                   /codon_start=1
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758014"
FT                   /locus_tag="AEL011W"
FT                   /orf_name="AGOS_AEL011W"
FT                   /product="AEL011Wp"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS52674.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniParc:UPI0000252D5D"
FT                   /db_xref="UniProtKB/TrEMBL:Q757M5"
FT                   /transl_table=1
FT                   /translation="MGQGASTYGKGQKGKKDKKQKPKYEPPVQSKIGRKKRKGPATAEK
FT                   LPNVYPSTRCKLKLLRMERIKDHLLLEEEFVTNSEILKPFEMKQEEERKQLEEIRGTPL
FT                   SIGTLEEIIDDDHAIVTSPTTPDFYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDD
FT                   ADPMVSVMKIDKSPTESYNDIGGLEAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILY
FT                   GAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFI
FT                   DEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIR
FT                   PGRIDRKILFENPDVSTKRKILGIHTSKMNLSADVDLETLVTSKDDLSGADIKAMCTEA
FT                   GLLALRERRMQVTVEDFKQAKERVMKNKVEENLEGLYL"
FT   CDS_pept        614734..615753
FT                   /codon_start=1
FT                   /gene_family="HOG000233896" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758015"
FT                   /locus_tag="AGOS_AEL010W"
FT                   /product="AEL010Wp"
FT                   /function="metal ion binding"
FT                   /function="protein serine/threonine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="protein serine/threonine phosphatase
FT                   complex"
FT                   /protein_id="AAS52675.2"
FT                   /db_xref="GO:0004722"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008287"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG394483"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniParc:UPI0001DB28D5"
FT                   /db_xref="UniProtKB/TrEMBL:Q757M1"
FT                   /transl_table=1
FT                   /translation="MGYNETEPAIDGDNNEQRINEDMSTLEHTSNNNGNGLEPVEAGPD
FT                   SGIPAVEGGGSVSGQSPQHEPPAYELSYVVGVAENKNAKFRRTMEDVHTYVENFASRLD
FT                   WGYFAIFDGHAGNQASKWCGSHLHTIIEERILQGDDRDVRDILNDSFVYVDQQINSTLE
FT                   GNSGCTAAVGILRWEAPTPIPNMPINLEQHKRMLYTANVGDTRIILFRNGRSVRLTYDH
FT                   KASDIIEMQRVEKAGGLIMKSRVNGMLAVTRSLGDKFFDSLVVGNPFTTSVEITTSDQF
FT                   LIIACDGLWDVVDDQEACEMIKDIEDANEAAKTLVRHALEHGTTDNVTVMVVFFDNNQ"
FT   CDS_pept        complement(615924..616955)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19777008"
FT                   /gene_name="MED2"
FT                   /locus_tag="AEL009C"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 2"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52676.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG059031"
FT                   /db_xref="InterPro:IPR021017"
FT                   /db_xref="UniParc:UPI0000252D5F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757M0"
FT                   /transl_table=1
FT                   /translation="MIKELQGGNMATKFKTDEEMRGDRLTQCLDDIMRASTEMMVQQQL
FT                   KTIQLNSDVAAGFRKALSKSLGDRVRAFHSILDGVETTLTTASQYLDAVEEAAVKMKQW
FT                   KQQQEEEQRRKHQAELEKNKRQQEHDAATKAAAAQQLMAQQSPVDLTAPTPTGLASNLD
FT                   KSNRVGGVKPFSAEFGHLDEMDLSMFGGIDGHGDFSLEDFNMGGNSVPLNGGRPRNMVM
FT                   ADAGGFPARGGMGRGGATAINNGAQEIKTSTNEASTNNRNNDGTGGASNPRISSNYNSA
FT                   VADHESIGLRVDANGQNTKQSGQQSGAGLNPDDYLTLNDFNDLGIDWNTGENNELDLND
FT                   FNI"
FT   CDS_pept        617521..617997
FT                   /codon_start=1
FT                   /gene_family="HOG000216023" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758016"
FT                   /gene_name="ATP16"
FT                   /locus_tag="AEL008W"
FT                   /product="ATP synthase subunit delta, mitochondrial "
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="AAS52677.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG343819"
FT                   /db_xref="HOGENOM:HBG663981"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="UniParc:UPI0000252D60"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757N0"
FT                   /transl_table=1
FT                   /translation="MFRLTSARALFRVANVAARRTYAEAAADALKLNFALPHETLFAGT
FT                   AVKQVNLPVKTGQIGILANHVPIVEQLVPGVVEVLEGSESKKFFVSGGFATVQPDSTLS
FT                   ITSVEAFPLDSFSAENVRALLAEAQKNAGAADSRVAAEASIQIEVLEALQAALK"
FT   transit_peptide 617521..617586
FT                   /gene_name="ATP16"
FT                   /locus_tag="AEL008W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757N0 "
FT   mat_peptide     617587..617994
FT                   /gene_name="ATP16"
FT                   /locus_tag="AEL008W"
FT                   /product="ATP synthase subunit delta, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757N0 "
FT   CDS_pept        618517..620310
FT                   /codon_start=1
FT                   /gene_family="HOG000141751" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624457"
FT                   /locus_tag="AGOS_AEL007W"
FT                   /product="AEL007Wp"
FT                   /cellular_component="nuclear chromosome"
FT                   /protein_id="AAS52678.2"
FT                   /db_xref="GO:0000228"
FT                   /db_xref="HOGENOM:HBG059033"
FT                   /db_xref="InterPro:IPR006909"
FT                   /db_xref="InterPro:IPR006910"
FT                   /db_xref="InterPro:IPR023093"
FT                   /db_xref="UniParc:UPI0001DB28D6"
FT                   /db_xref="UniProtKB/TrEMBL:Q757M9"
FT                   /transl_table=1
FT                   /translation="MSQINEHQQSKLLHLQTKTGSLAQIWLASTMTNLNRTYLRTDIVQ
FT                   SVEEISKATTREGGDDGGDPITLRVSGELLHGVVRVYSQKANFLLTDVSDLLHRLKSVF
FT                   RGNMSRTTAVRVDTVARLDQVVLADTVTEMDVLAMPEIDFLDTTSSSKGLMRRERSMER
FT                   HVQGANTVTDPWDMSLEVGRRYAPDDDLEQQTSLLDLNFELSDMQNSKSWGEGTHNSEE
FT                   ISANVLAESQRQELPGNEGIEREEDLDWNLGFTEPAIVVPSSDFEHDNSIEVGRRAVPN
FT                   ADLQETVDLGFDLDIAKGDIEATAGEQDAGQLQSELSGSISTSSGTTVSSQRRGQAALV
FT                   NAKVLQVDHQPELHDRLLRDTPQTAASVDMTAIPLPSPPKKRAYSELASTMDFLPEFAL
FT                   DHFTAFVSQKRRHAESPAARTIAHEVSSAESVDETHIDISLDLNDDLLRSDAIEAGTEE
FT                   EIEGEDAILDVPSSPRAQTASASPDLHEYSHISTEDVGFSLPRREVEVTTGDHVAKSTV
FT                   DMANTIRSELMDVESTTFSHLLKSKYGEESGAITKSQASKAFFEMLVLATADCVDLSQQ
FT                   ASTGDITITGKGALYEKFIDI"
FT   CDS_pept        620573..628048
FT                   /codon_start=1
FT                   /gene_family="HOG000248819" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758017"
FT                   /locus_tag="AGOS_AEL006W"
FT                   /product="AEL006Wp"
FT                   /function="binding"
FT                   /protein_id="AAS52679.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG056522"
FT                   /db_xref="InterPro:IPR011430"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001DB28F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q757M8"
FT                   /transl_table=1
FT                   /translation="MAKQSTTTKSAKRYRYSSFKDKIDDLKIEPAKNLSKRAHDYVESS
FT                   HFLSSFEHWKEFNMSADFTEFAQEVVNLVQTLPQILYHDDKIYDILSKHIGKHDDKSLQ
FT                   PLLELLSQFCHDLGPDFLKFYERTLLLLINLLDESIKFENSDVFEWGFNCLAYIFKYLS
FT                   RQLTQDLIPTFTMLFPLLSHKKEYMSRFAAEALSFLIRKSSPKNLLPFVHNSCKTLNQL
FT                   ENNNLYDGLHSLFSEALKSTSDTLYSKSNAIVSVLLQVALDKDQSLVAVTLFCDIMMDA
FT                   LRHASAENAAPLYQLIIEKLDEFLSQKQEGDDLDKVIKILAVVTFAESGKKVNNWEALS
FT                   SCLQGALHHPRSESISPETLAFCFSVILRNADLKTVTSLHRTMFEFYMENYPSFFLEFV
FT                   KTVIDMDKGRFSSFNCSRFIGQFIKSHWKEHQKKIALLLLDLESKPELSSTLNFTIPEE
FT                   FVTSLTSDLQSLDALAAEDNIFELYWRNIILKRCDTDNTAVIVPNLKTLLEFPKPNDFV
FT                   KDLIGDLLMGLSLSSQDTLQPICLQIAENFELYRDSTLFIQGYTRVIQSEGLDAHETRE
FT                   QLLHKITDNFILPDRNLRYHSMMLLIKILEKSGQDVPQLFRDLLIIDDIPLTLTNGRDI
FT                   TLRVRKLGADYSITEGTPLLNNGFFKYIFGLLTVRFSPLWDGINEILPNIYGKAQRLVW
FT                   DLVLHLINALDNPHTLQYIEAPVSEPFAESFWTVSTTRLNDVLQSASDVFNMYVALDTS
FT                   LIDTFKGRRGSLGYPGMIRNQALKILIALPQLAEQNSRFIVPFVLKRNDQFDANQDEDH
FT                   LGELAVHSADTWSETDRNLILKLLGKFKNIKAIYKSEDVRQRLMELLGSRTLEVQKLAL
FT                   DALLAYKDPVAVKYRDNLKNLLDDTLFNDEVTKLFAQNESRVIVNTDERLLMPFILRIL
FT                   FGRVQTPNTSGIKKTRKTAVITVLPNLGEKNITDFLALGSNGINYQYFFEENAVIPDSE
FT                   LTAINFRRMLGFINVLSASLNVLGSNFPEAVKTTIKPLVYAIHMSGRTGQNKELQGSID
FT                   SLTASVRQQGMKCLFQLFGCIGEVIDWDEYLPIIHDHVIQPRVANFEHENLQSPSSIMK
FT                   LICYWSTSKSFYPFLYYADYSAARALMALFSNEHAKESVLHVLLDCFTKIIKQPTTEDS
FT                   YIDLASLVAATSLQVLPSLLLRLVEPDGISLAIDLLLNITEAGYVQDNDTTKLLVEALT
FT                   SAVEKDLNGIKPADKVKVFACLSALLSSYVCQWNDLERLYVACSKMYRTLRDRKQRESL
FT                   NTVFSSMGKRFEHIQPVAKLLCDLNSYSTSRMQEYDFETILSAFKVFTEETYQQFNEQH
FT                   WLPILYTCLYFINDKEELALRTNSTHALTKFIDYANENPSAEQATAAISLIKDVLLPNL
FT                   KLGLRSASDEIQAEYITLLAYIVTNSRYFTDFEDMKVLLFNNDEEANFFINIRHIQLHR
FT                   RQRAIKRLGEASDKLNENSISHYLLPMIERYIFVEDEKYRNLCNETIATIGILSNYSSW
FT                   NQYKAILRRYISMMKQKPNHLKEIVNVIVAVTRSFKNTLECIRSSNSSIPCIRNFPSKA
FT                   DEPNAYVENEIYPILHKILSTRDDETIIQRIPLAHSLINLVLGLPNERIVSLLPGILTS
FT                   LCQVLRSRSEELRDVVRKNLGNIAVVLGPEYLTFVIQELKSALARGSQIHILSYSLHHV
FT                   LVSMSEALGHGDLDDCASMIIDIVMEDTFGAAGQEKDAEGYTSKIKEVKFNKSYDTSEL
FT                   LAANINLPVFGTLLRPVKALLLERIGIKTQRKLDEVLRRYSLGLGHNSQASSPDVLKMC
FT                   HEIYTLSQVFSPGSAKQRKEYNEKEDFFLIRLDAKRVDVQVECSHYIETLQKLSLDLLR
FT                   VAISRNRNLLDTTYLEGFIPILKESLLSDNDGVVISTLKVLMLFIKLQFSEDSEAIFKN
FT                   CARKVLTIIKDSPSTSGELCQVGLKFLSALIRYKDIELKDSALEYVLGRIEPDLMEPNK
FT                   QGLAFGFLKSLVSKHIVLPKLYDIIDNVAEVMVTNHAKEIRDVARSVYYQFFMEYDQSK
FT                   GRLEKQLKFLVNNLQYPSQEGRQSVMELLNLLINKSGPALLMKLSSSFFVFLANVSVND
FT                   DSPKCRKMASLLLTNLFKNLGQENMGTIEKYIQAWLKQVDNVLFVSLGMKIYKIYLLEL
FT                   GLGCNASLDGVALARIKAVLSDTEVGSDSLWDMVYTALETFAVFAQKSGDEVYSPAYKP
FT                   TWDSIVACLLYPHEWVRLSASRLINVLLANMERLEVPLSDYEIQTIAYRTFHLLAAPSS
FT                   SANVGSKEVSVKVLVNIAQYWNKHSTPYISKNNEDEVRYSTAMEFAISRISAILRNEEN
FT                   KSESHASKMSAIQLLAMLIQILDAAQLAQYGEAIILAVYTYVENNSGIDISEQFAELQQ
FT                   MSQEALNMLEEKLSTSDFTRAYTAAKQVVIKRRQERRAKRAQLAVTAPAIAAEKKLKKH
FT                   ARSREKRKHEKDENGFYQRKNKKKRTI"
FT   CDS_pept        complement(628253..628930)
FT                   /codon_start=1
FT                   /gene_family="HOG000001026" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929983"
FT                   /locus_tag="AGOS_AEL005C"
FT                   /product="AEL005Cp"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52680.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG059034"
FT                   /db_xref="InterPro:IPR000910"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="UniParc:UPI0001DB28F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q757L6"
FT                   /transl_table=1
FT                   /translation="MVDQNNKDLALAIKELTEQNDTLSLAIQRTRLSVKRLRLEYAVLL
FT                   ERLEARIEKDPSLHYEEPLPTLASFKNNLLESLPSSRSRKRRSKEKRDPNLPKRPTNAY
FT                   LLFCEMNKDKIRHEHAANNVDMTKVLPEIWKNMDEEAKKPYYDLYNADRLRYQREMTAY
FT                   SQNKTTEEANVDVKNESGNEEEEGDEPEHEPDADEIDVNDSDVTQLDDGIGDVASSVMS
FT                   SEM"
FT   CDS_pept        629314..630741
FT                   /codon_start=1
FT                   /gene_family="HOG000164450" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758018"
FT                   /locus_tag="AEL004W"
FT                   /orf_name="AGOS_AEL004W"
FT                   /product="AEL004Wp"
FT                   /protein_id="AAS52681.1"
FT                   /db_xref="HOGENOM:HBG431219"
FT                   /db_xref="HOGENOM:HBG586490"
FT                   /db_xref="InterPro:IPR003734"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="UniParc:UPI0000252D64"
FT                   /db_xref="UniProtKB/TrEMBL:Q757L5"
FT                   /transl_table=1
FT                   /translation="MSDEQEPLLKEETNGAPLEMRTVVSGTAVVPAIPGNPDSLMPTGI
FT                   PECSSTISSAIAETPIGSSGSATGNTATTLLLADNKGHKSYMQKAGVSISAPVRSGPKV
FT                   ITGSRVGPQRTSRTAQKLKLLPEEPFQRSQEQEDDSVDREVYSQVNRITDKPARRDAEK
FT                   LGKSHRHLLPRVTAYCTASSYNMKELVRWLKDCKRTHHTHPKLFDECLYTPFIYTDWRG
FT                   DKRFEHEDVIRLDDEGGEINVSDKQPDLFIFEYGVVVMWGFTEREEKAFLNDLERFEKE
FT                   KLAEEDVQVEEFNYYITQSYQPRIYNDFITLRDGSNYMIKLSISHAISQSVKISLFEEL
FT                   VDNTIEDTQDIPQEIASSGKVSMSKADIMKSIGELFILRININLHGSVLDSPEIMWSEP
FT                   QLEPIYQATRGYLEINQRVALLNQRLEVVSDLLQMLKEQLGHSHEENLEFIVILLLGVE
FT                   VLISVVNIIVDIVADTK"
FT   CDS_pept        complement(630921..631316)
FT                   /codon_start=1
FT                   /gene_family="HOG000234652" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758019"
FT                   /gene_name="HTA2"
FT                   /locus_tag="AEL003C"
FT                   /product="Histone H2A.2"
FT                   /function="DNA binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52682.1"
FT                   /db_xref="EMBL:AAO15409.1"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG524528"
FT                   /db_xref="HOGENOM:HBG610736"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI0000252D65"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757L4"
FT                   /transl_table=1
FT                   /translation="MSGKGGKAGSAAKASQSRSAKAGLTFPVGRVHRLLRKGNYAQRIG
FT                   SGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIA
FT                   QGGVLPNIHANLLPKKSAKATKASQEL"
FT   mat_peptide     complement(630924..631313)
FT                   /gene_name="HTA2"
FT                   /locus_tag="AEL003C"
FT                   /product="Histone H2A.2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757L4 "
FT   CDS_pept        631902..632285
FT                   /codon_start=1
FT                   /gene_family="HOG000231213" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758020"
FT                   /gene_name="HTB2"
FT                   /locus_tag="AEL002W"
FT                   /product="Histone H2B.2"
FT                   /function="DNA binding"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52683.1"
FT                   /db_xref="EMBL:AAO15411.1"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG493811"
FT                   /db_xref="HOGENOM:HBG715487"
FT                   /db_xref="InterPro:IPR000558"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000006CB03"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8J1F8"
FT                   /transl_table=1
FT                   /translation="MAPKAEKKPASKAPAAKKTTASTDASKKRTKTRKETYSSYIYKVL
FT                   KQTHPDTGISQKSMSILNSFVNDIFERIASEASKLAAYNKKSTISAREIQTAVRLILPG
FT                   ELAKHAVSEGTRAVTKYSSSTQA"
FT   mat_peptide     631905..632282
FT                   /gene_name="HTB2"
FT                   /locus_tag="AEL002W"
FT                   /product="Histone H2B.2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8J1F8 "
FT   CDS_pept        join(complement(632838..632879),complement(632504..632779))
FT                   /codon_start=1
FT                   /gene_family="HOG000224438" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081292"
FT                   /gene_name="ECM15"
FT                   /locus_tag="AEL001C"
FT                   /product="UPF0045 protein ECM15 "
FT                   /protein_id="AAS52684.1"
FT                   /db_xref="EMBL:AAO15412.1"
FT                   /db_xref="HOGENOM:HBG251261"
FT                   /db_xref="HOGENOM:HBG742314"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR016198"
FT                   /db_xref="UniParc:UPI000006CB04"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8J1F7"
FT                   /transl_table=1
FT                   /translation="MSKLHTLVDICMVPLGTSSPSVSDYVTKIEKRIRESHLKSTMHSF
FT                   GTTIEGPWDEVMSLIGQLHEYSHELGYVRIHTEMRLGTRTDKQQTAQDKVDVVEKKLSD
FT                   Y"
FT   CDS_pept        complement(634510..636726)
FT                   /codon_start=1
FT                   /gene_family="HOG000192885" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081293"
FT                   /gene_name="NTH2"
FT                   /locus_tag="AER001C"
FT                   /product="Probable trehalase"
FT                   /EC_number="3.2.1.28"
FT                   /function="alpha,alpha-trehalase activity"
FT                   /function="calcium ion binding"
FT                   /biological_process="trehalose catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS52685.1"
FT                   /db_xref="EMBL:AAO15410.1"
FT                   /db_xref="GO:0004555"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005993"
FT                   /db_xref="HOGENOM:HBG059035"
FT                   /db_xref="HOGENOM:HBG324549"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011120"
FT                   /db_xref="InterPro:IPR018232"
FT                   /db_xref="UniParc:UPI0000252D66"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757L1"
FT                   /transl_table=1
FT                   /translation="MLQGMPKRSGSISELHDPFSSPDVYYGPATDPRRQKQPNKYSRTR
FT                   TMSIIENVSTFKSAGKQYNIRRRGSEDDSMLASSGHRKFYIKDVDKTLEELLESEDTDG
FT                   NYQITIEDRGPKTLRVGTANSNGFRHVQIRGTYMLSNLLQELTIAKNFGRKQVILDEAR
FT                   LNEDPVNRLTRLITHQFWDSLTRRIDYNSIAAIAADTKVDTPGAKVPRIYVPHGCPEQY
FT                   EYFIECSQLNPSLNLEVKYLPDVITPEHVQSLNESPGLLALAMESHRDPITGESTLVGF
FT                   PYVVPGGRFNELYGWDSYLMALGLLDCNKVDIARGMVEHFIFEIEHYGKILNANRSYYL
FT                   CRSQPPFLTDMALKVFEKFGGDQNPTAVDFLKRAFIAAIKEYKSVWMAEPRYDKTTGLS
FT                   CYHPDGIGFPPETEPDHFDAICRKFAEKHNVTIPEFRCMYDAGEVHEPELDEFFLHDRA
FT                   VRESGHDTSYRLENVCAYLATIDLNSLLYKYEKDIAYVVSKYFDDSITDYAGETTTSSH
FT                   WEALADIRKQRITKYLWDEETGFFYDYNVHIGKRTSYDSATTFWAMWAGLATQEQANAM
FT                   VEKALPRLEMLGGLVACTEESRGEITMNRPSRQWDYPYGWAPHQMLAWTGLDNYGFTGV
FT                   ARRLAYRWLFLMTKAFVDYNGIVVEKYDVTRGTDPHRVDAEYGNQGADFKGVATEGFGW
FT                   VNSSYILGLKFMNTYAKRALANCTVPDIFFKHMKPEEKARYALI"
FT   CDS_pept        637287..637919
FT                   /codon_start=1
FT                   /gene_family="HOG000176323" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777009"
FT                   /locus_tag="AGOS_AER002W"
FT                   /product="AER002Wp"
FT                   /biological_process="intracellular transport"
FT                   /protein_id="AAS52686.2"
FT                   /db_xref="GO:0046907"
FT                   /db_xref="HOGENOM:HBG265217"
FT                   /db_xref="InterPro:IPR000156"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI0001DB28F2"
FT                   /db_xref="UniProtKB/TrEMBL:Q757L0"
FT                   /transl_table=1
FT                   /translation="MSQEAKPATPAPTSEEGPKPPTASVFTMFGGKKADDKKADDKKTA
FT                   EEQTGANSDSKAEDAAAEEDAVESPEVHFEPVVTLEKVEVKTMEEDEEVLFKVRAKLFR
FT                   FDGEAKEWKERGTGDVKFLQNKSTQKVRLLMRRDKTLKVCANHYISPEYVLKPNVGSDR
FT                   SWVYSCTADVAEGEPEAFTFAIRFGNKENADKFKEAFERAQAENKKR"
FT   CDS_pept        complement(638023..638847)
FT                   /codon_start=1
FT                   /gene_family="HOG000006053" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20624458"
FT                   /locus_tag="AER003C"
FT                   /orf_name="AGOS_AER003C"
FT                   /product="AER003Cp"
FT                   /function="di-trans,poly-cis-decaprenylcistransferase
FT                   activity"
FT                   /protein_id="AAS52687.1"
FT                   /db_xref="GO:0008834"
FT                   /db_xref="HOGENOM:HBG372223"
FT                   /db_xref="HOGENOM:HBG627837"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="UniParc:UPI0000252D68"
FT                   /db_xref="UniProtKB/TrEMBL:Q757K9"
FT                   /transl_table=1
FT                   /translation="MNDSRDFTQNSWLISRLKDVFVSVLRSSGRVPKHVGFIMDGNRRY
FT                   AKKHNIEVREGHSAGFMSMNKVLELCYESGVTTATVFAFSVDNFRRSAFEVDSLMELAK
FT                   ERVMQITQHGELAEQYGIHVRIIGDRSLLPADVQEEMARAEKATEANTRAVLNVCIPYT
FT                   ARGEILHAMKGTIADAQSDGAPITEADLDAHMYTGGLPPLDLLIRTSGVSRLSDFLLWQ
FT                   VCQKGVVIELLSCLWPDFGPLTMAWILLRYAFKKSDEFSGGDEDVADSKKSK"
FT   CDS_pept        639098..640525
FT                   /codon_start=1
FT                   /gene_family="HOG000009104" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758021"
FT                   /locus_tag="AGOS_AER004W"
FT                   /product="AER004Wp"
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /protein_id="AAS52688.2"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="HOGENOM:HBG313699"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR017446"
FT                   /db_xref="UniParc:UPI0001DB28F3"
FT                   /db_xref="UniProtKB/TrEMBL:Q757K8"
FT                   /transl_table=1
FT                   /translation="MIRSGSVRLLRETSAAGRCYTSRRSKSTFETAMDAVTRLVTPASW
FT                   LNRSPTFLVSDEMKTLSKNIARLIGSGHPVLNRVTSYYFDSGGKKVRPMLVLLLSRALS
FT                   EIPLDQRDRMRIDYTDVPEDPVYSQVPKSILFEHPVNNISPLHILHGIKPLNPLTKGPE
FT                   PLPQEFDRERGILPKQRRLAEIVEMIHTASLLHDDVIDHSGTRRGKPSGNVAFTNKMAV
FT                   LAGDFLLGRATVSISRLRNPEVVELVSNCIANLVEGEFMQLKNTVVDGDLETINNGTQQ
FT                   IPPASKTIPLPVHDYRVNTTLASGISHEVMIETAFDYYLHKTYLKTAALISKSCRAAAV
FT                   LSGARDPILDECYHFGKNLGICFQLVDDMLDFTTSGELGKPVGADFELGIATAPVLFAW
FT                   KEDPSLGPIIQRNFSQPGDVARALEAVHQHDGIKKTAEVAREYRDKALHNLRAALPESD
FT                   SRAALEFLTNSILTRRK"
FT   CDS_pept        complement(640753..642036)
FT                   /codon_start=1
FT                   /gene_family="HOG000248561" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758022"
FT                   /gene_name="GPI18"
FT                   /locus_tag="AER005C"
FT                   /product="GPI mannosyltransferase 2 "
FT                   /EC_number="2.4.1.-"
FT                   /function="transferase activity, transferring hexosyl
FT                   groups"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS52689.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016758"
FT                   /db_xref="HOGENOM:HBG396018"
FT                   /db_xref="HOGENOM:HBG434064"
FT                   /db_xref="InterPro:IPR007315"
FT                   /db_xref="UniParc:UPI0000252D6A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757K7"
FT                   /transl_table=1
FT                   /translation="MECFKRLTTVFFTVKLVQYLLVYFAPGQFDTSTPLFLEKYQPLQP
FT                   EKWYHKLLSWDSVYFVKNGLQAVTHTNAYGYVSLPEYEHEWMFSPFVWSQTLKTAGGAT
FT                   LRNWAAPIDTLLVRATLLNLVLHYVSVWLLYALTLRTFPKNRELAYKTSLLFILSSAAG
FT                   FLLAPYSEPLSFAFSFLGMLLRMLAVEHNVYGGITLAWYNWLPYTLSGICFSVAAANRP
FT                   NCVLLGVYYIYDVLKLVRQRNWVRAVLFPCIAGSMMLGIFAYMHYYLPSVVFCPERESW
FT                   CKHSLPWIHIPYKSFYSFVQGYYWRNGFLNYWTWNNVPNFLFALPNLVILWYSTVYFSY
FT                   QYPLESIRPLVYITRALLLIITFFAHVQIINRISSFIPLHLWYLSDRMIKTTGEAKGDD
FT                   RLVYLYVNWLILWIPLQTVLFACFLPPA"
FT   CDS_pept        642949..643482
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758023"
FT                   /locus_tag="AER006W"
FT                   /orf_name="AGOS_AER006W"
FT                   /product="AER006Wp"
FT                   /protein_id="AAS52690.1"
FT                   /db_xref="HOGENOM:HBG059036"
FT                   /db_xref="InterPro:IPR020999"
FT                   /db_xref="UniParc:UPI0000252D6B"
FT                   /db_xref="UniProtKB/TrEMBL:Q757K6"
FT                   /transl_table=1
FT                   /translation="MSEILTGLAVDSYDSDHLAKKIPWAIFTVWIIALLLCIFLVNLRR
FT                   RRRGLQPIMGTAWLAPPSYGQSQRQYNMPPVDPAAVPVPEYTTHPNANIDLGYYDNEGK
FT                   FHPADSSLPKPPPAATANTVPSSYTSAPVREQFDAEYERPAGAPPGAQVRQTSSSRGHA
FT                   MPGVTDSGAHYYAP"
FT   CDS_pept        643863..645350
FT                   /codon_start=1
FT                   /gene_family="HOG000271509" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758024"
FT                   /locus_tag="AER007W"
FT                   /orf_name="AGOS_AER007W"
FT                   /product="AER007Wp"
FT                   /function="oxidoreductase activity, acting on the aldehyde
FT                   or oxo group of donors, NAD or NADP as acceptor "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS52691.1"
FT                   /db_xref="GO:0016620"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG439831"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="HSSP:1AG8"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI0000252D6C"
FT                   /db_xref="UniProtKB/TrEMBL:Q757K5"
FT                   /transl_table=1
FT                   /translation="MGFQSFKPTFRNEDLVRRGAYINGEWITSAKESFNVTDPATDQVI
FT                   AELPDFDSGEAEAALKAAHASFQSYKKTSPTQRSEWLRNLYDLIMENAEDLAAIVTWEN
FT                   GKSLREALVEIRYGATFFKWFSEEALRLYGTTIQPSNPGNRAFTIRQPVGVCALICPWN
FT                   FPNAMISRKAAPALAAGCTVIIKPDPQTPLSSLALAHLAEKAGFPPGVINVVPTSKYTK
FT                   DIGVLLCESSLVRKVSFTGSTAVGKILMQQAASTVKKVSFELGGNAPVIIMGDADMEKT
FT                   VEEVLATKFRGMGQTCICANRLYVHRSIIDDFSSRLVKKVEGLKLGNGFQEGVTHGSLI
FT                   NNAAIEKVERHAKDAIERGAKVLLPGGRAPELGPHFYSPTVLSDVKPDSVLTREETFGP
FT                   LCAMIPFDTVEEVVGYANDTQYGLASYVFSENIKTVYSIAEALDFGMVACNTGLFSDSM
FT                   VPFGGIKESGFGIEGSLHGINDYTVLKTVTIGNVPTL"
FT   CDS_pept        645585..647117
FT                   /codon_start=1
FT                   /gene_family="HOG000141828" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758025"
FT                   /locus_tag="AER008W"
FT                   /orf_name="AGOS_AER008W"
FT                   /product="AER008Wp"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="DNA-dependent ATPase activity"
FT                   /biological_process="DNA metabolic process"
FT                   /protein_id="AAS52692.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006259"
FT                   /db_xref="GO:0008094"
FT                   /db_xref="HOGENOM:HBG059037"
FT                   /db_xref="HOGENOM:HBG203118"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="UniParc:UPI0000252D6D"
FT                   /db_xref="UniProtKB/TrEMBL:Q757K4"
FT                   /transl_table=1
FT                   /translation="MDLYEQLPSSQLVFDAQFQFLLECSQQQGVSVLDFLTLSPQQLVK
FT                   MLNRSVSEISKFQELLREEFRAEVFQANPILPASALKKVQCFTTGDVGIDALLNGGIYT
FT                   HGITEVFGESSSGKSQFLMQLSLAVQLPLELDGSAGQCVFITTESDLPTKRIESMIKSR
FT                   EIFSAGRVSQSNIFTATCNDWTSQNHILSVQLPILLERNPNIRLVIIDSISHHLRVELA
FT                   AKTFQQSLDNRSLIDQMAQNLLHLSQKHAVAVVVANQVGDKPIPDLPLKQTIMDYDYQL
FT                   GFMIGWKDSSIYYRHLRSAGVFDEEVLTDDDDYQKVVSTHERMILRKSQQQQQERQQQQ
FT                   QQQQQQKAQEYQEPSDESLQTQLKLGESSSSPGATVYASKSFPDANTQLSTISPQPSLK
FT                   KANHINSSLGYTVNTTPSPVIRKKKRVDTKTPNLGLTWANHLSTRIKLSKTHIASQLIE
FT                   EQDLDYDSIVDSTSLWQVKRSLKVVFSTHADQGLIEYFIRNEGLVTKKEKSG"
FT   CDS_pept        join(complement(648758..648763),complement(647414..648601))
FT                   /codon_start=1
FT                   /gene_family="HOG000065964" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758026"
FT                   /gene_name="MAF1"
FT                   /locus_tag="AER009C"
FT                   /product="Repressor of RNA polymerase III transcription
FT                   MAF1"
FT                   /function="transcription regulator activity"
FT                   /biological_process="negative regulation of transcription
FT                   from RNA polymerase III promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52693.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016480"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG190111"
FT                   /db_xref="HOGENOM:HBG512112"
FT                   /db_xref="InterPro:IPR015257"
FT                   /db_xref="InterPro:IPR017152"
FT                   /db_xref="UniParc:UPI0000252D6E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757K3"
FT                   /transl_table=1
FT                   /translation="MKFIDELDLELVNQTLNFETSESKISGGCDIFTTKPVASDKKLYK
FT                   TIDRHLESLLQENESYNAAIQQQIELENKRRDPKQAGSDCAEPAEDSPTRNANSFWEQK
FT                   RRMSVSESPRADTSPLFKSQKLNDQQLKELVSHPLEVPGCKSPSNETSARGVLRRSTSA
FT                   GSFENNAGSAEQQKRRTSSIGSAANGTKSPILRRSSFNRETINIGPFGPISETASRRTF
FT                   AYLIGILNASYPDHDFASLKPTDFVKSSRKQLVSKFENSIIALGKQPQEWIWETINAHM
FT                   DLADCVFYQYNPQESFLDDEPGHLWSLMWFMFNKKRKRVAYFYLSAFRVKNPPSTGGSV
FT                   ALDEYYDSNSKPELREKRRRLTIEHETNDFEGEYDLTYTSSGDGAVEDEDEDMNDAD"
FT   tRNA            649057..649128
FT                   /gene_name="tRNA-Glu"
FT   CDS_pept        complement(649250..651544)
FT                   /codon_start=1
FT                   /gene_family="HOG000141827" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758027"
FT                   /locus_tag="AGOS_AER010C"
FT                   /product="AER010Cp"
FT                   /function="binding"
FT                   /protein_id="AAS52694.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059038"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI0001DB28F4"
FT                   /db_xref="UniProtKB/TrEMBL:Q757K2"
FT                   /transl_table=1
FT                   /translation="MPFFDPNNPSPLDDIRIQEEYEGVDLNPRNRSKPRANSLLHDQQS
FT                   LISFDSIQTADRLLDKLDLSIEDELLLQQALREEEEERRIATQEYPDDIYFSMTQSSRP
FT                   MIPMTTARPAHRPVLCIPASSFPSLRHAGGTARHKTNVAPPVHQSSHAILEDLNDNEKL
FT                   VSSKGNVVEDHISKFRYSYLVQEGSGDEAEDTPQNEDGSETLDALQIEKYRRKLAQTNR
FT                   YYGTGSSPTELTHGSGSASVSNPQSRAKSSTHVLEQATHNETASSHTPSNSVSSLALQN
FT                   HTTASSFESDLTARTAENGPNNGSSTLLSTPKTSRKSLECDSPGHPSSPSIWNKGHKKK
FT                   NSFSLKNLFKSPKVTSETESSPKADNSSNEEHDAAAYSEQMPPITAPSAHRQSEHHHHS
FT                   ASAYPKKPLQKLQHSYKLLIEPRPMLPVVRSDEVALLKHRRSASLPKNGPRPGTQRDPN
FT                   TWEQQDRATLLQHAKILQQQKQLPQISSSHSHAHNKRPPVPPKDIPVGSQQPKMHTQQG
FT                   ANKMHKPATSVVQRTGSLGNKRVPDPPLPVSADGRLTPEQKVQLALELRNRRQYAECTK
FT                   LLREACEAGDRTGFLLYGLALRHGSGIPTNLPESFKWIFKASGVKDEAAEVLSLNIDPF
FT                   KLKNVPLVPPEPEAPALYECGISYLKGYGFAKPDELKGLKYLEQAASLGHIDSICLCGT
FT                   IWSKRSRNRPRDSCRAAAWFRIADAMGADLIGANWIYKEKYMRPSPESSAAVGSYKEQK
FT                   ATPPVPTKHKP"
FT   CDS_pept        complement(652495..655164)
FT                   /codon_start=1
FT                   /gene_family="HOG000001027" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081294"
FT                   /locus_tag="AGOS_AER011C"
FT                   /product="AER011Cp"
FT                   /protein_id="AAS52695.2"
FT                   /db_xref="HOGENOM:HBG059039"
FT                   /db_xref="InterPro:IPR008862"
FT                   /db_xref="UniParc:UPI0001DB28F5"
FT                   /db_xref="UniProtKB/TrEMBL:Q757K1"
FT                   /transl_table=1
FT                   /translation="MDQARTHTNTPPAETIALKSEPTAGRVSQADAGSSSPGSGGPNTM
FT                   ATAASSPEDNAEGEEARSAGPGLKQPDPRQQLTDYMQDMRALGSQGYITPSQQQGVADE
FT                   GPARRLERERGGPADSSFNTTMTHNNTTIFKPFDTQTGQFLSTPASAASALARGDSAAT
FT                   AVSASSASAASSQEHRSRNDQRPSAGRLRRMKFRSHSVPTILHSSCRRLNASSLTASVS
FT                   TSSATQLRDAQAPPQLEPAYANSAVSSTSTVSSGSMPPASQFAGIKKKKHGGKGNQGSL
FT                   RNAILMSHRLPPASGQDLSIDDRIRHIKMQSDPMPLPPINLQCLREIDLSEIVKNPQLR
FT                   HDIVFDPLLQFRPNLDGERGVKKRQIADKYWAEVENEIIVYNQRPEVFDYSRTRLVPLF
FT                   DTLKDVLVTIVPQKEISTVENVLDTELLIQELLKGSLIMTNLSDWLAQLFKHHCAPMRD
FT                   PWVDGMQCKFREAQEEKSVIKLVEALKLVFQILEAMKLDIANHQIRILRPALLSNAVEF
FT                   ERQYFRSLMNSQRVNLKSSLKWFKDKYDESVRDGSLKSDQLTKIPDIYRLCIRNIISLL
FT                   SCRKMVREYPTSLAFDHARLILLRADIRQAVCLLVCKLLFKQLVVNDTTADRATKEYVV
FT                   AKYNNKRLKEEIVSIITDEHGNCRWTKNTMSIAIHLCKTIDELKQEFETLKLQNTRQLG
FT                   ATRTFAAAHQASITNPKTTSTPISKTLTQLDSKNIDFAKSWLSKQTQPLSEVYGVLENR
FT                   VFNSLEESIFRRSNCTKDGVVKQDFINLCNSNSQGTTSSGMSGVNTNHSVAGASCSPSS
FT                   SVFSTPSRNHHLSAPAAAHGGAHPSGFPENDSAGSMASLDMEEFESLYRHLYAVVNFHW
FT                   SVFGCHYVEALGDNVERI"
FT   CDS_pept        complement(655702..656013)
FT                   /codon_start=1
FT                   /gene_family="HOG000234654" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758028"
FT                   /gene_name="HHF2"
FT                   /locus_tag="AER012C"
FT                   /product="Histone H4.2"
FT                   /function="DNA binding"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52696.2"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG210755"
FT                   /db_xref="HOGENOM:HBG385452"
FT                   /db_xref="InterPro:IPR001951"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR019809"
FT                   /db_xref="UniParc:UPI000042B79D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AX1"
FT                   /transl_table=1
FT                   /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVK
FT                   RISGLIYEDVRAVLKSFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG"
FT   mat_peptide     complement(655705..656010)
FT                   /gene_name="HHF2"
FT                   /locus_tag="AER012C"
FT                   /product="Histone H4.2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75AX1 "
FT   CDS_pept        656295..656705
FT                   /codon_start=1
FT                   /gene_family="HOG000155290" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758029"
FT                   /gene_name="HHT2"
FT                   /locus_tag="AER013W"
FT                   /product="Histone H3"
FT                   /function="DNA binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52697.1"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG493811"
FT                   /db_xref="HOGENOM:HBG715487"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI00000009B9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757N1"
FT                   /transl_table=1
FT                   /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPG
FT                   TVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSL
FT                   FEDTNLAAIHAKRVTIQKKDIKLARRLRGERS"
FT   mat_peptide     656298..656702
FT                   /gene_name="HHT2"
FT                   /locus_tag="AER013W"
FT                   /product="Histone H3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757N1 "
FT   CDS_pept        656845..657477
FT                   /codon_start=1
FT                   /gene_family="HOG000161598" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758030"
FT                   /gene_name="TRP1"
FT                   /locus_tag="AER014W"
FT                   /product="N-(5'-phosphoribosyl)anthranilate isomerase "
FT                   /EC_number="5.3.1.24"
FT                   /function="phosphoribosylanthranilate isomerase activity "
FT                   /biological_process="tryptophan biosynthetic process "
FT                   /protein_id="AAS52698.1"
FT                   /db_xref="GO:0000162"
FT                   /db_xref="GO:0004640"
FT                   /db_xref="HOGENOM:HBG502210"
FT                   /db_xref="HOGENOM:HBG554803"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0000252D72"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757J9"
FT                   /transl_table=1
FT                   /translation="MVVAKVCGVRDAGAAAAAAAAGAGFVGMVCVPGRRRTVGREEARA
FT                   IAAAVRGAPGTRLVGVFQDQAPEEVLRLQRELGLDAVQLHGAEDWAAFRAQLPASTLLI
FT                   KSFVFPRDCEAALAMHRAARGRNCMVLFDAAGGGSGARLDWAALAAWGAAHADVQFMLA
FT                   GGLTPANVAEAARLPGVVAVDVSSGVETGGAKDGNKIRQFVENAKGI"
FT   CDS_pept        complement(657500..658363)
FT                   /codon_start=1
FT                   /gene_family="HOG000195569" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758031"
FT                   /gene_name="IPP1"
FT                   /locus_tag="AER015C"
FT                   /product="Inorganic pyrophosphatase "
FT                   /EC_number="3.6.1.1"
FT                   /function="inorganic diphosphatase activity"
FT                   /function="magnesium ion binding"
FT                   /biological_process="phosphate metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS52699.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004427"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006796"
FT                   /db_xref="HOGENOM:HBG355416"
FT                   /db_xref="HOGENOM:HBG434750"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="UniParc:UPI0000252D73"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757J8"
FT                   /transl_table=1
FT                   /translation="MSYTTRQIGAKNTLDYRVFIEKAGKVVSPFHDIPLYADEENQIFN
FT                   MVVEIPRWTNAKLEITKEEAMNPIIQDTKKGKLRYVRNCFPHHGYIHNYGAFPQTWEDP
FT                   NVAHPETKAYGDNDPLDVLEIGETIAYTGQVKQVKVLGVMALLDEGETDWKIIVIDVHD
FT                   PLAPKLNDIEDVEKHLPGLLRATNEWFRIYKIPDGKPENQFAFSGEAKNRKYALDVIRE
FT                   CHEAWCQLVAGKAADDKKVSLANSTLQESVAYAPEVAAAVPAANPLPDAPIDKSIDKWF
FT                   FISGSA"
FT   tRNA            658655..658727
FT                   /gene_name="tRNA-Thr"
FT   CDS_pept        complement(658761..659204)
FT                   /codon_start=1
FT                   /gene_family="HOG000171951" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758032"
FT                   /locus_tag="AER016C"
FT                   /orf_name="AGOS_AER016C"
FT                   /product="AER016Cp"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS52700.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG346242"
FT                   /db_xref="HOGENOM:HBG381683"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0000252D74"
FT                   /db_xref="UniProtKB/TrEMBL:Q757J7"
FT                   /transl_table=1
FT                   /translation="MQLQINNIQCVASWYWDVPKELKRDSPVYEDEDEEDVCGICRGSY
FT                   NGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLREGIRIN
FT                   EPHRDKFEKVLMKARQQSVVSVAGANPVGPDQDDVIIDQEFIR"
FT   CDS_pept        complement(659326..659976)
FT                   /codon_start=1
FT                   /gene_family="HOG000208731" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624459"
FT                   /locus_tag="AGOS_AER017C"
FT                   /product="AER017Cp"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="AAS52701.2"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG429920"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011899"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="UniParc:UPI0001DB28F6"
FT                   /db_xref="UniProtKB/TrEMBL:Q757J6"
FT                   /transl_table=1
FT                   /translation="MLPKSNSKFISRRGMRMLLVTGVLLVLTYFIIQNGTTSDQFVTPI
FT                   APRPVPNAPSVQDTVEAEEPSVQLLSKGAEGAVAASKEDVDVARAQQQSKVLFDAAKTY
FT                   NEILSLSSMVVFSKSTCPLSSGLKQLLNNNYEFLPDYQVVELDKHANGAELQKYVTKTT
FT                   ARSTVPNLVINGVSRGGHDSIMELHKTGELLESLRKWANGKITVTQKQRPSNS"
FT   CDS_pept        complement(660224..662044)
FT                   /codon_start=1
FT                   /gene_family="HOG000000718" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624460"
FT                   /locus_tag="AER018C"
FT                   /orf_name="AGOS_AER018C"
FT                   /product="AER018Cp"
FT                   /protein_id="AAS52702.1"
FT                   /db_xref="HOGENOM:HBG190107"
FT                   /db_xref="HOGENOM:HBG204123"
FT                   /db_xref="InterPro:IPR022751"
FT                   /db_xref="UniParc:UPI0000252D76"
FT                   /db_xref="UniProtKB/TrEMBL:Q757J5"
FT                   /transl_table=1
FT                   /translation="MLRRKYSKTLKLSLITVALGALFLVTNRWLPGEFPSVYTEYLQNR
FT                   LPNLGSFGKQQHMEEQESQTRQMIEEGEMRSKPSELLEEEAARTEQAERKSQIFAFYQK
FT                   VFELLAEHSPSGQISHKSGRQCQVSQVVLQGHLDDTSHWPLLTREHLSKCLKMTQKDKQ
FT                   MVSDKHMHYVDALSNLKLSKRAYSGAGIVTVGGGKFSMLALLLIKSLRKVGTSLPVEVL
FT                   IPPGEEEEYDYCSKLLPEVGAKCIYLKDVLPPAVINNHYFEGYQLKSAAIIASSFKDLL
FT                   LLDADNIPILNLDDIFQSKPYVEHGLVLWPDFWRRSTSPDYYEIARVQVDYNRRVRNHI
FT                   DNLTPASVYTQNMKDLSSIPMHDMEGTLPDPSTESGQLLIDKERHLSTVLLSLYYNVNG
FT                   ETWYYPLFSQGAPGEGDKETFIAAANFYRKPYYQVRTSTGAEGYHTKKGFSGVAMLQHD
FT                   FREDYRRYEAAREDVKTKYAKSQQYDPEYTVEGFYKKYFEDPNQPPVDVMFVHANLPKF
FT                   EPLKMSEKQLLMENGSHFRSYSHLDKLHNYDIELESFRVLNEYLCVRKVQLKFYKDKLS
FT                   RPAKWNSMCKYVEDRLKFLESTHEEALRKT"
FT   CDS_pept        662958..664064
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059096"
FT                   /locus_tag="AGOS_AER018WA"
FT                   /product="AER018W-Ap"
FT                   /protein_id="ADJ41776.1"
FT                   /db_xref="UniParc:UPI0001DB28F7"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGD3"
FT                   /transl_table=1
FT                   /translation="MRRGGILAGIMFVSTAARWPGAAWAGSILDVCGGSTAGCSADGDI
FT                   HNALLDPVLAAAQELALRTFYCEGDPFSKIYVRLKALELTTTPEDIKRILETWPRWGLR
FT                   GAGAANESTLYDAILREALEAEVADLVAREEAGEADAALLGGAWDFAQDIALFERPIME
FT                   VAAAYVDALRGLKAILQEPGNVNTDVVRAWINDWFVKSPMMFRLALLQIKSSAKRMALE
FT                   RKYRRYYLQRILTGAWFYVDITHAAQRLFGEYRTGFDDVYPEVYNKFLHNLNSSFVEEF
FT                   NSFYRRPNFASESPTDGDPQEIMFRMLEYSLRGVFALKEPMATCFLGVAFVSAHDECYK
FT                   CIVNTSQRELVLMYKLITMYMSMKTKSS"
FT   CDS_pept        complement(664087..666411)
FT                   /codon_start=1
FT                   /gene_family="HOG000113510" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081295"
FT                   /locus_tag="AER019C"
FT                   /orf_name="AGOS_AER019C"
FT                   /product="AER019Cp"
FT                   /protein_id="AAS52703.1"
FT                   /db_xref="HOGENOM:HBG059040"
FT                   /db_xref="InterPro:IPR019183"
FT                   /db_xref="UniParc:UPI0000252D77"
FT                   /db_xref="UniProtKB/TrEMBL:Q757J4"
FT                   /transl_table=1
FT                   /translation="MNKHEEEILTLVQKDSYKQAINAVSKVVRQFPSSTYFRLLEQYVR
FT                   FKQSPSKYQYELMLGPLLEANTTLPHDAKSLDLLRTFLLELYSPIPPLKPYETAMKKYP
FT                   TFDLCYRWFQQAIQDLDFNSLNRATFQLSRFCKDVRAAKFWNAVVLLSWARVRPATMAK
FT                   QEQQLLPQLAYKILVQLKPYPKEEELVVFCQVCELLDEDKAAEIVDEILTFWGAEKANS
FT                   LDLYLKDLLLDNLLKLERHADLYEVCGKLLVHLDDFVLCKTLAQSAHKLGLPRADVESQ
FT                   LPATRNGLLTHLELGVLYNGRVTTDDLQPYLARFHDKTCCPVDLEHYMEHIDRSQLLTL
FT                   FSSFERSIDHDVNWARICPETTMDQFSNLFLEYRPTLLTKPDTNYSCCSHLILQLVQNL
FT                   VVDSRITLGNVLTAISLLESYQAQDAYNYDTRIWLIVLYQYLGITPAAHKHYENLKVKN
FT                   VQNDIVDHLLYTRYASFFPNKSHPYVQALCLAEDEQPIYQSLGGLPTLLKIAFERKSYT
FT                   KLPGMFSFYDQLRRSIMRWHKIGEHLKLLRICNDKRASHLKRIQMEILNLNLPESNSLA
FT                   DNRDFNVVFETANDKNAFSTLSGYMRVDDAYVRLQLCQEFMLEGISAGAFSPVVEILAP
FT                   AQKDFKQFTRYEKWAWDVISNVYEHMDDIQEEFLMDHLQKIPDFGLERDWKLVHGYSTV
FT                   LLTLKTLDGIKRIKSPTLKKLMKDQLQHVRGRCSSIFDEYAEEIATCSVDIEFLSRFGC
FT                   QPASESATQSLREVFKALRNL"
FT   CDS_pept        666836..667714
FT                   /codon_start=1
FT                   /gene_family="HOG000212937" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929984"
FT                   /locus_tag="AER020W"
FT                   /orf_name="AGOS_AER020W"
FT                   /product="AER020Wp"
FT                   /function="ATP binding"
FT                   /function="aminoacyl-tRNA ligase activity"
FT                   /biological_process="translation"
FT                   /protein_id="AAS52704.1"
FT                   /db_xref="GO:0004812"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG112663"
FT                   /db_xref="HOGENOM:HBG526758"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniParc:UPI0000252D78"
FT                   /db_xref="UniProtKB/TrEMBL:Q757J3"
FT                   /transl_table=1
FT                   /translation="MSSIYKALSGKNQKKKDGNAGAEKQYMNKQRVLLISSRGVTYRHR
FT                   HLIQDLHSLMPHSRKEPKLDTKKDLGQLNEIAELYNCNNVAFFEARKHQDLYMWLSKPP
FT                   NGPTVKFYLQNLHTMDELNFTGNCLKGSRPVLSFDKRFDTQPQYRLFKEMFIHTFGVPP
FT                   QARKSKPFIDHVMSFSIVDDKIWVRNYEISHAARNNSEYEDKQDEDISLVEIGPRFVMT
FT                   PILILEGAFGGPKIYENKQYVSPNVVRAQLKQEAAKEARARADAAVQRKIKRRDNVLAM
FT                   DPLSNDALFKN"
FT   CDS_pept        complement(667792..667989)
FT                   /codon_start=1
FT                   /gene_family="HOG000170763" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929985"
FT                   /locus_tag="AER021C"
FT                   /orf_name="AGOS_AER021C"
FT                   /product="AER021Cp"
FT                   /protein_id="AAS52705.1"
FT                   /db_xref="HOGENOM:HBG059041"
FT                   /db_xref="HOGENOM:HBG756506"
FT                   /db_xref="InterPro:IPR021278"
FT                   /db_xref="UniParc:UPI0000252D79"
FT                   /db_xref="UniProtKB/TrEMBL:Q757J2"
FT                   /transl_table=1
FT                   /translation="MGAAYTILGRTFQPHQLSLATIGLASLLVIPNPFKKAEAKPVWKA
FT                   ASEDEEKFIQEYLEKHSAKQ"
FT   tRNA            complement(668114..668186)
FT                   /gene_name="tRNA-Ala"
FT   CDS_pept        668634..670208
FT                   /codon_start=1
FT                   /gene_family="HOG000198296" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758033"
FT                   /locus_tag="AER022W"
FT                   /orf_name="AGOS_AER022W"
FT                   /product="AER022Wp"
FT                   /function="serine-type carboxypeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="AAS52706.1"
FT                   /db_xref="GO:0004185"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG474471"
FT                   /db_xref="HOGENOM:HBG588032"
FT                   /db_xref="HSSP:1BCS"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="UniParc:UPI0000252D7A"
FT                   /db_xref="UniProtKB/TrEMBL:Q757J1"
FT                   /transl_table=1
FT                   /translation="MRVSRLGFSCLALAGWASAMIMQNPFSAIMRGEGDAGSTTWLDGL
FT                   ESWPVLGQDGKLAKWYAQGMSEPRNMLQKIALRGSDFEVMRHKSNPDYALRVKKQDPAK
FT                   LGVDTVKQWSGYLDYKDEKHFFYWFFESRNDPANDPVMLWLNGGPGCSSFTGLLFELGP
FT                   ASIGKDLKPVHNPHSWNNNASVIFLEQPVGVGFSYGDSVDSTAVAGADVYAFLRLFFQK
FT                   FPHLAKNDFHIAGESYAGHYIPQIAHEIITSKEENSEEIPNFNLTSVLIGNGFTDPRTQ
FT                   YKYYEPMACGKGGVPAVLNEDQCSRMNASSSRCDRLMNLCYLTNRAIPCLAATVYCERY
FT                   ITQVYEETGLNYYDMRRKCESPDSDLCYRGLDYVQQYMNQKEVQEALGSEVELYEGCNK
FT                   RVGARFALSGDHGKPFQQYVSQLLDRAIPVLIYAGDKDYICNWLGNKAWSDEVGWRHTY
FT                   KYRTLPLKPWVNKNTGKTAGEVKSFGALTFLRVYDAGHMVPYDQPESSAYMIESWLNKN
FT                   YNLDYKV"
FT   CDS_pept        complement(670299..673418)
FT                   /codon_start=1
FT                   /gene_family="HOG000184672" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929986"
FT                   /locus_tag="AGOS_AER023C"
FT                   /product="AER023Cp"
FT                   /protein_id="AAS52707.2"
FT                   /db_xref="HOGENOM:HBG124975"
FT                   /db_xref="InterPro:IPR008828"
FT                   /db_xref="UniParc:UPI0001DB2914"
FT                   /db_xref="UniProtKB/TrEMBL:Q757J0"
FT                   /transl_table=1
FT                   /translation="MDSAVAARLNRLRAGFLKGCPEEDQMKRVIKPYGDATTDEALRQL
FT                   YVDREGHDLLVHLESPPISESYLGSMMPRTKKMSEERVGADEDKAESVVERSSRVLGAR
FT                   REDAAGAGLELPVLAVNGASEESFAGTSVSSTVSESKYDASQGPGKAKAVKGKSRFRSI
FT                   FRKKSSTDALRVQGAPKGAPRRTSLYDSSFGFEGIIDEDDDEEDNEDLDAEANKRFFYM
FT                   NGDLRDSIYPDVSNNSDEPKPKPIKKGNFLDNFSLNPQANIQNHDGRHVAGQKEEESSP
FT                   PKLGKPRNPETEEDYIIDSFINQKDLEPLELTENPPHDADVRNTSAARASLRSDRPSYV
FT                   EDADDDEAGGESGLASDAASSYGASLLYSDSSASDFRPNAVMDSSADTGMNPIEYLHYS
FT                   VPSTRGFAIYTVADDSSSVVNKLSSANRFRGSDTPNSEFKDSGSTPLLSKDGNHSGVSD
FT                   KKWSASLQPHSKSVRIRNSLPSFIMTGSIKSRAGRQYQHKRSTSDVNRASMQAFPEPLV
FT                   IKKVNVSDGKPHKSHLSSLLQKTENKADINPLEYFASASGANLPRGSVLDLDVYIQLSK
FT                   TYKKTPFSIRVKKTASVFETLGYALYCYVTKFRPGDLENDGLVIHEVENPNYFTLNIVD
FT                   EDGEPFEDNFGLLERTQCIGTVSDNEVVICRVEDNEQFTKNDSMTPLPHDFVKRATTIA
FT                   ETTCRTTSVNNNPPASAMTTISKDDNLTFKVYMYPNTNPRASGTTINIPGYCKIYDLVL
FT                   QCCKAKALDPTKYHLKPLGKNVLLDSNDLVNKLDGITSLELIKHKDSKSMAVEKLRQRR
FT                   PSLPTIQGSYMFNELTLDLGDQFIRAGDTANTKREDMVPGQNGGSKTTNNANKKYHSIY
FT                   KLGISRQHSLTAGHGAGIGGGIFRNKNSSKSSLTTNTQPPNVLAGGSSYKDMFAGAYYK
FT                   YKVWRRQQVSFINKHERTLAIDGDYIYIIPPENGYHWHQETGKTKSFHISQVSLVKRSK
FT                   RVPEYFKIFVIKPNNEKRYYFEAVSPEECVEIVTRLQNLSGAYKMNRKIK"
FT   CDS_pept        673637..674494
FT                   /codon_start=1
FT                   /gene_family="HOG000182422" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081296"
FT                   /gene_name="REX4"
FT                   /locus_tag="AER024W"
FT                   /product="RNA exonuclease 4"
FT                   /EC_number="3.1.-.-"
FT                   /function="exonuclease activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52708.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004527"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG206478"
FT                   /db_xref="HOGENOM:HBG756502"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniParc:UPI0000252D7C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757I9"
FT                   /transl_table=1
FT                   /translation="MVLSSNWSKLSKTQEKRVKKAEHGKSDGKSDGKTAGVGSRASGTP
FT                   PETAQRRKSKAKTSKIMEMVAKMNREMANSRQNSAEKNEVQKGALEEKISVDMAQSGKA
FT                   GKVGSVGKFVAMDCEFVGVGPDGKESVLARVSVVNYYGQEVLDLYVRPKEKVTDWRTWV
FT                   SGITPAHMKQAVTLEEAQRRVAAMLKNRVLIGHGLHHDLEMLMVSHPKAQIRDTSMHGP
FT                   FREKYGAGKTPSLKKLAREVLNIDIQGKEHSSVEDARAALLLYKSDKVEFERLHQQRFS
FT                   RRKA"
FT   CDS_pept        complement(674619..683354)
FT                   /codon_start=1
FT                   /gene_family="HOG000113101" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758034"
FT                   /locus_tag="AGOS_AER025C"
FT                   /product="AER025Cp"
FT                   /function="GTPase activator activity"
FT                   /biological_process="regulation of small GTPase mediated
FT                   signal transduction"
FT                   /biological_process="signal transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS52709.2"
FT                   /db_xref="GO:0005096"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0051056"
FT                   /db_xref="HOGENOM:HBG059043"
FT                   /db_xref="InterPro:IPR001936"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR023152"
FT                   /db_xref="UniParc:UPI0001DB2915"
FT                   /db_xref="UniProtKB/TrEMBL:Q757I8"
FT                   /transl_table=1
FT                   /translation="MVKNLICRIFNRLEQLLPTELNDFVYSEVERHPIFSNARLALLNA
FT                   GVTQGLQLVVDPLLEVVERIAEKNRPESGSTSGISSAVATLSVMESYTEDVLHSLLVML
FT                   RLLNDIIEVTWQSYESNHAGDEAEPGREAGTVNGFYSTYKVGFATEKEWTHAMAPPALE
FT                   TTAAQQLLRISNRFKTRSQTLEILKKIANSLHRPETLNSRLKVPDTLHNERSQTRSELL
FT                   DKIDDNCEALMKHVAASNPHEYHSYINTRIISPLLVTQTQNETDIATYLDAFSFYFITN
FT                   KYLVSFLELVSKMVTYFKKSVYQEVLLKFVSQAMTTWILSRPQEYLDVIDRIKYHPEDQ
FT                   STQLLIKEASFLFEEIYNSFSVTHILTESPTLQSTMSSPTSAGGSTSSIPGDGTSPAKG
FT                   SNAAHSISSATIVITNSVDDPMRPSTVPDTGEHASNHPRMTGNPDNVENITHMSVLSFL
FT                   SCMVMLHPGAFEEINNTSFRNIPDDPHLNESKEDITDSLYATTSGTTSVNSDERIRHSQ
FT                   HRRLKSFKKLTAFSTHSSNHHKVKFLSALVDNLTGIHAVSDAAIVDSLRTLILISSLAA
FT                   SVFQFEKDAPSIHFSRRLFPVLCDSLQLCSEQNARRNPLIAKCLFRHYTLHSSLQIDYF
FT                   PVACSLEPDAFNLRLQEYLEQRNNSLGHLHILTEGLKAYVCVQRNMPSEFKTLLATIGL
FT                   LRRTAYGLSCVLIEGSPLFDDRSSVSAVIDDLLEGRLIDELNIDDSDDGDPRIPAFMNA
FT                   FVPKESMKSFPQTPSVPSFTSSSFNEKTPSAPFIFPNKSDHDAVRIRRPSIGSPQPTLH
FT                   GRLTTTSSLPHDLERVQYSMRASMDRGVRPPLRMSSRGRYGSQDSIMHLMRSTSFVGNE
FT                   ALQEVRKDASNLYIVRKIIGNIYAIYKAVLHFSMSVLEAEKISPLHIDDYKDVVKPVFA
FT                   ALIDDGADSHSAVKAYCYVGITCIDELAGEHANKYMPSVFKANGYLIALLAASLFNVSL
FT                   TDSKREQIFGYLTDFWEFRQAIVKYFEKRGILSKISDEELYTFPVIRGATGRALCVSMY
FT                   SHNPNIHRLLKIGFRLFQKEIANHHLVNGHRVTTGQFNLQFIKAMGRDSYLSTGALAFQ
FT                   RRLRSDILARIKHPDRILYDSLRLIYNHWYSLLTAEHRSDTESNHFRNCAGFIAASCGV
FT                   FLAADDDILEKFSYLYQVRDSMVEKIDYFIYKQCQSINNEDLLTRENSRDIVSSELHPL
FT                   AFALLFKHLKKKAKDLFDIKITQPENELHYVLLEQIILVIRVILERDDDTDVLICVSLD
FT                   LIELLGDIFKIIELMPRDSPKYYKIIIQISKMLRSFEHSEQKICISGCMLIKNKWLRLT
FT                   MRWFESTIFREYDLENLGKPHRSMDLQRRDLDYLYIDTSIESSKALAYLTKDLVLEAPQ
FT                   SMSEKELSRSKEVVFGNYFTILLKGLEKSTGIKKFPPTLRHKIGMLNDNIITSLTNLLN
FT                   YNVDVGFKYALPIGYSPNRNIKLAFLKVFVNIVSNFDVTKKRLEEERSAAIETLLDRAV
FT                   EDPKLLSKAARVCPANDIDSLAGSFVTLYDIKNAAHLIVIELIIDEISRATRYMDVLRR
FT                   NSCATRSLSMFSRLKGGAYLINVLKPVLEEVVATGETFDVEKIEPDDPDCQIHVDLFCK
FT                   YLNKLVDSIVGSVADFPPEFFVICQSIYSSVKENFPDSAEIAVGSFIFLRFFCPALVSP
FT                   DSEGITDPLYPKARRSFMILAKVIQNIANGSVSSLKWPALQSEVEFLKTISDRIFCYLK
FT                   EISDPTRKVEIRTKPENRASVDDFHMLHRFLYYHGFEIRREFINDVKSAEDMGRLREFC
FT                   RLADRLLSLLGQPRMEFKSAISPYIRDHMDTNPELYEFMSRHSLKNILPEDTPFVREGV
FT                   SPDGFPIIVLTWHLCDRILKRESDALVFRIFQIYSKVWTTSHYCVIDCTGFDCQKYEEP
FT                   VRKLSNLFYKLIPHDAAKNCTGFYYYNMTENLLDLWLPIFRDKARYLSGLKIPHHFINS
FT                   NSPTKAISMLGLSDYSLEVYTDVRVTLHDASVYNSKDKKFYPVTLKIGNKHFQVIHDTP
FT                   KSINLGIMETALDIYFNDVYDIAEIKSTGLSNEVGVPYEFTIIMDDGNKLIFTSTKCLE
FT                   ILKIFYYSQVRLEEEFRDDEFGVSSMAHDHNKRKDMTYTIGHILMIVFVGLTSEDDAAE
FT                   SVAYNLMAATQSTFDLDCGHKLTVPPEVYVSGDNSAFYNSILNTLAVTTPELCECIWTY
FT                   ALDLLENVLNKKQITALLIALSPWTKNLYEYVYLANDEEGPEITTQIIRRLIRITMKQE
FT                   LHSILYAQLIFSNILLEGDLTELLFDEVIHHCVDRASEGSEWKRIIVILTKVPTTEVCG
FT                   LVLRKIQKISNSFLPTLQLETSTHSWSELIILVEVAVSLFFDSLLLAQLHLSEILCIVS
FT                   LLIDVGPTELRSALHRLLMNVCHSFVNNERLYEPQKENLKKISITLSRQKLKFMFGFSQ
FT                   DKGRVLQNFSPSSFLTKFTTLEHFISNLLELMGNASVNHSTVLCWKTKYLKYIMDVVTN
FT                   VESFLSSRAMMIIGIISKNGINDNLCYKLLRQTFRTLSVPWITEESIFYAISHIFAYSK
FT                   IVNGLQPTSKLLPQMFWFSTTYIRSPKSMVYQGGLLLMMNSAQRMSLASGGENAPPLLS
FT                   QLYKERQFVEAVMDEQGRVDGMRFTEANFIHILMAYLSKGLLIPFVRTTAVEALITFFR
FT                   LTFHKSPYQADDNYLVFMFFIYLVQRPDHFNEMLNEMDPDSEIISLDDTTGIDSRLLSW
FT                   MENGSDTALFALYQGAVYFSSRNSDEPGKVRFLLLLKHLVVKQPFMVFKVYNVIRDELG
FT                   RINTYDVSNTNTVTVAFFVIRLMVVQKDYLKLDDIQQEMQNHLATRGLSGISDIDIDAA
FT                   KKESELSPEKQIESILPRKVHALQIVDQMLSLSG"
FT   CDS_pept        complement(683666..684670)
FT                   /codon_start=1
FT                   /gene_family="HOG000171862" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758035"
FT                   /locus_tag="AER026C"
FT                   /orf_name="AGOS_AER026C"
FT                   /product="AER026Cp"
FT                   /protein_id="AAS52710.1"
FT                   /db_xref="HOGENOM:HBG396270"
FT                   /db_xref="HOGENOM:HBG527326"
FT                   /db_xref="InterPro:IPR021867"
FT                   /db_xref="UniParc:UPI0000252D7E"
FT                   /db_xref="UniProtKB/TrEMBL:Q757I7"
FT                   /transl_table=1
FT                   /translation="MLARKRRSITGKSAVKHTPAIKPSKARKVIRRYHVLLQKRRAICK
FT                   LLGIPVAENDEVLNERQIARYVTDAGLQEQYRLGADMAHPDEKVERELLKIQKMRESPL
FT                   LVQMLGYVMAEINGPRGLQNYQAASTVGQTASRGGDTSRQLVPWLREAGTPADARALEI
FT                   GALSAANCISTCGLLRTVVRIDLHSNDSTAIEEQDFMLRPLPQADADAFDLISCSLVLN
FT                   FVPTPLARGEMLLRFRSFLRGPRPLLFIVLPLPCMENSRYMNSEYFCNMMTALGYNCLY
FT                   QRSAKKLIYFLFASRTGMPAPYPLKYTRKHQLADGPAMNNFSITLPALSSPRI"
FT   CDS_pept        684897..687155
FT                   /codon_start=1
FT                   /gene_family="HOG000290702" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758036"
FT                   /gene_name="MAK5"
FT                   /locus_tag="AER027W"
FT                   /product="ATP-dependent RNA helicase MAK5 "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="AAS52711.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0000252D7F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757I6"
FT                   /transl_table=1
FT                   /translation="MSPTNNGRNKKLGPRRKVPGRVSKSKSRAKVQAGDAKRVLDANAL
FT                   KWEKVDVPDTLGDFGGFYGLEEIDGVDVEVVDGKVQFVARDESRLKSPADAVDGTDMVE
FT                   VDEDAGMEDVTEFRNLDDVAEGELSALSDEGSASEDDGSDSSGSSDMDEDDDQELQSEI
FT                   FNKDIGLDEAEAPELPSWTNTMKLSATVLQGLSRLGFSNPTEIQLQSIPKALDGHDIMG
FT                   KASTGSGKTLAYGIPILEGIIRDDTDSRPIGLIFTPTRELAHQVTDHLREVGALLVKRN
FT                   PYSIMCLTGGLSIQKQERLLKYKGSARVVVATPGRFLELLEKDQTLIDRFAKVDTLVLD
FT                   EADRLLQDGHFEEFERILKHLSRARKFTNGKKHGWKTMIYSATFSLDYFNKLSNTSWKK
FT                   MKKAPSENEMEEVLKHLMTKIPFRGKPLIIDTNPEQKVASQIKESLIECLPTERDLYVY
FT                   YFVTLYPGTTLVFCNAIDSVKKLNAYLHNLKISAFQIHSSMLQKNRLKSLEKFQEQAKK
FT                   NQALNKPTVLIASDVAARGLDIPGIQHVIHYHLPRSADVYIHRSGRTARAENEGVAVTI
FT                   CSPQEAMGPLRKLRRVLAGKAGSKGKRWQNEIALLPVEPDIVSQLRERSRLASALADSE
FT                   IATSSLSKDDNWLKKAADDLGIDVDSDDETKDTFLAKNKTKKLNKQLDKSTSKSYKMEL
FT                   NALLNTPIRKDARKSYLTGGLSNLADDLTKKKGHSSIIGHDKVDALTLLKSKSKRAKR"
FT   CDS_pept        complement(687320..688636)
FT                   /codon_start=1
FT                   /gene_family="HOG000224681" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758037"
FT                   /locus_tag="AER028C"
FT                   /orf_name="AGOS_AER028C"
FT                   /product="AER028Cp"
FT                   /function="translation release factor activity, codon
FT                   specific"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS52712.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016149"
FT                   /db_xref="HOGENOM:HBG007735"
FT                   /db_xref="HOGENOM:HBG497188"
FT                   /db_xref="InterPro:IPR004403"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="UniParc:UPI0000252D80"
FT                   /db_xref="UniProtKB/TrEMBL:Q757I5"
FT                   /transl_table=1
FT                   /translation="MDSGEAEKNIKIWKMKKLVKSLEKARGNGTSMISLVIPPGGQISQ
FT                   TQKKLTDEYGTASNIKSRVNRLSVLSAITSTQQKLKLYNQIPPNGLVLYCGDVITEEGK
FT                   VKKVTFDIEPYKPINTKLYKCDNKFRTEVLSELLEADEKFGFIVMDGQGCLFGMLSGNT
FT                   RTVLQKFTVDLPKKHGRGGQSAVRFARLREEKRHNYVRKVAEVAVQNFITNDKVNVKGL
FT                   ILAGSADFKTDLAKSELFDLRLAAKIVKIVDVSYGSENGFNQAIELSAEALANVKFIQE
FT                   KKLLTEYFDEISQDSGKFCYGVDDTLKALDLGAVEKLIVFENLEIVRYVFKTSEDEEVI
FT                   KFATPTQEDKSYAIDKATGTEMEVKEEQLLIEWLAEHYKEFGANLEFISDKSSEGAQFV
FT                   TGFGGIGGILRYKVNFDQLADDSEDEYYDDDEGSDYDFI"
FT   CDS_pept        complement(689025..690722)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758038"
FT                   /locus_tag="AGOS_AER029C"
FT                   /product="AER029Cp"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS52713.2"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059044"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="UniParc:UPI0001DB2916"
FT                   /db_xref="UniProtKB/TrEMBL:Q757I4"
FT                   /transl_table=1
FT                   /translation="MERESPCKVCPVAEGERVLIDGPNVHAVETVRRILASKRPKMPME
FT                   AMHAMCEQQGAKCRATAQNTDSDAPSVVTIAKEQWERLVSSINSLSLGPDGPAAAGEST
FT                   EHKGVRCDGCWSKYGDGAGFIRGLRYRCVCCDDFNLCAECEATGYTGSQHDSGHAMLKI
FT                   KNPQHPWWRALRMPVHYRVVCDGCNPGVIRVVDTETCSEEGYIQGPRFHCLQCLDHDYC
FT                   ARCVANEMGTGTHRPSHSMELIRLPGYRPTHTYASPRSGGMRCAGRCESDLTGRQYYRC
FT                   IQCDAFHLCVDCFHKGVAIVEHVNAHGISCQDTSPASLFVGEPSPGELPSLIRAPLASV
FT                   CIFAPDISVAAATLFSQVHDVKDLERIASQCAAYESLVPRFGASAEELERKLSSLPPKA
FT                   TEDEFGISVTVSRVDFALTFRLRNYTTDAIPSSSSLVFSHHPVGGSSHTRTMSIGPHEL
FT                   PPGSSKQLNICYPHQTSDGDPYSLSLVSPAGTALYSGKASSMPADILLACPGGTPASSA
FT                   AFNAMYTNQSSASVPAPVVNAPFRQSNSPVMPSDEEYDLLSDSDIEVV"
FT   CDS_pept        complement(691116..693743)
FT                   /codon_start=1
FT                   /gene_family="HOG000161488" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758039"
FT                   /locus_tag="AER030C"
FT                   /orf_name="AGOS_AER030C"
FT                   /product="AER030Cp"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS52714.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG175905"
FT                   /db_xref="HOGENOM:HBG327532"
FT                   /db_xref="InterPro:IPR003864"
FT                   /db_xref="InterPro:IPR022257"
FT                   /db_xref="UniParc:UPI0000252D82"
FT                   /db_xref="UniProtKB/TrEMBL:Q757I3"
FT                   /transl_table=1
FT                   /translation="MADANDSSDSNSTSSFVSALILYGIIGLVYTLIFLALRKRYRRVY
FT                   EPRTLDDVRTLQPSERVESAPAGYVWWLPHLLYKPHKSLLQHMGVDAYFFARYLAVFGT
FT                   LALIGCFILLPILLPVNAAGGRHLRGFERISFSNVAMSRRLYAHVFLSWIFFGLVLYVI
FT                   YRELYYYVSMRQALQTSPYYSSLLQSRTVLFTDVRGGTDAESVLRGAFTGVEEVVYAKD
FT                   HTELRKLVKERNKTANKYESALNKVVNKSVKVRRKAELKGNTVLQQREDLKDDDFERYV
FT                   KKRPTHRLGKIPCVGEKVDTLKHCASRLGSLNSRVKSEQEEWETSQPLNTCFVIFSTQR
FT                   DAQEAYQRAPVALPKGSYDRCIIGCAPDDVNWDSLSMSKSVRRSKRLVGNSILTAMIIF
FT                   WAIPVAVVGCISNINFLTEKVHFLRFINNLPDVLMGLITSLLPTIMLAVLMSLVPIFIQ
FT                   LVANKTGSISRQETQLYCQRWFYAFQVVHVVLVVMLASSAASTVTAIIDDPNNAFEQLA
FT                   QNMPLSANFYLSYVMLFAFIFASGVLLQLTGFVLSFILGRILDSTPRQKWTRYNTLNLP
FT                   TWGVMYPLMELQVCIMLAYAIVTPVLLIISTLALLFAYVAYMYVFNYVYGLKHDYKGRN
FT                   YVNALFQVFVGLYLAEVFLFALFIMGRAWGPLVLNVIMLAFTVLVHLYLQRRFLPLVDA
FT                   VPLSLLDGAAGSVGKDQGWAEVVRAGRARPLDGLVALTNRLTGAATPAHPAPVNPDAEK
FT                   AALSRSAPAAASSALARVKNFFHPSAAYNYDLAKSRLPDTYDKPLEYAEGYTRSAYTDP
FT                   CIRDKEPVLWVPEDPMGVAARQAAIAEQHGVKVSTSHTGFDEKGAAIYTDNPPDYTPYD
FT                   YVNH"
FT   CDS_pept        complement(694421..695416)
FT                   /codon_start=1
FT                   /gene_family="HOG000071678" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19777010"
FT                   /gene_name="GPD"
FT                   /locus_tag="AER031C"
FT                   /product="Glyceraldehyde-3-phosphate dehydrogenase "
FT                   /EC_number="1.2.1.12"
FT                   /function="NAD or NADH binding"
FT                   /function="glyceraldehyde-3-phosphate dehydrogenase
FT                   (phosphorylating) activity"
FT                   /biological_process="glycolysis"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS52715.2"
FT                   /db_xref="GO:0004365"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG269967"
FT                   /db_xref="HOGENOM:HBG571736"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="UniParc:UPI0001DB2917"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757I2"
FT                   /transl_table=1
FT                   /translation="MVKVAINGFGRIGRLVMRIALSRANVEVVAINDPFITVDYAAYMF
FT                   KYDSTHGKYAGDVQYEGNTLVIDGKKIKVFQERDPAQLPWGEEGIDIAIDSTGVFKELD
FT                   SAQKHIDAGAKKVVITAPSSTAPMFVMGVNEEKYAGETIVSNASCTTNCLAPLAKVIDE
FT                   QFGIEEGLMTTVHSLTATQKTVDGPSMKDWRGGRTASGNIIPSSTGAAKAVGKVLPQLN
FT                   GKLTGMAFRVPTVDVSVVDLTVKLNKETTYDEIKAAIKAASEGKLKGILGYTEDAVVST
FT                   DFLGDNNSSIFDASAGIMLSPKFVKLVSWYDNEYGYSTRVVDLVEHVAAN"
FT   CDS_pept        695995..697050
FT                   /codon_start=1
FT                   /gene_family="HOG000294685" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758040"
FT                   /locus_tag="AER032W"
FT                   /orf_name="AGOS_AER032W"
FT                   /product="AER032Wp"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS52716.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000252D84"
FT                   /db_xref="UniProtKB/TrEMBL:Q757I1"
FT                   /transl_table=1
FT                   /translation="MSAPTIPRTQKAVIFYENGGPLQYTDIEVPKPKATELLINVKYSG
FT                   VCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVAMGENVRGWKIGDLAGIKWLNGSCMAC
FT                   EYCEKSNESNCPEADLSGYTHDGSFQQYATADAVQAAHIPAGTDLAQVAPILCAGITVY
FT                   KALKSANLRAGDWVAISGACGGLGSLAIQYATAMGYRVLGIDGGEEKEQLFRQLGGEVF
FT                   IDFRKSKDIVADVVKATNGGAHGVINVSVSEAAIESSTEYVRSNGTVVLVGLPGGAKCK
FT                   SDVFSHVVKSISIVGSYVGNRADTREALDFFARGLVKSPIQVVGLSELPQIYEKMEKGA
FT                   VVGRYVVDTSM"
FT   CDS_pept        697282..698121
FT                   /codon_start=1
FT                   /gene_family="HOG000019802" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758041"
FT                   /gene_name="MRPS9"
FT                   /locus_tag="AER033W"
FT                   /product="40S ribosomal protein S9, mitochondrial "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="mitochondrion"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS52717.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG059045"
FT                   /db_xref="HOGENOM:HBG328295"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="UniParc:UPI0000252D85"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757I0"
FT                   /transl_table=1
FT                   /translation="MFARMASLRALVPVRALLWRAPVRSVHRAAVRETRIVPQLPTFYS
FT                   ANPAHEAHMDRLEALLRKHTKQQARRVAVERTASDRPRWLSFDQYALIGGTSRLKPTQY
FT                   RQLVSVLDRLHAIDPQLSNGEIAATLEAFLRKSRLEEQNVVRQELDHLGRACAVGRRKT
FT                   SSAKVWLVRGSGEVLVNGRTFADYFSKIKDRDAIMYPLRVLDAAGKYNIFAAVRGGGVT
FT                   GQAEAIMHAVAKALVVFNPLLKTRLHRAGVLTRDYRHVERKKPGKRKARKMPAWVKR"
FT   CDS_pept        complement(698191..698523)
FT                   /codon_start=1
FT                   /gene_family="HOG000216554" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758042"
FT                   /locus_tag="AER034C"
FT                   /orf_name="AGOS_AER034C"
FT                   /product="AER034Cp"
FT                   /function="DNA binding"
FT                   /protein_id="AAS52718.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="HOGENOM:HBG192507"
FT                   /db_xref="HOGENOM:HBG202961"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI0000252D86"
FT                   /db_xref="UniProtKB/TrEMBL:Q757H9"
FT                   /transl_table=1
FT                   /translation="MPEIDQHKKRLVGQLKGKLWFCIEQQVRRELPYGVTFTPKFINAL
FT                   VELCFAQLDELGGDLEAFARHAGREVVASDDVMLRLRKNPELQAFLRRELAQLRAPGAA
FT                   RTAQRR"
FT   CDS_pept        698712..701732
FT                   /codon_start=1
FT                   /gene_family="HOG000141726" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758043"
FT                   /locus_tag="AGOS_AER035W"
FT                   /product="AER035Wp"
FT                   /protein_id="AAS52719.2"
FT                   /db_xref="HOGENOM:HBG059047"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR021772"
FT                   /db_xref="UniParc:UPI0001DB2918"
FT                   /db_xref="UniProtKB/TrEMBL:Q757H8"
FT                   /transl_table=1
FT                   /translation="MNQYTITYGLSPPQSARNRNMHILPVMKMLPLPDGFLTGGRDGTV
FT                   VKHCYCEVSHNYQKRVRMQVHSDWVSDLVELSAGTYLSVSHDFSVHLLLLQTRNDGWET
FT                   RILGYHDDYVKCICVLQRGGADSSRSSSSERSRGESGSGGRALFATGGLDKKVKFWELQ
FT                   GREARVLFEYDNAQPQETGSVYALCALSPQEVVIGDNNGDLKIISAVTGELVHVVSGAH
FT                   GSNVRLAQLLDQGRRLITTSSDGAVKLWDVAALCAGEAEAALVHEWQWQCPVWSVAGLS
FT                   ESTLLFGDAWGNITRIRHTGQDTASWGRAVQDVLYGAAPDVEVYTNGILSMCFMEQSKL
FT                   WFSCSRNSNIYLMKLDAEGVQTDRKIQSLEGGSALLKSCLLTNRRHVITLNTLNQVQKW
FT                   DIVSCELLDTYRPTDGSFDDLVNKNNTKEILPHWCSVSIRTGKLFIKFNDRFTATEVYG
FT                   TALKQYKLINDVVLNDDQRYNLGRLAINSILYEFIKYELHMDKFARLEAVNSKRSSSSS
FT                   SNIIPQLPNNIPQDLQKQQGYLGQDYDQQGRIPQLVLYPLQRATTTGNIDDTPDKPVSK
FT                   ERKRLNIFPKMPGTSSVNNSAHSEAGTPKSDTMSPILGESIDQTPRPAPSEDETITPSL
FT                   PLTAGADEVGLERATPATAPELGPKQSSSNLSLLSRFRRQSTHILGPPTLNNFPSMQRC
FT                   ESPPETQTSEESPEKEPPATQNGLKSNGPGSEKALPATPVSLKTMADLLHANKEIYRQQ
FT                   ATTKGGAFKKFGRKLLESQFLRDDEAPLIEIKNGCLILINYWRTGSCGDTVLFSTYLPA
FT                   PDYSWHFDDPDSDAGNEHPSNELTRMDRIYRFRIFRSLEQHFPYWFARQLFHEEKTAKN
FT                   YPKLNFLIKPYVSPDGEANTAEPEEKVRSSHMLFSKKSQELPAALPPITDGKMRLSAPD
FT                   MIKVKRIKQYIVDRFESKTPEMRNKISVSEWLELLCKDSLLDDDLTLAAIRTLHWKSNN
FT                   EIVLEYRRKVRQTSRKR"
FT   CDS_pept        702063..702710
FT                   /codon_start=1
FT                   /gene_family="HOG000205213" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758044"
FT                   /gene_name="RPB5"
FT                   /locus_tag="AER036W"
FT                   /product="DNA-directed RNA polymerases I, II, and III
FT                   subunit RPABC1"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52720.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG051063"
FT                   /db_xref="HOGENOM:HBG314635"
FT                   /db_xref="InterPro:IPR000783"
FT                   /db_xref="InterPro:IPR005571"
FT                   /db_xref="InterPro:IPR014381"
FT                   /db_xref="InterPro:IPR020608"
FT                   /db_xref="UniParc:UPI0000252D88"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757H7"
FT                   /transl_table=1
FT                   /translation="MDQDNERNVSRLWRAFRTVKEMVRDRGYFITQEEVDLSLEDFKAK
FT                   YCDSMGRPQRKMMSFQSNPTEETLKKSPNMGSVWVEFCDEPSVGIKTMKNFVIHIGEKN
FT                   FQTGIFIYQNGITPSALKLLPSVAPATIETFNETALVVNITHHELVPKHIKLSDEEKKE
FT                   LLKRYRLKESQLPRIQRMDPVALYLGLKRGEVVKIIRKSETSGRYASYRICL"
FT   CDS_pept        complement(702856..703596)
FT                   /codon_start=1
FT                   /gene_family="HOG000225965" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081297"
FT                   /gene_name="RIB7"
FT                   /locus_tag="AER037C"
FT                   /product="5-amino-6-(5-phosphoribosylamino)uracil reductase"
FT                   /EC_number="1.1.1.193"
FT                   /function="5-amino-6-(5-phosphoribosylamino)uracil
FT                   reductase activity"
FT                   /function="NADP or NADPH binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="riboflavin biosynthetic process "
FT                   /protein_id="AAS52721.1"
FT                   /db_xref="GO:0008703"
FT                   /db_xref="GO:0009231"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053449"
FT                   /db_xref="HOGENOM:HBG668075"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="UniParc:UPI0000252D89"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757H6"
FT                   /transl_table=1
FT                   /translation="MALIPLSQDLADILAPYLPTPPDSSARLPFVTLTYAQSLDARIAK
FT                   QKGERTVISHEETKTMTHYLRYHHSGILIGSGTALADDPGLNCRWTPAADGADCTEQSS
FT                   PRPIILDVRGRWRYRGSKIEYLHNLGKGKAPIVVTGGEPEVRELGVSYLQLGVDEGGRL
FT                   NWGELFERLYSEHHLESVMVEGGAEVLNQLLLRPDIVDSLVITIGSKFLGSLGVAVSPA
FT                   EEVNLEHVNWWHGTSDSVLCGRLA"
FT   CDS_pept        complement(703680..704474)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18929987"
FT                   /gene_name="SPP381"
FT                   /locus_tag="AER038C"
FT                   /product="Pre-mRNA-splicing factor SPP381 "
FT                   /function="RNA binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="extracellular region"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="AAS52722.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG059048"
FT                   /db_xref="InterPro:IPR009730"
FT                   /db_xref="UniParc:UPI0000252D8A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757H5"
FT                   /transl_table=1
FT                   /translation="MAIRHFRRQREQVTSGSSSDTETSDVSEQDTGAGEGPTEAETRAE
FT                   GAEQGAWERAPSVAGSEAGESDEDDSESSSSDDEEVVLHRPVFLKKRDPGAGPAARTGA
FT                   VSGAQERTLDQVQHHNAVQDKERALKQIATSYSTDKELLHRIAQLETDGDTDSDSERRE
FT                   HELWAQRRHQRMLRLREEERRRQSELEENEAARLTNSALPMDDAGIQTAGGAERGTRPA
FT                   SSSDARKRRGPEAKFKPSKVQKPQLKRTASPSRADENEFSIL"
FT   CDS_pept        704810..705556
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081298"
FT                   /locus_tag="AGOS_AER039W"
FT                   /product="AER039Wp"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="AAS52723.2"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG059049"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI0001DB2919"
FT                   /db_xref="UniProtKB/TrEMBL:Q757H4"
FT                   /transl_table=1
FT                   /translation="MRVCSVFLLVWGAVALASVVSIKSEDQFYALVDNGRYSLIKYYTA
FT                   WCSHCKHLAPVFVELSDRELAMPAGAEVQFLEVDCDRFGNSLCARLPGFPVLELVRPSA
FT                   QDGPEAAPQPPAAGGWRRVLHWLHALLPQQHPFRVPEDRIAEFRGSRTADTIASFIQQV
FT                   VRNDRLEELAQRVLDGAAQEDEPLVHNGRAYLASVAGKDLREERNRLETLLGSDVGISK
FT                   AEELRLHLSIVSKLQEADSALLDDEL"
FT   CDS_pept        complement(705634..706539)
FT                   /codon_start=1
FT                   /gene_family="HOG000248817" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758045"
FT                   /locus_tag="AER040C"
FT                   /orf_name="AGOS_AER040C"
FT                   /product="AER040Cp"
FT                   /protein_id="AAS52724.1"
FT                   /db_xref="HOGENOM:HBG059050"
FT                   /db_xref="HOGENOM:HBG396546"
FT                   /db_xref="InterPro:IPR009737"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI0000252D8C"
FT                   /db_xref="UniProtKB/TrEMBL:Q757H3"
FT                   /transl_table=1
FT                   /translation="MGLLSYIRSAYEGDESEHTDLREMEKHIELCSSCDACSPEWEAEV
FT                   ARDTQVFARLKIEREASLYGTSKPASVHFVVPTSQMDWAHSACDERPGSVQQRVAAWVA
FT                   QQDAGPDGMPMRCSVSSQPIDILDVEVMRGHKNNVLILPHFIKLVGLTADRVEQVLDEL
FT                   LPLLRANDMPALLARPDIWECPEDSFIFLCSHTTRDKRCGITAPVLRKHICAHLQTHGL
FT                   YRDVSDARPHGCTVAFVNHVGGHKYSANAVIFLKRSRTMLWLGRVSPVHAEPIVKHLLL
FT                   PAVPQLPFPENVRCVRKYDF"
FT   CDS_pept        707007..708317
FT                   /codon_start=1
FT                   /gene_family="HOG000181587" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758046"
FT                   /gene_name="CSR1"
FT                   /locus_tag="AER041W"
FT                   /product="Phosphatidylinositol transfer protein CSR1 "
FT                   /biological_process="lipid transport"
FT                   /biological_process="phospholipid catabolic process "
FT                   /cellular_component="endosome"
FT                   /protein_id="AAS52725.2"
FT                   /db_xref="GO:0005768"
FT                   /db_xref="GO:0006869"
FT                   /db_xref="GO:0009395"
FT                   /db_xref="HOGENOM:HBG324518"
FT                   /db_xref="HOGENOM:HBG540797"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR008273"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="UniParc:UPI0001DB291A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757H2"
FT                   /transl_table=1
FT                   /translation="MTQTAAPGRVQTLTKEQEKVLKQVWVHLFQFWGIDVDGSAVLTAK
FT                   EPEPAAPSGKGRKLLGLFGKRKDATGAARKESNGKAAAKVYDAEKVEDSDAEKEKPTPQ
FT                   KVEGLEEMYELLKELDGAAVSKEFWSMLRCDYPDNLLLRFVRARKWDINKAMIMMAHSL
FT                   RWRLNEGKPEDIVFGGERGAQKADKKGIVKQLELGKATVRGFDKNGCPIVYVRPRLHHA
FT                   ADQTEAETSEYSLLIIEQARLFLKEPCDTATILFDLSGFSMANMDYAPVKFLITCFEAH
FT                   YPECLGKLFIHKAPWIFPPIWNIIKNWLDPVVAAKIAFTKTAADLEEFIPAEQIPLELG
FT                   GKDEYNFDGFVMPDGSADTKLSDEKGKAAVLEEREAIIKRFIDATISWIESTSDEESAK
FT                   WLEKKIDLSKELSENYSKLDPYIRSRSFYDVNGTLKV"
FT   CDS_pept        708514..710544
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929988"
FT                   /locus_tag="AER042W"
FT                   /orf_name="AGOS_AER042W"
FT                   /product="AER042Wp"
FT                   /protein_id="AAS52726.1"
FT                   /db_xref="HOGENOM:HBG059051"
FT                   /db_xref="InterPro:IPR012485"
FT                   /db_xref="UniParc:UPI0000252D8E"
FT                   /db_xref="UniProtKB/TrEMBL:Q757H1"
FT                   /transl_table=1
FT                   /translation="MLQSVTDPVQRLLDCTKETGPSQLRSVLSDLYERAPRHGISPAKI
FT                   LELIGFLCSAEFIAVSTRVYIVENCLIPNGYLSSSTVFEVLKHLGPSTPQNAFKLIVEP
FT                   AFQVALVKWLCHVLVIIPDYQKVLQRTYPIWFQLWMVDYLQDWTTYLLIWGTESKIQVT
FT                   EYRVRVLERIGSNPGYRNGKPLASFLLHKFLQLKPSKIVQHAIAELRCNAKRLMTVQKV
FT                   QLESKFMDGLQHVLSAGGVFESLQFKDSVNSQLNALKVLDDNNTNDTAQTPIGKQLTLE
FT                   QFANQIERMPCPSGHLNSLDINGYERLLLPLMAPEAKEALHLWLEYLLRTEGNPTTLKR
FT                   AMALLRAVDKTDIPFESLLLCDNFSSTDALKSLHMLYLVAEVPESNIIVNALLKSHKCL
FT                   RSGKSPYAPQFILGLCILVMCKISQGELSKFLLQICSTFLKTLVNMCLLGKEAPKTALI
FT                   LIHPLLYTLENAPSSAIPRDELTSVFVLPDIINSLVALNDPLVIALICEYLVSAKDRVK
FT                   GFTVDNSYVRKLNRCILDMANYLWRNKLFTEPYTWGLPKTFWAKISSNLYLPEPEIRQK
FT                   HLYSLPNFYPFRFISEEVLRRLEGQENTEVIYSKPLTEAGYRCWRKELELNGKTWLSKV
FT                   NNYDSFRKRLLMGIQEDSTYAGVPLFMQTYLKSFTESQAGS"
FT   CDS_pept        complement(710604..713225)
FT                   /codon_start=1
FT                   /gene_family="HOG000200747" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758047"
FT                   /locus_tag="AER043C"
FT                   /orf_name="AGOS_AER043C"
FT                   /product="AER043Cp"
FT                   /function="ATP binding"
FT                   /function="leucine-tRNA ligase activity"
FT                   /biological_process="leucyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS52727.1"
FT                   /db_xref="GO:0004823"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006429"
FT                   /db_xref="HOGENOM:HBG521010"
FT                   /db_xref="HOGENOM:HBG693845"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="UniParc:UPI0000252D8F"
FT                   /db_xref="UniProtKB/TrEMBL:Q757H0"
FT                   /transl_table=1
FT                   /translation="MRGFPGAWCKRSLNTASDAVDLVKVGQKWKSKVLSGVPQPAAEGT
FT                   RPHMYVLSMFPYPSGMLHIGHLRVYTISDALNRFYRMKGYEVVHPMGWDAFGLPAENAA
FT                   LERGIAPADWTRQNIARMKQQKGDMLAHFEWGREVTTCDPEYYRFTQELFLELWHHGMA
FT                   YKKEAEINWDPVDKTVLANEQVDAQGRSWRSGALVEKRKLNQWFLRITRFAHELSHDLD
FT                   GLDGWPAKVKAMQKHWIGEVEGTEVRLCTGDGEAIVAFTPRIEAVFGLQYVAISTEHAL
FT                   TKKMAERLPELCEFLQRPLVLSESDLSGFQLPGTYVQHPFAKDHGHRIPVFVSPYVPAD
FT                   GAGAVLGTPAHDEFDHKFWRANKPAEPVISSFEASGECDDECHIQTKGILNAKAGNLKG
FT                   ISSQDAKQVLADKLVATGDGRQTTQYRLRDWLISRQRYWGAPIPIIYCDSCGTVPVPKQ
FT                   DLPVMLPNIAGLSKKGNTLEHIPEFVNTSCPSCGGPAKRETDTMDTFMDSSWYFFRYLD
FT                   SHNQKEPFGYDKATRSMPVDMYIGGVEHSILHLLYARFISKFLASIGKWDGSACNGEPF
FT                   KRLVTQGMVHGKTFIDPENGSFLKPEELDMSNPADPIICRTGQKPRVSYEKMSKSKYNG
FT                   ADPAQCISKHGPDAIRAHILFQAPISDVVNWDETKIVGIERWLARIIKLAHTLAADSQL
FT                   KHGPVAKLTNMHEIALFNEVQKLLGSITDSFSRTLSLNTVISDYMKLTNLLDQALKNKD
FT                   INPAWLLTHFKKLVSVIHPTVPAVSEEAADIIKGHLQLLTWDHYVWPTVDAQQKDNSVG
FT                   YRVFVDGKMRFIYPAPSAFINDKNGVLKALLAHPDGGKYLAGRQVKNLILKKNIISLVL
FT                   QK"
FT   CDS_pept        713543..716854
FT                   /codon_start=1
FT                   /gene_family="HOG000141857" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758048"
FT                   /locus_tag="AER044W"
FT                   /orf_name="AGOS_AER044W"
FT                   /product="AER044Wp"
FT                   /function="ATP binding"
FT                   /cellular_component="chromosome"
FT                   /protein_id="AAS52728.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="HOGENOM:HBG059053"
FT                   /db_xref="HOGENOM:HBG202567"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="UniParc:UPI0000252D90"
FT                   /db_xref="UniProtKB/TrEMBL:Q757G9"
FT                   /transl_table=1
FT                   /translation="MTNDKRTIDDVDREVTSLLQEADEARERQAQNKRRKRFAPMTQYG
FT                   TDTVDGEDWEGTPAGYMKRITLKNFMCHEHFELEFGPRLNFIVGSNGSGKSAILTAITV
FT                   VFGAKASDTNRGVSLKSLIREGCGTARIAIVLANQGLGAFEQGVYGSEITIERTLKRDG
FT                   QSSHFSIKSENGREVSNKKRDLQRIVDYFSIPVLNPMCFLSQDAARSFLTASTPQDKFR
FT                   HFMRGTLLEEIDMNLAKAEEILRSSKSNLDYHGENMKALREDYEHAKRLFKEIYSTHDW
FT                   NERKKTLQGKLCWLNYKENERRLRKFKKRQEEISQKIVACDEKITERNLKIERYKADQD
FT                   STHEEVDQKMTSLQDHQIKFEEAEQELGQFREKHEVLKEERRKVEREIASLEVSLKAHR
FT                   QQVKQLEQELAEALGGSKEQMVTEKRQVDEEIKTLKGNLPSLEDKFQQCRDRELEYSHQ
FT                   RNTAIQQLQTSINLKKQEYRESTANRSQDSYAVYGRNMNRVVAEIRNRRHEFSKPPIGP
FT                   LGLEVSIKPGYEQWARSIQSIVGPSLGGFVVSTSRDNLLLRQILRKYPDTRNTSIVTYA
FT                   LTEFNYEHGKAHTAHPTISDVLGFSRRDLECLFVDQHRIETIILVDNKDDAYNVLKQSP
FT                   QNITRALSLKDNRSGFQSSLAPSGGFRLDTIEYQQHLLFARTSGNNNASDTQYLKAVIE
FT                   EEEGELRRIQTHYASLGSEIKEEGRKLEEQMRSIRSRIVSLELRSKHLKVKIEKEVDTG
FT                   ALDAHKAALNVETSQIAQHRGAIAAINDQLLQLKDEVEPYKRKHESARQLVAKVKEELE
FT                   DLKEMIRVRSHRIDKMTDDITIYNKKKVAYQEEFQSIQTNVDSFTPVLDSLREDAERHC
FT                   SEEVAYGSEIPNTEEEVRMEMRIADRHIKQAEKSVGMTQEEVARLLESTREKFYDAQEK
FT                   YSAVDRALWSLHESLEQRRITLMNNIKSTCREADSDFRTTIRVRNGFSGALNFDTPGAL
FT                   MVLVKTANDETPRNVDTLSGGEKSFSQITLLLSTWSTMRARIIALDEFDVFMDQVNRTI
FT                   GTRMIMKKFSTNIRTQTIIITPQDIGKIADIRDPGIKIHKMRDPQRRNNSDFYST"
FT   CDS_pept        complement(716959..720837)
FT                   /codon_start=1
FT                   /gene_family="HOG000094118" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758049"
FT                   /locus_tag="AER045C"
FT                   /orf_name="AGOS_AER045C"
FT                   /product="AER045Cp"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle fusion with Golgi apparatus "
FT                   /cellular_component="Golgi membrane"
FT                   /protein_id="AAS52729.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0048280"
FT                   /db_xref="HOGENOM:HBG059054"
FT                   /db_xref="HOGENOM:HBG203095"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR006953"
FT                   /db_xref="InterPro:IPR006955"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0000252D91"
FT                   /db_xref="UniProtKB/TrEMBL:Q757G8"
FT                   /transl_table=1
FT                   /translation="MDLIQGLIQPPKAPSVEATIPTLCERIESSTLLSDRRSAILGLKS
FT                   FSRQYRELVVASGLKPLIGTLKRDYEDEDSVKAILETLLILFLRGEGNEDLTRNWAAQY
FT                   SRLQGGKYPSPMLVKKQIEHFDQFSLWIADALTQGEDIVDLLVQLLETDSFHVRLYTIQ
FT                   LLGAIVTTRPEAGNRAIIAIPTGISTLVSLLDDVHDPIRDETVLLLTVLANNNSHIQKL
FT                   VAFENVFDRIFRIIADEGGMRGSLVVSDCLNLLSVILRYNASNQSLFFETSNLPHLGGL
FT                   LDEVLSDEEEFYWNEQRVTNLKTALSIVRRMVEPGNTTTPRHQQLFADTNILMIILRLT
FT                   FFYGTPNSIRPHALLTIADMVRGSPKIQAQLGNIDVPYWDPALPQVVPSSDPVVMPVLD
FT                   LLLRWILFANSIHTFDIRTAALELVKAYLVGNPELQETFLCAQIDLYKKQAEVLSTADQ
FT                   RTSIVAVLLGYDPHADLNPFKLFFSVDLLLFLFKSEDGNAKLRDLFRGIQDGDSAAGEE
FT                   VLSSVQTVVELSVASISSKESRIPISYLSFLIVLLFEDFHTVNEFLSNDSNVKSLLNLV
FT                   PVAQDEGITVKCLVVMLLGVAYEFCTSSSPLPRAQLYESLVATIGVDDYTSKIKQFKEC
FT                   SLFKEVVDSYFDPTFDETGLPKIYFSTYFSELFRENSYRIQSALSRSPDIDPNGKISFE
FT                   AFEELQQRFTTVNKELCELSSSSMEEIHKLELDLRKCQEQYKQLMKAKQESDTQVSDLD
FT                   EKLAQLKTQLDEANSKVEDLSTKKTTLEAAKADCLKKLASHEGQVNSLKNRTTQLEKQL
FT                   ATVSEQKSTAEAGINKMNRELFNLTKEKDSLTAVMNKLQKEGEKKLQEAEKEKVRITQL
FT                   LSQRDRDIENLRNELQDQGTQKKKLEDEHAGLLKEIADLKSQCASQDSLIPKLKEKLKT
FT                   LAESLKDTQNEHATLQKQVGNIQATSHAEITQLNAELQKLKDENVILISRKDELTQELE
FT                   KLQAQTAAGEKQTSDIALLNTQKSELSAKLSRAEKELVNQKAKAEGLFQERAELKDKLN
FT                   TSEKQLQESSQKLSNAQSELNEIRSRLKANEHDLITSRQEAEKLKKQNQQQSSKKDIHK
FT                   LDELSKEADSYKAQVSKLSAELESTMGQLQKSSVEQTDRIENLIKENKDLNTTIATLEK
FT                   EKKAQVVVNAHQENARANNKAVVDNKQKAKSQPATPLVNSKVQELEEQLEALQRKCSEM
FT                   ETLQKEVKELKENATQLESERDDLMLLVSDLDEKNQKYRSRLEELGHPVSSDEEDESEI
FT                   DDNDEDED"
FT   CDS_pept        721434..722048
FT                   /codon_start=1
FT                   /gene_family="HOG000065968" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758050"
FT                   /gene_name="RAD59"
FT                   /locus_tag="AER046W"
FT                   /product="DNA repair protein RAD59 "
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52730.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="HOGENOM:HBG059055"
FT                   /db_xref="HOGENOM:HBG203094"
FT                   /db_xref="InterPro:IPR007232"
FT                   /db_xref="InterPro:IPR016810"
FT                   /db_xref="UniParc:UPI0000252D92"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757G7"
FT                   /transl_table=1
FT                   /translation="MSDYTNVSWDNVTYYGGNGVALDELELKVSWHNRPASSWSVRRIG
FT                   ALQHKIEQYTFKIYHVNRYGKHSLSQVIPTHVLIQFANEAFGYNGWSSAVEEVLITDVK
FT                   QRERVRDGAAIELYTVTAEARVKLTLQDGTNTEATGLSKITLPSKGDAYGKAKKEASAD
FT                   ALKRCLLSFEGIVIEHEQKVASNYYTDGEFGSRKAGDKRDR"
FT   CDS_pept        complement(722152..726126)
FT                   /codon_start=1
FT                   /gene_family="HOG000188454" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758051"
FT                   /locus_tag="AGOS_AER047C"
FT                   /product="AER047Cp"
FT                   /protein_id="AAS52731.2"
FT                   /db_xref="HOGENOM:HBG059056"
FT                   /db_xref="InterPro:IPR006849"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI0001DB2936"
FT                   /db_xref="UniProtKB/TrEMBL:Q757G6"
FT                   /transl_table=1
FT                   /translation="MRNLVSLNKGSLQPSSEAHPNLGLYASCFDTLSDSVTCVLGAADV
FT                   GAIVVHQYMKSGAVRELASFFTQDYEDELVSFAHFADVNQLVFVFAHGDIMMATYGDEG
FT                   AGLDATVVEIVGSIEDGIAAAEWSHDEETLALVTGGRSVVLLSRQFEPVADIGLELDDL
FT                   KLSKNVTVGWGKKETQFRGKGARAMEREALQSLKASGLVGNELRDPTMPYMVDSGAITE
FT                   LDPRTVGISWRGDCEYFVVSTIETVQDPDDDSATLERRALRVYSRHGKLDSASEPVDGL
FT                   EHALAWRPQGSLIASIQRKVNVPGNESLDLVFFERNGLRHGEFETRLAIDERIKSLAWN
FT                   ASSDILSIALEDRIQLWTSKNYHWYLKQELYTECTKFVKWHPEKDFTLMYGDGDTVNVV
FT                   DFAYKMIRGPTFEPNDCGMTVVIDGRTVNITPFAMANVPPPLSYRDFDAPDNVLDAAVG
FT                   LSNTVFAAVTREALVVASIESLANMKSGRHPIIASTFQKHLFATELDTIRQVAFINDSV
FT                   VGILLDSGQLSRIALVNIQDPIQPELIKVVDTYTKVVLVKSSFDYSTLVYETRDGTVVQ
FT                   LDAEGGTVEITKFPQLVNDFCVKRILTDGKTEWQPAESKLVAFGLTSSGKLYADSVQLA
FT                   SAVISMDITDELLLFTSAQHYLQFVHLNTPEFKPLPTLEGDIMDERIRSIERGSILINI
FT                   IPSKAAVVLQAPRGNVETIYPRIMVLAEVRKYIGLKRYKDAFVICRTHRIHLDILHDYA
FT                   PDLFYANLKTFVDDIERVDYLDLFISCLVEEDVTVTKYKETLNMSTDAVFDVAPPPPTE
FT                   MEEYIKKKSFNPLKSKVNKICQVLLEVLLGTAQYKAKYLQTIVTCYACQNPPKVKDALA
FT                   LISQLRDEEAKDSTVTYLCFLQDVLFVYKEALALYDVNMALLVAQKSQMDPREYLPFLQ
FT                   NLNEQEPLRRKFMIDDHLKNYEMALTHLVGIDEPTGAVSDETREYIQQHELYKKALDLY
FT                   RYNTQLQNSVYAIYGAHLASKQEYNEAGIIYELLGNWEKAMEVFTMGNKWSPALAIASQ
FT                   HFPDRVLDIATELVDSLQYEHRYAEAAHVELKFMKNVRSAVSLYCKAYDYEQGILLCIT
FT                   EGTPELINELVDPALGDGFSVLAELLADCKGQINSQLRRLRELRAKKEEDPYAFYGQET
FT                   EEADDVSIAASETSTKESFFTRYTGKTGGTAKTGASRRTAKNKRREERKRARGKKGTIY
FT                   EEEYLVKSIGRLIDRLKQTLPDGVKLVDALLRRNMREQAYQVQKGFVSMEALLKANIVE
FT                   IYNISEKDRERIDDNGNVYQLPVIPVPEIPAFPVRQIIDY"
FT   CDS_pept        complement(726236..726619)
FT                   /codon_start=1
FT                   /gene_family="HOG000154459" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758052"
FT                   /gene_name="SWC7"
FT                   /locus_tag="AER048C"
FT                   /product="SWR1-complex protein 7 "
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52732.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG124840"
FT                   /db_xref="InterPro:IPR020195"
FT                   /db_xref="UniParc:UPI0000252D94"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757G5"
FT                   /transl_table=1
FT                   /translation="MEYKYNVTLLLLQVVLHRQQELAHQDKTLSQISLLREPVVDTAVL
FT                   ERFSAHRVVRLYAPELCGLRLEELQAVVREVFARGLAGSAEDTPVTLITLANHYYRLRV
FT                   QELELQELPKLKELMESAAGLRT"
FT   CDS_pept        join(726846..726849,726906..729475)
FT                   /codon_start=1
FT                   /gene_family="HOG000216640" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777011"
FT                   /locus_tag="AGOS_AER049W"
FT                   /product="AER049Wp"
FT                   /function="binding"
FT                   /protein_id="AAS52733.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG022193"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR021841"
FT                   /db_xref="UniParc:UPI0001DB2937"
FT                   /db_xref="UniProtKB/TrEMBL:Q757G4"
FT                   /transl_table=1
FT                   /translation="MDKSVIKGLNDKIYEKRKAAAQQLEKVVRDCVANEDHEMIDRIIE
FT                   ELYRDYAYALHQPMARNAGLMGLAAAAIALGNKYVAEYLNKILPPVLACFGDQNDQVRF
FT                   YACESLYNIAKIAKGDILVYFNEVFDVLCKISVDNDTSVKGAAELLDRLIKDIVSECAS
FT                   THVAAVNHDPKDIPTATTTDPQTGDVLQVDQNIYDKERPVLAFSLPDFIPLLSERIHVL
FT                   NPDTRMFMVSWLQVLESIPDLELITYLPHFLPGLFTYLGDTHNDVRMVTLALLNSLLHE
FT                   VERVTQLQASLLVQELQYQQQLDDVPGKKPADGALITERKKSLMNQLEQLSATENINEL
FT                   TKDNEDASSQNNLPDSMTSSTDPVKVPELRNGEVYHPGQDVHLDFPKIIEILINNLSCT
FT                   EPEIQSVVLNWLQTILRISPNNILPFLSKILSVLLKILSDSDPHISEMAKQVNARLIEL
FT                   TTKYDTTDKINYGPIVNILTLHFLDSNVTTKIACLDWLILTYSKNPQQLIDHDESTHLT
FT                   VLKSLSDKDPRLISKALELISDLCNGSNEAYIKKFLKNLLKLFKENDKLLKTRSNYIIR
FT                   QLCAKLSPERIYKTLSSIVEMDDDISFVRMVIYSLTTNLITSPELSSLRKKLRSGEDWA
FT                   FFVTLFKSWSYNPISLVSMCLVSENYELAYSVLQNYVDYDLTVNDLLQIDILVQFLESP
FT                   VFTRLRMQLLEPERYPYLHKCLYGILMVLPQSKAFEILNARLSSVSRLSTSVYNSNNTQ
FT                   KATESAIRASAQKKTQYQVLLDHFKSICEKERQNTPKQPTHDDHMLGLNDIFSTQSGSE
FT                   NKLKIHLSNGDENINGATDCDSVVFTGRVGANTASLAGIEGIGGS"
FT   CDS_pept        complement(729512..730699)
FT                   /codon_start=1
FT                   /gene_family="HOG000183078" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758053"
FT                   /locus_tag="AER050C"
FT                   /orf_name="AGOS_AER050C"
FT                   /product="AER050Cp"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS52734.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG202432"
FT                   /db_xref="HOGENOM:HBG738425"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000252D96"
FT                   /db_xref="UniProtKB/TrEMBL:Q757G3"
FT                   /transl_table=1
FT                   /translation="MSTIMYTCNACMIQFKSSDLQRYHMKTEWHRYNLKRRIADLPPID
FT                   ADIFTQKMQISEREKRLHEVDEFGFPVLKPVGHSGGRRRNTNGAILRGRRDGDGKKKAP
FT                   FRSDSPALSIASQMSKISVRSTDYDEHSASEYAFTDESQAESEDITDKEDAGEDGEERP
FT                   DVVDCVYCGVHCNTVAENLDHMSVAHGLYVPERRYLENAAGLINFLIERIVISKRCMCC
FT                   NFHGSSLESIRAHVASKSHCRIPYESKEERATIAAYYNFNEDQVADNTAVSDSESDPDL
FT                   SIEDTEEEDINSNYTIAHVDDTGVELTLPTGTRLGHRSMRRFYRQNLALPSTQADGTRT
FT                   LAVVDRRFAGGISANEYARNMKHSQLLASRAQSKNIKRQAKRDNFQKHYRDELLQ"
FT   CDS_pept        complement(730981..733314)
FT                   /codon_start=1
FT                   /gene_family="HOG000165026" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758054"
FT                   /locus_tag="AER051C"
FT                   /orf_name="AGOS_AER051C"
FT                   /product="AER051Cp"
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52735.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG270821"
FT                   /db_xref="HOGENOM:HBG330634"
FT                   /db_xref="InterPro:IPR007034"
FT                   /db_xref="InterPro:IPR012948"
FT                   /db_xref="UniParc:UPI0000252D97"
FT                   /db_xref="UniProtKB/TrEMBL:Q757G2"
FT                   /transl_table=1
FT                   /translation="MAGHSHRSSVKKGHKTFKSKHASKGALKRLHKGKVEQETAAGVKG
FT                   VRVVRKQDRKNAAKQLRQQKISSTSQLRRLFEGANGAAKIVAVIPLTPDVDAGDIVQRL
FT                   VQGCDEDVSGMQTPCVRDFRIGKFRSTLKVIVPDMGSFLSIMDAAKVADYVVLGLSGTS
FT                   EVDPVFGEQVIRVLELQGIASYMGVVSNLSKVHPKEKFQLDVKQSLESYFRHFFPTEDR
FT                   IYNLEKASDSLNAQRILCQQYPRGVSWRDSRGYLVAGSVDYVESGPDAGELVVDGTVRG
FT                   VGLHPNRLVHLPGLGDFQVSAIEKIAASSRSSEDNGEGSGVFLPDAQQDTLEEFAPHDL
FT                   DMEEWDDNQFEYDNLTSARYDDHGFLPGREQSLERAKVPKGTSEYQARWYVDNVVDVSD
FT                   DDAEDEMELEMGSNEVGTVADDTMMDAEDAQSDDASEADMATMVDEMFVDLSPEEEERQ
FT                   LQEYRAMEKDDLEFPDEIELDPSESAIERLKRYRGLKNLHNCVWNVDEQDPHCPSEWKR
FT                   MLRIGSYKNLKARTNKSVAAEASVVAGDKVRLRIRFPKHLLERLKDPRIAPFVVYGLLP
FT                   HEHKQVVANLSIQRWEEFEDPVPSGESLIVQYGVRRYTIQPQFSSASNVPNNVHRFERF
FT                   LHHNSASIATCMLPLDLTQSPAIYFKENPSDPKGLTFVGHGTFLNADHTRILAKRIILT
FT                   GHPFKFHKRVVTVRYMFFRPEDVEWFKSIPLFTKSGRSGFIKESLGTHGYFKATFDGRL
FT                   SAQDTVAMSLFRRVWPKTSLPWFY"
FT   CDS_pept        733815..733985
FT                   /codon_start=1
FT                   /gene_family="HOG000231300" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20624461"
FT                   /gene_name="RPS29"
FT                   /locus_tag="AER052W"
FT                   /product="40S ribosomal protein S29 "
FT                   /function="metal ion binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS52736.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG312140"
FT                   /db_xref="HOGENOM:HBG589144"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="UniParc:UPI0000252D98"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757G1"
FT                   /transl_table=1
FT                   /translation="MAHENVWFSHPRNYGKGSRQCRVCASHSGLIRKYGLNICRQCFRE
FT                   KANDIGFHKYR"
FT   ncRNA           734311..734501
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR34"
FT                   /product="AgSNR34"
FT   CDS_pept        complement(734590..737631)
FT                   /codon_start=1
FT                   /gene_family="HOG000161331" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758055"
FT                   /locus_tag="AGOS_AER053C"
FT                   /product="AER053Cp"
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="AAS52737.2"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG006464"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniParc:UPI0001DB2938"
FT                   /db_xref="UniProtKB/TrEMBL:Q757G0"
FT                   /transl_table=1
FT                   /translation="MIFLSSVQLRRFYTSHFIHRHLQVQSATRRSNLSPLFYSRSMSNN
FT                   ISGVSGLRELAATLEQPLLDDRKYRYIELPNHLRVLLVHDKNTDKSAASLDVNVGAFED
FT                   PEDLPGLAHFCEHLLFMGSKKFPNENEYASFLSKHGGASNAYTASQNTNYYFHVNHENL
FT                   YDALDRFSGFFSCPLFNESSTEKEIKAVDSENKKNLQNDMWRLYQLGKSLTNPIHPYHK
FT                   FSTGNFETLWSIPRSKGVNVRDELLKFYNRSYSANLMKLVILGREDLDTLAQWAYELFK
FT                   DVPNHGTKVPEYHAQAFTPEHLMKVIKVKPVKNLKSVEISFVVPDMDKHWQVKPARYLS
FT                   HLIGHEGTDSLLAYLKNNSWAIDLSAGATTVSEGNAYFSVNVDLTDEGVVQYEAVICAV
FT                   FQYINMLKEVLPQEWVFTELKDIGEAHFKFKQKGNPAATVSSLSKNLQKAYLPVQVILN
FT                   TSLMRQYEPGLIMEYLNSLTLENSRVMLISQKVETNLSERWYGTEYSVADYTKDFVSKI
FT                   RSLGANPALKIPAPNEFIATRFDVHKDEGNVKPLLEPFLLRDDRCGKLWYKKDDMFWVP
FT                   KGYIYISMKLPHTHSSIVNSMLCTLYVDHINDSLKDLAYNAECAGLEISLRKTNQGLDL
FT                   SLSGYNDKLLVLLARFFEGIQKLFLREERFMVLKQRLIQKLHNHLYDTPYTQIGRLYSS
FT                   LINERSWTTQEKLDITEQLTFDHLANFVPTIYEQMYFELLVHGNFSHEEALEVYDLVSS
FT                   LVPNEIRNSEGRNSKLRSYFIPAGGAYHYETALADKENVNSCIQKVIQLGAYSELLSAK
FT                   GSLLAQMVNEPCFNTLRTEEQLGYVVFSSKLNTHGTVNLRILVQSERSSSYLESRIDNF
FT                   LSKFGSTLEMMSDAEFEKHKDALCKTLQQKYRNLGEENDRYVTCIYLGDYNFLYKERKA
FT                   QLVRQLTKKEMLDFYQQTICSKQAASLVVHMQAQAGVQDSPADKVDGYPTGNAITDVGA
FT                   FKSQLYLAPIRAPIKKFEVTTPKL"
FT   CDS_pept        737957..738211
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929989"
FT                   /locus_tag="AER054W"
FT                   /orf_name="AGOS_AER054W"
FT                   /product="AER054Wp"
FT                   /protein_id="AAS52738.1"
FT                   /db_xref="HOGENOM:HBG049873"
FT                   /db_xref="HOGENOM:HBG059057"
FT                   /db_xref="UniParc:UPI0000252D9A"
FT                   /db_xref="UniProtKB/TrEMBL:Q757F9"
FT                   /transl_table=1
FT                   /translation="MARIRAYELITIGIVSAFGIYSGVNFFEPIVVNQLRQDGHLRQDV
FT                   EVPEFDADGNLLEQKLGAKTPAAPAPVSDGSATDGSKSH"
FT   CDS_pept        738431..740272
FT                   /codon_start=1
FT                   /gene_family="HOG000248034" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758056"
FT                   /locus_tag="AER055W"
FT                   /orf_name="AGOS_AER055W"
FT                   /product="AER055Wp"
FT                   /function="binding"
FT                   /protein_id="AAS52739.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059058"
FT                   /db_xref="HOGENOM:HBG203093"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0000252D9B"
FT                   /db_xref="UniProtKB/TrEMBL:Q757F8"
FT                   /transl_table=1
FT                   /translation="MAKSRKKLRSNKARVNPILRDAAKDAQVRSKRIQPLMQQLQSAAV
FT                   NDRQMALGSISVLCEDAHMRELFLREKLLQEVMSRLLTDDNTEIVVEAYGLLRNLCLEQ
FT                   GYDVAIYMWRSDIWVSISAGLEKLVESLSSLSSNAKASIESRRLLFDFGDNLISLVVAL
FT                   ADGASEIQEQLVAEHLPQLFHVITQILKYGFIVGDDSKTCTLKITTQLFNSVLDLIYDF
FT                   ASDSAAFMDALHGHPDLSQFVQTLPELNILNGSELTQVLVQGILLQLLDESITFQQAES
FT                   ILDRTCAAIQPIDLALMKHTLNTAEQEKELSSLKNTEEFSSMIRKQSDNTKKAMMQMQS
FT                   LELSLEIVTAVTELLASQVEQRREPLPGTLVNILKQVLPDFFNVLAEDFTSHVLMAWNN
FT                   LLWLFLSLEINVFELANEPWKQLWSCIYQAGNVDPRVRFGKLSCVWALLKAVQLQANPT
FT                   EYLDLLQVATVDFVQSIRREYDNAGDAGPEDQLDLRLRCCHVLFVLATFQQHIDVNREV
FT                   GLFFLHILSQKDTHPQLLVEVADHFIDIYSDAAFDYDHPNFVGLGFLDTLRKDIVPNLR
FT                   AAFKFVDKNKDPQLKAECHELFTTLGSFVAYKEGERS"
FT   CDS_pept        join(complement(740906..740943),complement(740412..740847))
FT                   /codon_start=1
FT                   /gene_family="HOG000233454" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758057"
FT                   /locus_tag="AER056C"
FT                   /orf_name="AGOS_AER056C"
FT                   /product="AER056Cp"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="AAS52740.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG492183"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="HSSP:1A3S"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI0000252D9C"
FT                   /db_xref="UniProtKB/TrEMBL:Q757F7"
FT                   /transl_table=1
FT                   /translation="MNSLCLQRLQEERKKWRKDHPFGFWAKPTKKEDGSMNLQKWEAGI
FT                   PGREGTIWKDGVYPITIEYPDDYPSKPPRVKFPAGFYHPNIYPSGTVCLSILNEDQDWK
FT                   PAITMKQILLGVQDLLTSPNPNSPAQEPAWRAYAKNLQEYEKKVLEQARRYAK"
FT   CDS_pept        741145..742083
FT                   /codon_start=1
FT                   /gene_family="HOG000115505" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758058"
FT                   /locus_tag="AER057W"
FT                   /orf_name="AGOS_AER057W"
FT                   /product="AER057Wp"
FT                   /cellular_component="peroxisome"
FT                   /protein_id="AAS52741.1"
FT                   /db_xref="GO:0005777"
FT                   /db_xref="HOGENOM:HBG203092"
FT                   /db_xref="HOGENOM:HBG389562"
FT                   /db_xref="InterPro:IPR006708"
FT                   /db_xref="UniParc:UPI0000252D9D"
FT                   /db_xref="UniProtKB/TrEMBL:Q757F6"
FT                   /transl_table=1
FT                   /translation="MTEAVDEYDDLDAYLDDGGKPEKEAEKKTEEEQKHGEQQQTRKSG
FT                   KFGAEQTGGTDAEVAEMINDLQTQFQQMLRPETDGADKDTVDNFRQLLETLGQAAPEAA
FT                   GAGAADAGAAGKESGQGSEDFKDIISNALGRLKVNSSKIDSKLEQEKKAQTSDDLLSQL
FT                   LEQMAGVDEGDGDGTMDGAILNILNQMSSKEVMYQPMKEMQLEFVQWMQGNAELEEHRE
FT                   KIATYRQQLDTVNAIVALYERADYSNEKYRGEITDLIDKLEQLGDSPVNKGFSNEGNQE
FT                   LNDLAKMLEVDGDDPSLGNIDKEIQETCKQQ"
FT   CDS_pept        745294..746022
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758059"
FT                   /locus_tag="AGOS_AER058W"
FT                   /product="AER058Wp"
FT                   /protein_id="AAS52742.2"
FT                   /db_xref="HOGENOM:HBG059059"
FT                   /db_xref="UniParc:UPI0001DB2939"
FT                   /db_xref="UniProtKB/TrEMBL:Q757F5"
FT                   /transl_table=1
FT                   /translation="MRSTTFVSSAALAVALYASQAVATPPACLLACAGKVSKESSHPLN
FT                   DVAHFCTKESDAMQKCFSSICPEGKAEGALSAFKANCAEHGKPVSSASSSSAASSSTAA
FT                   SSSAGSSSASATASSSAEKSSAAPSSSASSGAKSSAAPSSSAAPSASASASPASSAAPV
FT                   ASSAAPSASSAAPSTTVLTPTGTGHAASSATPSVPVVSASSSSASDVPPPIDHPFEGAA
FT                   NKVKAGMSLAGGLALAGLLL"
FT   CDS_pept        complement(746321..747613)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758060"
FT                   /gene_name="ART10"
FT                   /locus_tag="AER059C"
FT                   /product="Arrestin-related trafficking adapter 10 "
FT                   /biological_process="endocytosis"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS52743.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006897"
FT                   /db_xref="HOGENOM:HBG059060"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="UniParc:UPI0000252D9F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757F4"
FT                   /transl_table=1
FT                   /translation="MTTKITLKLNPPHNGRYYTEDDIISGSVVLKLAKATAVKQLRVIL
FT                   KGTSQTMTLAEADRHSSRLPQDPQTQYTKEKSTHILFHQGVQLLPPTGVEDSIKLGQDT
FT                   YKYGFEFRLAGGPKCVSGHQATSHSFLEDKAHEHYGEQLPPSFNDRHEGGGVTTEELFF
FT                   YNLGKVRYTVRAEADVATGNKWAPKSPLHDTMVISFLPLQCQAYVENACTSAGSDDTLV
FT                   NYTALPRTYRAAADVVLSDGLSVTPEVRSNALAYVHRLDYLFRESSGKFGNIFMVFSGD
FT                   PTKHSVKLTRLVLSLHEKVSFTANGHTNKNLSQLKLMDTPLDDELQLRDLHILEDGSRE
FT                   GKLNLGDHPVLSRLRFNEEDYIHRGNTLFSFTTCNIKREYYFQLDLHWKVDATAVRSEI
FT                   IVDPVTVYAESAPPAFEGLPPYPEKPPKYEA"
FT   CDS_pept        747947..748765
FT                   /codon_start=1
FT                   /gene_family="HOG000001141" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15759127"
FT                   /gene_name="ATP10"
FT                   /locus_tag="AER060W"
FT                   /product="Mitochondrial ATPase complex subunit ATP10 "
FT                   /biological_process="mitochondrial proton-transporting ATP
FT                   synthase complex assembly"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS52744.2"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0033615"
FT                   /db_xref="HOGENOM:HBG059061"
FT                   /db_xref="HOGENOM:HBG202573"
FT                   /db_xref="InterPro:IPR007849"
FT                   /db_xref="UniParc:UPI0001DB293A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757F3"
FT                   /transl_table=1
FT                   /translation="MVIWRRYLSGTAQPLVFKKMNKALAQAAPREHVVRRLEQPVGMPQ
FT                   PPTAATRYVEGNSMLDMFSEEKTSRRAAELAAEFSKSGLYDAATFRKTNGRVFLPPASY
FT                   WRAEHARYFPHLGGRTLTGARGSVEDVLAGKVSVVKVFSCETGEGLASSYFRHEGHDYL
FT                   REDDVAPAQIVEISLTESWIKDWLVRLMAGRLRSLVPAARHERYFICRRAQLPFTVRES
FT                   LELGNLYTGYVLVVDPQLKIRWMACGGAEKRDAELLWKCVRGVQRECAAV"
FT   CDS_pept        complement(748897..750174)
FT                   /codon_start=1
FT                   /gene_family="HOG000019858" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15759128"
FT                   /locus_tag="AER061C"
FT                   /orf_name="AGOS_AER061C"
FT                   /product="Isocitrate dehydrogenase "
FT                   /EC_number="1.1.1.42"
FT                   /function="NAD or NADH binding"
FT                   /function="isocitrate dehydrogenase (NADP+) activity "
FT                   /function="magnesium ion binding"
FT                   /biological_process="isocitrate metabolic process "
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="AAS52745.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004450"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0006102"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="HOGENOM:HBG020077"
FT                   /db_xref="HOGENOM:HBG596047"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="InterPro:IPR004790"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="UniParc:UPI0000252DA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q757F2"
FT                   /transl_table=1
FT                   /translation="MLGRGRMLGRRLFSGSRAAARIRVKTPVVELDGDEMTRIIWERIK
FT                   QQLVLPHVDVELKYYDLSITSRDATSDQVTVDAAHAIKQYGVGVKCATITPDEARVREF
FT                   GLKKMWRSPNGTIRNILGGTVFREPIVIPRIPRLVPGWEKPIIIGRHAHGDQYKATDAV
FT                   VPGAGTLDLVFRPADGSAPTSLHVYDFAGPGVALAMYNTEESIRGFAHASFRLALAKQL
FT                   NLFLSTKNTILKQYDGRFKDVFEELYQAQYKAEFERLGIYYEHRLIDDMVAQMVKSKGG
FT                   FIMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHFRQHQAGK
FT                   ETSTNSIASIFAWTRGLAKRGELDNTPDVVNFAHALEAATTNTVQLDGIMTKDLALACG
FT                   RSDRSAYVNTNEFIDAVEARLKKELA"
FT   CDS_pept        complement(750338..750553)
FT                   /codon_start=1
FT                   /gene_family="HOG000001142" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15759129"
FT                   /locus_tag="AER062C"
FT                   /orf_name="AGOS_AER062C"
FT                   /product="AER062Cp"
FT                   /function="cytochrome-c oxidase activity"
FT                   /protein_id="AAS52746.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="HOGENOM:HBG191345"
FT                   /db_xref="HOGENOM:HBG398789"
FT                   /db_xref="InterPro:IPR004202"
FT                   /db_xref="UniParc:UPI0000252DA2"
FT                   /db_xref="UniProtKB/TrEMBL:Q757F1"
FT                   /transl_table=1
FT                   /translation="MFQQVTRLASRRAFSSTVRRQAHYEEGVYSNIPMKIHNRRIPYAV
FT                   LHFGFFALGFSLPFVAVYVQFKKAGL"
FT   CDS_pept        750765..750947
FT                   /codon_start=1
FT                   /gene_family="HOG000199609" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20624709"
FT                   /gene_name="COX9"
FT                   /locus_tag="AER063W"
FT                   /product="Cytochrome c oxidase subunit 7A "
FT                   /EC_number="1.9.3.1"
FT                   /function="cytochrome-c oxidase activity"
FT                   /biological_process="respiratory electron transport chain "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial respiratory chain "
FT                   /protein_id="AAS52747.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0005746"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022904"
FT                   /db_xref="HOGENOM:HBG053624"
FT                   /db_xref="HOGENOM:HBG736151"
FT                   /db_xref="InterPro:IPR014368"
FT                   /db_xref="UniParc:UPI0000252DA3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757F0"
FT                   /transl_table=1
FT                   /translation="MSAIAPITGSLKKRIMKDIAVGMGLGTVLGSYWWWGFHKPKIAAR
FT                   ENYYTQLAEQKAAEE"
FT   mat_peptide     750768..750935
FT                   /gene_name="COX9"
FT                   /locus_tag="AER063W"
FT                   /product="Cytochrome c oxidase subunit 7A "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757F0 "
FT   pro_peptide     750936..750944
FT                   /gene_name="COX9"
FT                   /locus_tag="AER063W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757F0 "
FT   CDS_pept        complement(751009..752955)
FT                   /codon_start=1
FT                   /gene_family="HOG000001143" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930245"
FT                   /locus_tag="AER064C"
FT                   /orf_name="AGOS_AER064C"
FT                   /product="AER064Cp"
FT                   /biological_process="vesicle docking involved in exocytosis"
FT                   /protein_id="AAS52748.1"
FT                   /db_xref="GO:0006904"
FT                   /db_xref="HOGENOM:HBG059062"
FT                   /db_xref="HOGENOM:HBG202575"
FT                   /db_xref="InterPro:IPR001619"
FT                   /db_xref="UniParc:UPI0000252DA4"
FT                   /db_xref="UniProtKB/TrEMBL:Q757E9"
FT                   /transl_table=1
FT                   /translation="MSVDLNTRKLEKQVKERLFEQLNQCTRQDPILLLIQPSLVPYINA
FT                   LCTFSELTKHTRVNVIMTLDESCLGNLLSMDVGLTKLVVLLDVRSDLKVPDQLHEIIRG
FT                   LSLRKLDVISASWKEHTEIEEAKVFPDYLQLQLDEVALRVHKWCMLPVCYLDDDFLNCN
FT                   VLMTSDGQNLYYPATPSLAGTTRNVLVNHLKESLVSLCLENDITITHSVALGPNSKRLV
FT                   DALQTDLRDLVTQEAQAQQKVLYGKRHSGLQTDLIVFERQIDNMTPLLSQLTYVGMLND
FT                   VFTFTADSKLQDLRVGDVLENPEDQRAVHLDYKEDGVWNELKYVNFGAVGTKLNTWAKE
FT                   LKGQYDARHQVETVGEIKRFVSGLGDLQQRQKLLKLHTGISSKIMEHVNHGAIFQQLIE
FT                   TEQDFCMNNLDNRASCERILDLMYSGAPKDVVLRLCCLLSLTKNGIRDREFLTLKTEIL
FT                   DAFGVEVLPELERLTAHGLFLSKTVFPARSAVKDFQTLAAWYDLCPQLDRPIDPLDPRE
FT                   PTFTLCGVIPLSVRILQSLYDRSVALQHYSSQQPFVISRAPSLARLEPLFAAQYGRDTA
FT                   HQRVWDRSADPATIAVGAPGRAPDLALLVFVGGVTPAELATVAFLQRALRAKNVRKRFV
FT                   VLADGLLRAAPPV"
FT   CDS_pept        complement(753168..755492)
FT                   /codon_start=1
FT                   /gene_family="HOG000223225" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18930246"
FT                   /locus_tag="AGOS_AER065C"
FT                   /product="AER065Cp"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="AAS52749.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniParc:UPI0001DB293B"
FT                   /db_xref="UniProtKB/TrEMBL:Q757E8"
FT                   /transl_table=1
FT                   /translation="MAPKASGGVGSGTKKKAGSDTNSEKKTSSKPKLPALYITRPVGND
FT                   ITKRSTVAVLSPEVLQASEFRVGEICLVAKEGQRGVAAIIQSGSEDQPAAVVQLAAPLR
FT                   AVGGVLLGDRVTVRKLPVQPSYATNVTVASLEGHVLGSGTKAIEKLLNDAGIIMPGQIF
FT                   KDVLLDESSGLRGNIVVTDINSNADLADEVAKLAVTDSADVDVCLSPPGLFLKGKTTVF
FT                   YSQSHQVHQRFRLPQRINYQSVGGLSKEIQQLKETIEAPLCDGEFYHECGVEPPRGILL
FT                   HGPPGTGKTMLLRCVANENDAHVQIINGPSLTSKFLGETEERLRAIFDEARQFQPSIIL
FT                   IDEIDSIAPSRDSDDAGEAESRVVATLLTLMDGVDSSGSIVVVATTNRPNKIDPALRRP
FT                   GRFNVEVEIGVPDAAARLEILMKQVSRMAESRRGFTDQDIAEIAAKTHGYVGTDLSGLC
FT                   ALAVGKSKHRAVKQEIPLSQVKISLCDFEAALLEVKPSAMREIFLETPKVYWSDIAGQD
FT                   QLKREMEEVIELPLKGAEKLKRLRITPPKGILLYGPPGCSKTLTAKALATESGFNFFAI
FT                   KGPEVLNKYVGETERTVRELFRKAKVAAPSIIFIDEIDELAKTRDEDAGSSAAANVLIT
FT                   LLNEIDGVEELNGVVVVAATNKPHIIDSALIRSGRLDKHIYVAPPDFEARLQILRNNTR
FT                   TFGLDDPDAILKRLAEQTAHCSGAAVAQLCRDAAIAATREDYEGGNVEERHFLEALPRL
FT                   TRDVTPDVLLPYQTFAEKRGI"
FT   CDS_pept        755657..756337
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15759130"
FT                   /locus_tag="AER066W"
FT                   /orf_name="AGOS_AER066W"
FT                   /product="AER066Wp"
FT                   /protein_id="AAS52750.1"
FT                   /db_xref="HOGENOM:HBG059063"
FT                   /db_xref="UniParc:UPI0000252DA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q757E7"
FT                   /transl_table=1
FT                   /translation="MVLVLPTIICKDAIKLFSAQAARKACKKKALELSNRPAVDEQSLK
FT                   LPKGCLQKDMVKLRNIFELMGGPQAGLRVVKAEELRKCLYIDRTIPINIDTMPAPVTVT
FT                   DLKIAGEKLLSGEIVAWRERIRKSVQSPYLVLPPFLSDNTKHPKLLEFFLKKAQLKEIA
FT                   RVRTPALHIKAQMMRQYDRYVFCSMIGYFYLTNDRETMQRFLDESITKRLFRYILAEPQ
FT                   LSRY"
FT   CDS_pept        complement(756351..760199)
FT                   /codon_start=1
FT                   /gene_family="HOG000163048" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081543"
FT                   /locus_tag="AGOS_AER067C"
FT                   /product="AER067Cp"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="AAS52751.2"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG346461"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012961"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR016438"
FT                   /db_xref="UniParc:UPI0001DB2955"
FT                   /db_xref="UniProtKB/TrEMBL:Q757E6"
FT                   /transl_table=1
FT                   /translation="MYLDSDITSKLSEYTQGWGNMASTATDDLDQLFASLRLLDEHSSP
FT                   RHKVPVPRHDTVNYQEQLKSKYASQSNVLSWPLLDLLQDVPQAAANGSKANAHGSGDVY
FT                   DYEDFVQLPEHISRMSYRFKRKGLRGEIASYKEEVDLVEVANANAANSLLLTRKVDHRA
FT                   NAIKGSTSQLPFTPGGISMTTMKLQSNISETGVATSRLHRDADGLFDIPQGFDRGIMLV
FT                   DNPEEGAEQVVDLHSLDQVDTELANKQELEGIKKHKEQELAVGGTGSMLWKPAAGAERN
FT                   LADVDDLLPVGIEFGRTIHDRNKVPLKHEWAHVVNLSHTLENLDELVPNPARTWPFELD
FT                   IFQKQAIYHLEQGDSVFVAAHTSAGKTVVAEYAIAMSTRNMTKTIYTSPIKALSNQKFR
FT                   DFKEDFDDVSVGLITGDVQINADANCLIMTTEILRSMLYKGADLIRDVEFVIFDEVHYV
FT                   NDQDRGVVWEEVIIMLPSHVKFILLSATVPNTFEFADWIGRTKHKNIYVLSTPKRPVPL
FT                   EINVWAKDTMIPVINENREFLAKNFSKHADLLANSGSSNTAKKTASTRGNKAPTRGDKA
FT                   NKVITKGSRGVGAKGSNRSSFFKRDGPNKQTWPRLVNYLRSRDLLPVVIFVFSKKRCED
FT                   YAGFLEGTDFSTAKERSQVYMFIEKSIARLKKEDRDVPQIQQVRSLLERGIAIHHGGLL
FT                   PIIKELIEMLFAKGFVKVLFATETFAMGLNLPTRTVVFSEIEKHDGNGLRYLSPGEFTQ
FT                   MAGRAGRRGKDKVGTVIVMSYNHPLDVTSFKDVTLGVPTRLKSQFRLTYNMILNLLRIE
FT                   ALRVEEMIKYSFGENTKQNLLPEQELKVKALREKLNESPDVNCMHCSQILDKAVELTTR
FT                   HRDSIRGIITEANSRNILFGLLRQGRLIVYRDSDNNAKLGFVFRNDASSNRCVVVSFTK
FT                   PCCLSDGKPNNLPYLTICRRFVKKAFQPLKLAPATMESVPFENIELISRYHLNVSLADL
FT                   LNGDQKAKDAFQEKIQTVLHIAPKLKPADMDKHITLKIQQHLSDHATVVKEFMELDACK
FT                   CPKFAEHFAVRYSKYKIEQEIADVVHLMSEQNLTLLPDYEQRLAVLKECGFIDSSNNVL
FT                   LKGRIACEINSGFELALTELILDNFLGDFEPEEIVALLSAFVYEGRTKEEMPVVITPRL
FT                   AKGKERIEQIYSQLMSTYETYQVPLTKDEAEFLEKKRFAIMNVVYEWARGLSFKAIMQI
FT                   SPEAEGTIVRVINRLDEVCRELKTAAVIIGDSNLHMKMTQAQELIKRDIVFAASLYL"
FT   CDS_pept        complement(760666..762573)
FT                   /codon_start=1
FT                   /gene_family="HOG000248774" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15759131"
FT                   /locus_tag="AGOS_AER068C"
FT                   /product="AER068Cp"
FT                   /protein_id="AAS52752.2"
FT                   /db_xref="HOGENOM:HBG435109"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="UniParc:UPI0001DB2956"
FT                   /db_xref="UniProtKB/TrEMBL:Q757E5"
FT                   /transl_table=1
FT                   /translation="MTEMEQPMLQQHTGVGNVHTAVGQSRTGGEGLALKDEAAVSAATT
FT                   ASSTLAEGPEEGGRAAAPPPEPDMTQLPAEPMPKHQQKHAQTSIKAVKRLKDAKPFLQP
FT                   VDPVKLNVPHYFQHIKRPMDLSTIERKLAVGAYETPEQVAQDFNLMVDNCAKFNGASSV
FT                   IAQMARNIQASFEKYMLNMPPRDQPVQPRKRRKSSEEAAVVIRRAETHTGRPKREIHPP
FT                   KSKDIYPLENAKPQSKKHQTEMKFCQQVLKELTAKKHASFNYPFLEPVDPIALNCPSYF
FT                   DYVKEPMDLGTIGKKLGNWEYADYDDFERDVRLVFKNCYAFNPDGTLVNMMGHRLEDVF
FT                   NSKWADRPIVADEDSDEGEDDSEYESDVPYTEEDIDESLITNPAIQYLEQQLARMKVEL
FT                   QQLKRQELERIRKERRLARGLSNGGSSSTGRRKRSRTARKKGGAGAAAAAGGSSGGGAG
FT                   LGNGSGGSGLVKKKRKLKTVVTYDMKRIISERIGDLPEAKLERAVDIIKNSMPDIVGAD
FT                   GEVELDIDQLDDTTILTLYNTFFRQYGAPSSSVAEDELRTNSLSPPSAASSKANKRRRS
FT                   KALSEEEQNKQIEKIKNKLAILDSASPVSPNLLGLLSGNNEGSSEDDDDDDISSESEEE
FT                   "
FT   CDS_pept        763090..763596
FT                   /codon_start=1
FT                   /gene_family="HOG000204790" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777279"
FT                   /locus_tag="AER069W"
FT                   /orf_name="AGOS_AER069W"
FT                   /product="AER069Wp"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS52753.1"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG489199"
FT                   /db_xref="HOGENOM:HBG717354"
FT                   /db_xref="InterPro:IPR008417"
FT                   /db_xref="UniParc:UPI0000252DA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q757E4"
FT                   /transl_table=1
FT                   /translation="MSLYYSLVFAMLVCESAVFALLAVPLPMAVRRPLTRALARPFESA
FT                   TVQMVLKVLLGFVLLLFVDTTNRLYVVNREYERARHVEFAHGRRELLSRKFLAQRNMYL
FT                   TGITLFLTFMLGQTFNLVLELLALKGATERPGATTAAGLRAEIEECEKELARLKAQADA
FT                   LAEDM"
FT   CDS_pept        complement(763613..765556)
FT                   /codon_start=1
FT                   /gene_family="HOG000240610" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19777280"
FT                   /gene_name="DUS3"
FT                   /locus_tag="AER070C"
FT                   /product="tRNA-dihydrouridine synthase 3 "
FT                   /EC_number="1.-.-.-"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="nucleic acid binding"
FT                   /function="tRNA dihydrouridine synthase activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52754.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0017150"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG014348"
FT                   /db_xref="HOGENOM:HBG521382"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="UniParc:UPI0000252DAA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757E3"
FT                   /transl_table=1
FT                   /translation="MSSTEGGAKRVAEDGSEVSEAKRVGRIEGVAQLKPEYVVAGAAQL
FT                   RAAESDEELTSERMVEPEGGTRKKSKKARGQNKNRDNRQAKEEHQLCPRLAQGNADACA
FT                   FGAQCRYLHDVRTYLEHKTAEIECPQFTGCPVFAATGRCPMGFKCRFLSSHCNMETLEL
FT                   ATTPEDERAKLWSVNHEVNHIASDRKLDLVKRRAPFPRSEHVLEIIDAIQQEFRDEMQG
FT                   AAAAPEGAVAEVPQVQQREEQLSNKRARQRELYAQYHETRYFAQEKKPLDLHHKKIVSP
FT                   LTTVGNLPFRRLMRQLGADVTYSEMALAVPLIQGTNSEWALPKAHCSELPGFGVQLACS
FT                   KPWQAAKAAEALADNVGDGLSEINLNSGCPIDLLYRQGSGSALLDNPARMIRCLNAMNY
FT                   VSKDVPVSVKLRTGTRDGHPIALGLCKRLVMETDVAAITLHGRTRQQRYTRSADWDYVG
FT                   QVADALRSYETERAEKLKDREGKLRIQFVGNGDCNNWEDWYRHLENENVDSVMVARGAL
FT                   IKPWIFEEVDARQYIDKSSSERLEILRDYARFSMDHWGTDEYGIALCRRYFCEFMSFFH
FT                   RYVPMGICERYPVLLNERPPNWRGRDDLETLLGSTDAADWIKLSEQFFGPTPDKFVFQP
FT                   KHKSNSYAPSVQ"
FT   CDS_pept        766224..768077
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081544"
FT                   /locus_tag="AGOS_AER071W"
FT                   /product="AER071Wp"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS52755.2"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059064"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001DB2957"
FT                   /db_xref="UniProtKB/TrEMBL:Q757E2"
FT                   /transl_table=1
FT                   /translation="MDVTTATSTTPNIYITEAQPGHQAGGGHAAHPVQHHLGTQQHQHQ
FT                   MAKFRRESIAHSQGMGGVSWGSLTVGSWLKDEVMIHAHTKDGFNSNLAASNMVSFASPP
FT                   SSSGSYLPNLEKQYCKDYSCCGQLLPGLHDLLRHYEEAHIATSPGYVSIAGGASLTNSM
FT                   ATHALQGSGMARKKVGNLSQPHQTQHSQPTQHSQQQQPTQQQPTHAWVAQHSAVQASHG
FT                   ASHNIQPRYGHPGSHHAELQQQQVQIPNQHHHRQALNTGAQIHAQSGMGSSQQQLHLNG
FT                   NLVDAVCTNDVFLQTNNVNNAVAAAGAGAAAPSVSKIGMSSGKGLGSGMLHSKANKRNS
FT                   QQPQQMNFNNYSLQMNASRNNSGTPGLQQQVQSRLMQKRSAINSAAAGVDLDFMDQDMI
FT                   DEFNPDSGATLMGMQHLGTLVDGPSVLTGHISAHTSSQTQGMVKKKQPRSMNSGGNSAG
FT                   TSSALGKRSSSALTASSSGRHSMSSDDDDDDDDDDQDDDLDEDEPPGKSRKQQGYIDDP
FT                   ARRLYVMDHEEHKPFKCPVIGCDKTYKNQNGLKYHKTHGHQNQKLHENPDGTFSIIDPE
FT                   SNEPYPDGMGFEKDKPYRCEVCGKRYKNLNGLKYHRGHSTH"
FT   CDS_pept        768675..769460
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624710"
FT                   /locus_tag="AGOS_AER072W"
FT                   /product="AER072Wp"
FT                   /protein_id="AAS52756.2"
FT                   /db_xref="HOGENOM:HBG059065"
FT                   /db_xref="UniParc:UPI0001DB2958"
FT                   /db_xref="UniProtKB/TrEMBL:Q757E1"
FT                   /transl_table=1
FT                   /translation="MQINVLWPLQWVPWATYAAVILWVQVVVILPLATVLWQDFYSQLL
FT                   PSESHFERQLRPVKAPASAAGSVNYMWSMELWRQTVSPQDVTSTPPSAGHEQLAVQSGI
FT                   PYLLVIDLQLYCFDQEPIHVVTVEVAAHTEYFTVTCFPSVEHAMRSPWTAQPLATRIQH
FT                   EFENRLQLPDILLSADTRMVNVTIQSTARLRFGHRSAYSLSMQVGGIRYAMLHWYRTCH
FT                   ILGTTLFVGVISAWFYISFSIAFMVIGFLRGAGAKNTKS"
FT   CDS_pept        complement(769776..772937)
FT                   /codon_start=1
FT                   /gene_family="HOG000184673" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15759132"
FT                   /locus_tag="AGOS_AER073C"
FT                   /product="AER073Cp"
FT                   /protein_id="AAS52757.2"
FT                   /db_xref="HOGENOM:HBG059066"
FT                   /db_xref="InterPro:IPR013887"
FT                   /db_xref="UniParc:UPI0001DB2959"
FT                   /db_xref="UniProtKB/TrEMBL:Q757E0"
FT                   /transl_table=1
FT                   /translation="MVESTGRDVGMLQSLQRFVTMISGGAAASNKNVAFFLRLNLLTQL
FT                   RQLQSGPGGHEGRGQRDALVQWWITLLNYLNSDLNGGRHHTPAAETVSVALECISRVVT
FT                   VLMPRAGDEARDFEIYAHHLLLTVHYITNRLVDNSKRRKVVAQNAQLPAAQIKATLLYV
FT                   QAYNGLLRAFMGKVIAYAYMYLPAAMRYDVQVLRFLVGNVVAVPLTRNEVVPWKPVRFE
FT                   LEDEATSQQMSPKMVGNEEDLKIFQVMISYLQNDQVFSTFYWHYWYILLQLHLSAGQNG
FT                   ELQLGGCPGVLLLLDHVGNSLSRDLSKFAQYMRTQDLKEPSLAQGNSSAALATRLNNMP
FT                   LTVASDKLNSFVYTKFQSVKIWECLRNLVGCFRRLTRTSADQLLHRLIQEHDVRLLEAT
FT                   SKIPAYDSVVGNLVYNKLLQFIVFQFAGSQPSFLQDLNWTGWIKGLEGMLCTLNSNCQS
FT                   IALLCLFNIWDAIPTPQRRAIQDILLSDLWHRLAIETEFHIVRILFMKLLVFRVVPDDE
FT                   LDSSLLRTNLSMVHESAKDLSKKITVDTDCMDIKNILAFNGNKKLTLISNNPVTEEALI
FT                   LEERKKYETNANTAQQQPVIPPSFPMVSTLSNVRPSVVLLKGKYPFDVFDEMVSRAALI
FT                   LADKKVREKMNEEKQGVSRRSSWHSNDDNNEHVASSQSTPSAWHSIISKLSSYHTHSSS
FT                   TSALPSQGHASTRGMRSRTEEMLCSDSLDVESGELLSMYSNNSQVSNLTNSSEDHADPS
FT                   KRYSYGGRGVSQLKNCSQESLPSTQSKKRKLLAPPELKYSSSVTEKDKITHIFRLTMTQ
FT                   TPSAAGSFANLITKLREANEKWGVKAHVEKPLPYDKPLPSSPEMPGTKDYTLIDGFDFN
FT                   SLSSSIMGDIQQISDLTSQSMATNKSTPSLISIPTDGVPEPNWGFLSIFGRKRSPSADD
FT                   VDTLGNLTITDSKLVPENDTVHFTPEVSVEPSCGSNASLVPGLELSMEYTENVTPEDSI
FT                   KRGHTVSMFQRTRLQKFLRIILTYNATVQEFFTFVDCVNDTCEVGNIFMDFDVGQQANR
FT                   HLRPN"
FT   CDS_pept        774205..776136
FT                   /codon_start=1
FT                   /gene_family="HOG000095255" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15759133"
FT                   /gene_name="BRE1"
FT                   /locus_tag="AER074W"
FT                   /product="E3 ubiquitin-protein ligase BRE1 "
FT                   /EC_number="6.3.2.-"
FT                   /function="ligase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin modification"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52758.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="HOGENOM:HBG059068"
FT                   /db_xref="HOGENOM:HBG203087"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013956"
FT                   /db_xref="UniParc:UPI0000252DAE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757D9"
FT                   /transl_table=1
FT                   /translation="MEEPAAKRPKLSDRSEPLTQRDVVLFQKEALFRQLNRYRAEARAG
FT                   QVQVEELRRAHGQVGERLAAVCGVVRSVARAVADARGDGDARALCERVAGGDDDEVVAR
FT                   AAEFAAVVAGGLGRGAAAGEGWHRLEAVNSRLAAENAQLAAELGAVRGFYAELLRRYDR
FT                   DESETVRRVFKVEESEPPRAATPVEESSAKGAASDGEAATAVVEREMQIEELQTEIRVL
FT                   EDTVAQLTDWKRLNEQELTKLRQMASSAELSQRHPTPPSSSNLSADLQVLRSKVEKLSH
FT                   ENKELAQLNEAYLGKFQQLSADREIFNNRLSAEFQTAQETLKKHNSNLEKDLVRIRTAR
FT                   DELLSKVAVLEAQKSKSDMLEDLEKMLALQQEQLKALSEHKPEPARDAVMKELQDLEKA
FT                   FKELSQYSNKKYSEYVNQESLMSKLTVEKTKADQKYFAAMRSKDSILIENKNLSKNLSK
FT                   SNELIQQLKDIEKSLQAKIENLNKQLHISRINEKRLLDSNKTTSLKIMDLTSQLSKANK
FT                   SSTLVQQECNKLIEEKAKMESKLNDLEIETKNLATKLTYQENKSKKLHKTLVSNGGDNG
FT                   ALAEELENFRTVVYCSLCSKNWKDTVIKTCGHVFCADCCKERLAARMRKCPTCNKGFSS
FT                   NDLLVVHL"
FT   CDS_pept        776506..777564
FT                   /codon_start=1
FT                   /gene_family="HOG000203649" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777281"
FT                   /locus_tag="AER075W"
FT                   /orf_name="AGOS_AER075W"
FT                   /product="tRNA-dihydrouridine synthase "
FT                   /EC_number="1.-.-.-"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="tRNA dihydrouridine synthase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="tRNA processing"
FT                   /protein_id="AAS52759.1"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0017150"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG058012"
FT                   /db_xref="HOGENOM:HBG738405"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="UniParc:UPI0000252DAF"
FT                   /db_xref="UniProtKB/TrEMBL:Q757D8"
FT                   /transl_table=1
FT                   /translation="MPTVPSFIPKPKKLTPENDPLHIIKTRRITHNRPATIAGPMVRYS
FT                   KLPFRQLCRHFNVDIVYSPMILAREFVRNEHARMADFTTNSRDTPLIVQVGVNNVVDLL
FT                   RFVEMVSPYCDGIGINCGCPIREQVREGIGSALIYNQPLLCEMVRAVKEKYKDTVRLET
FT                   KIRIHDDLAQTVTLCNALASAGVDWITIHGRTRTTRSSVPANIAAIRYIKEHITDKELP
FT                   IVANGDCFTLDDCHRIAAETGADGIMAVRGLLANPALFSGYKTCPWHAVELLWHYAMEF
FT                   GTLPYQLLQHHLHCMLENMGADKTLLKQMMDIKNFCELIDWFDEHFVLRRKSQEELSDI
FT                   PDIPYRHRAPRP"
FT   ncRNA           777956..778010
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR63"
FT                   /product="AgSNR63"
FT   CDS_pept        join(complement(778497..778553),complement(778134..778421))
FT                   /codon_start=1
FT                   /gene_family="HOG000216660" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15759134"
FT                   /gene_name="RPL31"
FT                   /locus_tag="AER076C"
FT                   /product="60S ribosomal protein L31 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS52760.2"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG269646"
FT                   /db_xref="HOGENOM:HBG505448"
FT                   /db_xref="InterPro:IPR000054"
FT                   /db_xref="InterPro:IPR020052"
FT                   /db_xref="UniParc:UPI0001DB295A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757D7"
FT                   /transl_table=1
FT                   /translation="MAGLKDVVTREYTINLHKRLHGVTFKKRAPRAVKEIKKFAKLHMG
FT                   TEDVRLDPRLNTEIWKRGVKGVPFRMRLRISRRRNEEDNAKNPLFSYVEPVVVASAKGL
FT                   HTVVVEEEEA"
FT   CDS_pept        778959..779804
FT                   /codon_start=1
FT                   /gene_family="HOG000001019" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930247"
FT                   /locus_tag="AER077W"
FT                   /orf_name="AGOS_AER077W"
FT                   /product="AER077Wp"
FT                   /protein_id="AAS52761.1"
FT                   /db_xref="HOGENOM:HBG059069"
FT                   /db_xref="HOGENOM:HBG203086"
FT                   /db_xref="InterPro:IPR013951"
FT                   /db_xref="UniParc:UPI0000252DB1"
FT                   /db_xref="UniProtKB/TrEMBL:Q757D6"
FT                   /transl_table=1
FT                   /translation="MSMTATTEGDDGYRRRQSEIYRMQETLLDTTQTAETAGAAERVQE
FT                   ADPDGQGAGVDSGELLEVVERHYGARRCALGTIRYEAARAGRLTGGAGAALPFPYEVGQ
FT                   QTVPVPLLPRMGTAAINRLVTVELSAEDLESALATGENARVRNRELWGVDVYTCDSDPL
FT                   LVLVHCGVLDAELSGQGAGSGPRRRTPANRANPDCVTRGVSAAPSVRRGAYHFDVRAQL
FT                   LMLPPLQRYASAERFGLQSREWNTLHDGLSYGLYEVTILLRDPTLRDVGGADQITKVDW
FT                   "
FT   CDS_pept        780087..780740
FT                   /codon_start=1
FT                   /gene_family="HOG000142323" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15759135"
FT                   /locus_tag="AER078W"
FT                   /orf_name="AGOS_AER078W"
FT                   /product="AER078Wp"
FT                   /protein_id="AAS52762.1"
FT                   /db_xref="HOGENOM:HBG124127"
FT                   /db_xref="UniParc:UPI0000252DB2"
FT                   /db_xref="UniProtKB/TrEMBL:Q757D5"
FT                   /transl_table=1
FT                   /translation="MSGDRGADAPYSVADSRRKSRARPGLRSSVSSWMHKFRANLCKVT
FT                   SEALAETSGSDSGRSTVDALFDGATETADGRELEGDTEARSSTSQTLVAKSEEEAALGK
FT                   HSQSWTFETFDPHEQRQVLHGDSSVPFVDGPKLWHIRRELWTAPTANNSVQEAAEHRAS
FT                   FRKIKPHYYPRIYRKLVLDDRPLSQPINLEDVMKIMDAGWLETNKWERASRGLA"
FT   CDS_pept        complement(780801..781154)
FT                   /codon_start=1
FT                   /gene_family="HOG000067727" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15759136"
FT                   /locus_tag="AER079C"
FT                   /orf_name="AGOS_AER079C"
FT                   /product="AER079Cp"
FT                   /protein_id="AAS52763.1"
FT                   /db_xref="HOGENOM:HBG059070"
FT                   /db_xref="UniParc:UPI0000252DB3"
FT                   /db_xref="UniProtKB/TrEMBL:Q757D4"
FT                   /transl_table=1
FT                   /translation="MELDQDVNRIIKSKTATKVSAMQAEIEANHAYIYDVQLKKLLRLH
FT                   DEELQERCHTPLRKLYAKYSSRAEGNRDLQTWAEHVERDLRLLETTLRLVREGKAQDTE
FT                   QAPGKGDRIFRSD"
FT   CDS_pept        781322..784420
FT                   /codon_start=1
FT                   /gene_family="HOG000144402" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15759137"
FT                   /locus_tag="AER080W"
FT                   /orf_name="AGOS_AER080W"
FT                   /product="AER080Wp"
FT                   /protein_id="AAS52764.1"
FT                   /db_xref="HOGENOM:HBG059071"
FT                   /db_xref="InterPro:IPR019452"
FT                   /db_xref="InterPro:IPR019453"
FT                   /db_xref="UniParc:UPI0000252DB4"
FT                   /db_xref="UniProtKB/TrEMBL:Q757D3"
FT                   /transl_table=1
FT                   /translation="MLRAELVNAIPCQGAQCVAVVDGVRQLVVVRNNRDFLVYSSMDER
FT                   GLRLVQTYTELLGPNYGVEELLYSERLRTIFVRTTKCLLLLHSSNLQHYDKIVDKRGID
FT                   HAWLFEHPCGKAETWMTVLVYSVTGSSKIKMLTWVGRQFQAVHEVALGTRSEVISSVSG
FT                   GPACCVVLTSTTVYQWRYMSSELVRVDRVIKPTWPRELYDTVKEVETAQVEASTQGKEY
FT                   ADDVSSLISVESLSQLSRKTNLSNFWFKKPQGRAFKDVRLAFLPSDSVYPVIMDGKTEM
FT                   MLQLERADKESLYITVHDCRHFYERNRDFETVQYYMSRYLLLSNSNFVRIVDYYRGFIF
FT                   MEIYVSKGIKCVYPISESSLLIRTLDDELQLFKISCEDDLSKTTVHDCRSIPNNAEEAH
FT                   FDNLKRRIIFYESLLDTQKGLTMFSISGSSDNGDQAELYALKLRDLSLLFAIKSFERFA
FT                   GSQTLTLSKKLDERVNRLQELLAKQLFDLFLAFLAPPELVLRRCLPYNVAAEIDDLLTP
FT                   PILASEVKRTDLSPKLINRWCLPYLTDIRRHLHNLQRQGPNATVLWAFGAYKLQVGIEF
FT                   FQLDHSKASGLLNLLRIIDTALFQLYMHYNKPMVGPLIRVDNNCDLVKVEAALKENKMF
FT                   QELIDFYYNKSEHGKALNLLIHLSDYVDKSFATNVMQEKVKNLVIDYLSKLPSEYLDTI
FT                   FEYTAWLLKNYSDKDFIISSIFMNDSPACGKFNYEKVYSFIDKCNKQLSVTYLEYIVNI
FT                   YHHTDSKIFNYLILRYIQDISNEKCAKKLKAILKTTAYYEPRVVLRYLSTALEDDTLTA
FT                   ENIKWLKLLKTWPLGRLGEHETALGILVDDLGNYNQASLYCNELYATNKNAGTAALMNL
FT                   FEKLLAKVEFSGWRNVHLFLLENGSKLDAITLFEKLPPNIPINTLNEFLSRRIKSASMK
FT                   KNQSRIQNNLLKVNLIGSTYRLSQIISEFLVVDEDNRCYVCQKNLTLGSSELFSLFNLR
FT                   GSNILTHYNCGRSLQEIIAADDCKSGSMSHVKTLGDYKDEKKR"
FT   CDS_pept        complement(784487..787558)
FT                   /codon_start=1
FT                   /gene_family="HOG000217777" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15759138"
FT                   /locus_tag="AGOS_AER081C"
FT                   /product="AER081Cp"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="small-subunit processome"
FT                   /protein_id="AAS52765.2"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0032040"
FT                   /db_xref="HOGENOM:HBG053553"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007319"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0001DB295B"
FT                   /db_xref="UniProtKB/TrEMBL:Q757D2"
FT                   /transl_table=1
FT                   /translation="MEKSWYPTRELAAASPNHQQQCSKSVAYRQRSCVVKAGRVVVSFC
FT                   LMKLVFRDLKNLYGHRARCTSLTNSQAYSSRLRSARPLLINMAESDVAKRQRTGKNVSG
FT                   QAAHASRIFSPFRVVGNVTNETPFAVGTLGTTFYIATSVGKSFQIYDASNLHLLFVSAQ
FT                   QTSSPITCLATHHHYLYAGFGKHVGIYKRGQLERLLTLPDCNATVRHMCVFGGYLCVSA
FT                   DDNSVYVFKTEGGSKYPTEFYTKFNIGSLLGGEILELVHLPTYLNKLVVVTHSNIVLYN
FT                   IRTRKMLFSSDEFPDRITAAECAPALDVLALGTITGEVVLYNMKKGRKIRSIQTTNRVS
FT                   SLSFRTDGSAHMAIASTNGDLVFYDLNRKTRIHVLKGIHRDTYGGISKVSFLNGQSIVV
FT                   TSGGDNQLKEFAFDPSLSQSESETVVQPPRLLRSRGGHSQPPSRICFADSHSHFLMSAS
FT                   KDRSLWGFSLRKDAQSQEFSQRLHKNKDGSRIGGSTMKEKFPEIIALAIENFREGDWEN
FT                   VVTAHNGERAARTWNTKTKRVGRWTLSTSDDGLVKSVAMTQCGNFALIGSSNGGISVYN
FT                   LQSGIKRKVYKMHKGSVTGLAVDGMNRKMVSCGLDGLVGFYDFTTNSFLGKLQLGAPIT
FT                   QLVYHRASELFAVALDDFSIQVIDSVTQRVVRQLWGHSNRITAFDFSPDGRWIVSASLD
FT                   STLRTWDLPTGTCIDGVRLESVATNVQFSANGDILATTHVAGNGIAIWSNRSQFKAIST
FT                   RQIDEEAFARLLLPSASEDGGVSMLEGAFDAEDEEQSMGTYKSLEQINESLITLSLGPR
FT                   NKMNTLLKLDVIRQRSKPKEAPKKPEKAPFFLQLTGEKVGDDASGREDALNANATTSLK
FT                   EQEEKAASMQVQDQLAKFKPTTKLGFESEFTKLLRTSAAESDYNNFLVHLVNMSPASID
FT                   LEIRSLNAFEPFEEIVWFIEALVEGLKSGKNFDLYEAFMSLLFKAHGDIINANNKHEGI
FT                   ARSLQEWRAIHNSREHLDDLVKFCSSIINFVTTT"
FT   CDS_pept        787876..791304
FT                   /codon_start=1
FT                   /gene_family="HOG000177917" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15759139"
FT                   /locus_tag="AER082W"
FT                   /orf_name="AGOS_AER082W"
FT                   /product="AER082Wp"
FT                   /function="acid phosphatase activity"
FT                   /protein_id="AAS52766.1"
FT                   /db_xref="GO:0003993"
FT                   /db_xref="HOGENOM:HBG117938"
FT                   /db_xref="HOGENOM:HBG398541"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="UniParc:UPI0000252DB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q757D1"
FT                   /transl_table=1
FT                   /translation="MSEDNCLQPQLSPLFLSCSTKKAMESIAPILEGFTPKTSSSENTS
FT                   LKLPPASLTTDEEEDADENLDPNALARTVSVQSQQSAVGGTGAVTYNSLAAPDENAETF
FT                   AKHGAAHGLEQITSSQALEECACEEGNCTDACQAVSPGAYKGQSPRKPADDATEKNEGW
FT                   QHSVHPPVQQTGHEGANSDSATPAPSSSSSSRKSSTSITKPQLPRVGKIGVCAMDAKVL
FT                   SKPCRHILNRLIENGEFETIIFGDKVILDENIENWPTCDFLISFFSSGFPLNKAIDYVM
FT                   LRKPFMINDLIMQKVLWDRRLCLRLLEAAQVPTPPRLEITRDGGPRVDDALRSKLLERG
FT                   VHVKPIREPIWRMLDNDTLEVNGEIMTKPFVEKPVDGEDHNIYIYYHSKNGGGGRRLFR
FT                   KVGNKSSEFDPALVAPRSEGSYIYEKFMDTDNFEDVKAYTVGESFCHAETRKSPVVDGI
FT                   VRRNTHGKEIRYVTELTEEEKQMAARVSKTFSQMICGFDLLRVNGKSFVIDVNGFSFVK
FT                   DNSMYYDSCAKILRDTFVNAKKQIDLEKRNLPVIQEEKRQKWFFKGLVTVIRHADRTPK
FT                   QKFKHSFRSQIFISLLKGHKEEVVIRNVSDLQIVLQALRIAMEEGVEDPNKLEVLANAL
FT                   EKKLNFPGTKIQLKPVLNDDNEVEKVQFILKWGGEPTHSARYQAQELGEQMRQDFDLLN
FT                   KNILRNIKIFSSSERRVLASAQLWAMALFGADELGSDEISIRKDLLDDSNAAKDLMDKV
FT                   KKQLKALLREGKEAPPQFAWPLKMPQPYLVIKRVVELMNYHKKIMDHNFSHKSLEEMQR
FT                   RWCCGEDPTLFKERWDKLFKEFVSVDKVDPAKISELYDTMKYDALHNRSFLERIFSPDE
FT                   ADELNEDAACQHSLVDRYPINILAKNNFKIPETTLGKTTSNSVGSLGWVLEKESGMKAH
FT                   CSNPNSIFDHPRYMQLRELYRLSKVLFDFICPQEYGIEDNEKLDIGLLTSLPLSKQILN
FT                   DIDDMKSKDTPACIAYFTKESHIYTLLNIIYEAGLPMRIARNALPELDYLSQINFELYE
FT                   SADSGGQKSHAIRLKMSPGCHTQDPLDVQLDEKHYISCIPRISLTKHLDMDYVSQKLRN
FT                   KFSRVNMPQKFTPVHITQPDLSYKRPAMKDSSTES"
FT   CDS_pept        complement(791730..793007)
FT                   /codon_start=1
FT                   /gene_family="HOG000210451" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20624711"
FT                   /locus_tag="AER083C"
FT                   /orf_name="AGOS_AER083C"
FT                   /product="AER083Cp"
FT                   /function="magnesium ion binding"
FT                   /function="ribose phosphate diphosphokinase activity "
FT                   /biological_process="nucleoside metabolic process "
FT                   /biological_process="ribonucleoside monophosphate
FT                   biosynthetic process"
FT                   /protein_id="AAS52767.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004749"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="GO:0009156"
FT                   /db_xref="HOGENOM:HBG247648"
FT                   /db_xref="HOGENOM:HBG519284"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="UniParc:UPI0000252DB7"
FT                   /db_xref="UniProtKB/TrEMBL:Q757D0"
FT                   /transl_table=1
FT                   /translation="MRKCKVFMGTSHPELGKLVCEKLGIEPAPCTLKKFANGETSVQIG
FT                   VSVRDEDVYVIQSGSSTINDHIMELLILVSACKGGSARKVTAVIPQFPYSKQCKMKKHR
FT                   GAITARMLANLLIIAGADHVVSMDLHASQMQGFFTKPVDNLYGGPSLAKWIRENVEDYQ
FT                   HAVVVSKNPGGTKRVTALADSLKINFAMIHTDRRRSKDLYSQTKDMKQLRMRKQSMLRK
FT                   NRPIVRPGAAEDEEENIILTNGIQTARIINGHVIDDDVDDAYHSDVVVSDQEGSLASDS
FT                   YPIGGSYEAAADSEDEEAPQEKQEKLITLVGNVNGRSAIILDDMIDRPGSFISAAEHMV
FT                   KNCGAKRVYVVATHGIFTGDCLEQLEQSDAVYQVIVTNTYPINRDRMKRSQKLVVIDTS
FT                   SIFAECIRRDHYGESISVLFDSLASL"
FT   CDS_pept        793468..794280
FT                   /codon_start=1
FT                   /gene_family="HOG000094144" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930248"
FT                   /locus_tag="AER084W"
FT                   /orf_name="AGOS_AER084W"
FT                   /product="AER084Wp"
FT                   /protein_id="AAS52768.1"
FT                   /db_xref="HOGENOM:HBG059073"
FT                   /db_xref="HOGENOM:HBG397309"
FT                   /db_xref="InterPro:IPR012942"
FT                   /db_xref="UniParc:UPI0000252DB8"
FT                   /db_xref="UniProtKB/TrEMBL:Q757C9"
FT                   /transl_table=1
FT                   /translation="MSGRQMRERQRNGVLDFKQALQRCRTEVQESRMFADLTTHLEPHK
FT                   ERLTRIRCLALGKFHEEAPARWQLALLLELVDYLGHEVQCSLYDPAFTAEELSYVEQLG
FT                   ERWSVDEQSPWSTESSDKLLFFLPHAPLSLTESVVEAEQPRLWLANQLVQHTDRYTKAQ
FT                   LFEKYPLISKLVSYLDSGSKVGTASTDGFSAFVPKRSRRQRRNKAVYREPDIDYGSVKS
FT                   YFTGCTVLTDFSGGELLRDKPWLNAFSDLALHRIELGVKQVERPADSI"
FT   CDS_pept        complement(794379..800519)
FT                   /codon_start=1
FT                   /gene_family="HOG000177963" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15759140"
FT                   /locus_tag="AGOS_AER085C"
FT                   /product="AER085Cp"
FT                   /function="fatty acid synthase activity"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="fatty acid synthase complex "
FT                   /protein_id="AAS52769.2"
FT                   /db_xref="GO:0004312"
FT                   /db_xref="GO:0005835"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053545"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR013565"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016452"
FT                   /db_xref="UniParc:UPI0001DB295C"
FT                   /db_xref="UniProtKB/TrEMBL:Q757C8"
FT                   /transl_table=1
FT                   /translation="MSGITTRSLALGHGALEHTLSVPTGLYLTASQLAASFAKEQVAPT
FT                   EGYASDEEPASSAELLAKFVGHVAAQAGAGGEVAAVLELALDEFEASYMCGEEVHRVAA
FT                   RLLADDEQPTALPKVKELVQHYVYGSVRAQRPLMHRRPALLESATRGDARVVAVFGGQG
FT                   NTDDYFEELRELHQMYGVLVEDVLDTAAEQLNELLRTTEGAEKMYTQGLDFRQWLAQPE
FT                   RTPDNDYLLLIPISCPLIGILQLAHYAVTARIVGITPGELRACMVGVTGHSQGLSTAVA
FT                   VAEADTWESFFCALRKTVSLLFFIGVRCYQVYPKTSLPPSILEDSLENGEGKPSPMLSV
FT                   SNLTQEQVQEFVEKTNAHLPSEKHIVISLVNGARNLVVSGPPQSLYGLNLALRRAKAPA
FT                   GLDQSRIPHSERKLKFTNRFLPIESPFHSHLLEPALELIKQDLHDADLEFKQESLAIAV
FT                   YDTYDGHDLRQHSGSIVERIASCITKLPVYWETATTFKSTHILDYGPGGASGLGVLTHR
FT                   NKDGTGVRVIIAGALDHNIDDEYGFKQELFDVNPTSLKFASNWLEEFHPKLIKTGSGKV
FT                   YVDTKFSRLLGRPPLLVPGMTPTTVSPDFVAATINSGYHIELAGGGYFSPQGMTEAIDS
FT                   VVAQIKKGSSLGINLIYVNPRMLQWGIPLIKELRSKGYPIQSLTIGAGVPSLEVASEYI
FT                   ETLGMTHLGLKPGSVDAISQVITIAKAHPTFPIVVQWTAGRGGGHHSFENFHAPMLQMY
FT                   GKLRRHSNIILIAGSGFGSSEETYPYLTGEWSTRFNYPPMPFDGFLFGSRVMVAKEAKT
FT                   SLAAKKAIAACTGVPDELWEQTYKKPTGGIVTVRSEMGEPIHKIATRGVMLWKELDETI
FT                   FNLPKNKLQPALDAKRDYIIQKLNSDFQKPWFATVNGEARELTDMTYKEVAERMVELMF
FT                   IKSTGKWIDVTLRNFTGDFLRRVEERFTKDKSVSVLQSYSDLETPSKVLADIFSAYPAA
FT                   KSQFVNAQDVAYFLECAQRPTQKPVPFIPVLDHRFEFFFKKDSLWQSENLEAVVDEDVQ
FT                   RTCILHGPVAAQYTKEINEPIQHILDSIHDGHINKLLKDYYSDDISKVPVVEYFGGENP
FT                   REVDYPTVKKTPDTIVYNATSATDFRTWFNVLAGSQKSWRHAFFSIPRVVQGSRYSENP
FT                   TFKVFKPCDNMVVTIKHPETPDKTEVILQEPVQGTLKTTATVTFSGDVIQLSMIENRTM
FT                   DGIPVALPLLYKYNPTDGFAPIVEIMEDRNQRIKEMYWKLWLKDPFNLDFDPRDPIESE
FT                   DFTITSKDIAAFTHAIGNNCEDFVTRPGRPLLAPMDFAIVIGWRALVKAIFPNNVDGDL
FT                   LNLVHLSNSYRMIPGAKPLQENDVVNVSALIKSVVNQENGKLVEVVGTIKKSGKPVIEV
FT                   TTSFLYRGKYSDFENTFQKSTDPVYVIQINSPKDIAVLKSKEWLHFDNDKIDLLGRTLT
FT                   FETETEVTFKNRTVFSSVHCEGRVLMELSTKENVQIGVVKYDAGESHGNPVIDYLSRNG
FT                   STLEHKVNLENTIPIATIEAQSPGTNETYARVSGDLNPIHVSRHFANYADLPGTITHGM
FT                   YTSGAVRALVETWAADSVSSRVRAYSCQFVGMVLPNTLLTTRIEHVGMINGRKLIKFET
FT                   RNDKDEPVLAGEAEVQQPVSTFVFTGQGSQEQGMGMDLYDKSPVARQVWDRADNHFKQT
FT                   YGFSILEIVRTNPKELTIYFGGEKGRKIKENYTSMIFETIVDGEIASERIFKSITESST
FT                   SYTFKSDTGLLSATQFTQPALTLMEKASFEDLKSKGLIPAEATFAGHSLGEYAALASLA
FT                   DVMSIESLVEVVFYRGMTMQVAVPRDSEGRSNYGMIAVNPSRVSTGFTQEALQFVVERV
FT                   GKITEWLVEIVNYNVEDQQYVAAGDLRALDTLTNVLNFVKLQKIDLVKLQATMPLEQVE
FT                   EHLDEIITEISKKSLSKPQPIELERGFACIPLRGISVPFHSSYLRNGVKPFKNFLKKNI
FT                   IKENVKVDRLIGKYIPNLTAKPFAITKEYFEDVYKLTGSEKIKAVLDNWESYQN"
FT   CDS_pept        complement(800884..801693)
FT                   /codon_start=1
FT                   /gene_family="HOG000113347" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15759141"
FT                   /gene_name="LOT5"
FT                   /locus_tag="AER086C"
FT                   /product="Protein LOT5"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52770.2"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG059074"
FT                   /db_xref="HOGENOM:HBG202402"
FT                   /db_xref="UniParc:UPI0001DB295D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757C7"
FT                   /transl_table=1
FT                   /translation="MNADRPCCQFVTTKPTVENVTPFAQFQLTQPRLKGVSLQQLSALP
FT                   ILYGGGRNFLFGRFTDSEPQLQDTDLFVLDSCILLWPAHALRGLRIPYDAVIYHAVRRA
FT                   DVLELVLAVERDATLDSLFPPAPGPQPFALSTLELRLRPRYATYDRHYSGAVEQLFTFR
FT                   DFGLNRGDAMVANCNTAIATCMEFHHRAAAADDDDDDDDGPAAHVTPLAELLAPAGHVP
FT                   IYANHGSADDLTDDGLTDDGPQGGAAAGMALAFCSAARVPTKRRRQD"
FT   CDS_pept        complement(801766..803118)
FT                   /codon_start=1
FT                   /gene_family="HOG000274133" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081545"
FT                   /locus_tag="AGOS_AER087C"
FT                   /product="AER087Cp"
FT                   /function="catalytic activity"
FT                   /biological_process="polyamine biosynthetic process "
FT                   /protein_id="AAS52771.2"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006596"
FT                   /db_xref="HOGENOM:HBG152288"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002433"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="UniParc:UPI0001DB2979"
FT                   /db_xref="UniProtKB/TrEMBL:Q757C6"
FT                   /transl_table=1
FT                   /translation="MIAKEIAPALAQDQPEEVKHDSLCQARDHVTTGLAGLVATDPTTQ
FT                   KTGAHEQAHQAVFQAMKEHVERVNKDTCDAGEENSFFVCDLGEVERLLRYWRRELPRVQ
FT                   PYYAVKCNPDVRVLERLASLGVNFDCASKAEIERVLQLGVAPERIIYANPCKVSSFIRF
FT                   AAARGVRQSTFDNVEELYKIARFHPESQLLLRISTDDSTAQCQLSAKYGCSPDEVDPLL
FT                   AKVAELGLNLVGVSFHIGSGASDFSSLTQAVVDARRVFDRAAHFGLPALRVLDVGGGFQ
FT                   FDTFHQSSAILNAALDTHFPPGSGVELIAEPGRFLVATAFTLSSHVIAKRELPERGSML
FT                   YINDGIYANMNCILFDHYQPTPRVLYHAAAFHYFDTTSSKSRTAACPHRTSIWGPTCDG
FT                   LDCITDEYYLRYDLAVGDWLYFANFGAYTSSAATPFNGFEAAVEVIYIDTA"
FT   CDS_pept        complement(803518..804765)
FT                   /codon_start=1
FT                   /gene_family="HOG000034095" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15759142"
FT                   /locus_tag="AGOS_AER088C"
FT                   /product="AER088Cp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="AAS52772.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG059075"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniParc:UPI0001DB297A"
FT                   /db_xref="UniProtKB/TrEMBL:Q757C5"
FT                   /transl_table=1
FT                   /translation="MARIVPAGQPVASAGSELRRKWSLGDLMLPSLQAARRPALAQESP
FT                   YFFDVRGRAASAPSSPQNATVLTPTTSPRVQSLQSSPQVSLPPLRHLRLLPNPDRQQHA
FT                   PAYPDTCEHTHRWRHDLVRWCAEAKREHFKHIEAEMAQLDVRSFPGLHMLANAAYVSSI
FT                   VSPRDHFFQLADSSASEWIVMTPPVSPREEGQQPASPGLFTHAVSEKLVQTIRRKRLSA
FT                   SSHKKSNSFQAREMKKLLDSRSNLAPSGAGKISKKLPAAPVQQLMATINLGCSQQPECC
FT                   EPPNLTPQRPAADLHPTRSIPCHQLAQLVRTPMGPRTPSRRASMRRCLSCHCTESPCWR
FT                   PSWSDRRQDQLCNSCGLRYKKTHTRCLNSACRRIPSKGELAQMKTNPIVSEILENGLRV
FT                   EGLRCLFCNCVVETRD"
FT   CDS_pept        805363..805866
FT                   /codon_start=1
FT                   /gene_family="HOG000248726" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15759143"
FT                   /locus_tag="AER089W"
FT                   /orf_name="AGOS_AER089W"
FT                   /product="AER089Wp"
FT                   /protein_id="AAS52773.1"
FT                   /db_xref="HOGENOM:HBG059076"
FT                   /db_xref="HOGENOM:HBG398436"
FT                   /db_xref="InterPro:IPR019488"
FT                   /db_xref="UniParc:UPI0000252DBD"
FT                   /db_xref="UniProtKB/TrEMBL:Q757C4"
FT                   /transl_table=1
FT                   /translation="MNAPGAGHSQAAETFVKKLLAHLDECDVDRLQQALPLFQPHCRIV
FT                   VNTQPFASPAAFLQTWLQAVVATQHTLTSLDYHVIPGTATLVCNAACKVRFDESGRDKM
FT                   GGDAVLPAPAARAQPRARRWGTYYGLSLQLVLDERVLAGDAAAAIAALNYTLVFRPDDT
FT                   LMSI"
FT   CDS_pept        806459..808489
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15759144"
FT                   /locus_tag="AER090W"
FT                   /orf_name="AGOS_AER090W"
FT                   /product="AER090Wp"
FT                   /protein_id="AAS52774.1"
FT                   /db_xref="HOGENOM:HBG124407"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniParc:UPI0000252DBE"
FT                   /db_xref="UniProtKB/TrEMBL:Q757C3"
FT                   /transl_table=1
FT                   /translation="MLKVLVAGKPNNAALGVSLFLTMVVMVMWGVYMGGLTKTSGPIYN
FT                   IYHGRAEIEHVNVTKILPISAPILQFLGGALLSKNVSNEMIFGSLKRMAQTEALAPMLQ
FT                   LLTNTTNSVGTLAELAAANSGKEKPVAPLKGLLDIMQTSKNASAVVEGLSLVAKGVEAA
FT                   KKENASVKSDAEILALMAVAGNDVPKAVHSLNTLAAIPSEDRLKLSSILITLNLSPDPK
FT                   AFATALEDFLNKGLKLDDVREIISQFNAKIQRSTNASEIAGIADEIAKAEKQDSSAAVS
FT                   AMGAVLGHAASPFGALNVLNSSAELLNQPGAKPAAGALKGMMEAASNTTKAIDFIMERA
FT                   SHPKAGAAEQVMGLDMVLQNAVNSSETFANIIKMQMASTEESQKALPSLLGLLSYSTDK
FT                   IESMKSVIKLIEFGEKSPDVLNPVLEVLQASVKVNRLIPSKEILDLTPTILENFNVAAR
FT                   YRLGIFTICKLFLNGTQKACSKPHVVQGFDYRNILYTDLMDSDLAPYIKTLRVGPNDLY
FT                   LEGKLLEKQPMYEPSIRAHLAFDILGLLSAFILLFTLAGAMTGALSLGMHAWVNRLLVA
FT                   AVAGFALLSATVIQIVTAVVKWGAKIDNYGVVYKQGTAQATLSWVAFVLEAIVVLIVWG
FT                   AYYAGGKSQGVVNVEEGRASTSDEDIDKEKISRPHPAHPDI"
FT   CDS_pept        808951..811356
FT                   /codon_start=1
FT                   /gene_family="HOG000206081" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930249"
FT                   /locus_tag="AER091W"
FT                   /orf_name="AGOS_AER091W"
FT                   /product="AER091Wp"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /biological_process="transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS52775.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG524837"
FT                   /db_xref="HOGENOM:HBG557888"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010509"
FT                   /db_xref="UniParc:UPI0000252DBF"
FT                   /db_xref="UniProtKB/TrEMBL:Q757C2"
FT                   /transl_table=1
FT                   /translation="MLEFYKAHRIRILKASYLVLLVVTVKNLAQGKDAAERKAAGEPQD
FT                   RKKPRSRANSAINVHYLRSLLGQTNGIESNSDESAAESDDGDYDGPSVDQKRSSFLIKL
FT                   LLRDPRCLLTFLLQASLLVIRTMLSLRVATLDGILVSKLVKGQFSEFVKVLLGQWMTLG
FT                   IPASMVNSLLTYTTRLCAVTINRKVSYHLLDKYLSSHHSFYSVNNLPSDKNKALSLAMS
FT                   ESKENSPNTRREANPPIYVSDIPVQFLTRDVGAFSYNASVLLNQLLKPTLDLILCSFKL
FT                   AQSSSSGMMAEGTLVLGLIVYFSNLCLKLIQPNFVQLTVKRTHLEGYFRSLHSKLRSSN
FT                   EEIALFKGQSTELWNLDFSFYQLTLFLAGEIKSRALYDFATSFVVKYVWGAAGLILCSI
FT                   PVFFRSNMAEDVTADFITNRRLLLTASASIGRYVELRRSIQQLKGEALRLTNFNDRLDA
FT                   GSSSKTDGKKVIIEYDDSKIQFVHVPLVTPANQVLIPELNFELKHGNHLLIIGPNGCGK
FT                   SSLFRVLGGLWPVLQSFTNPKKPTKLIMPRRNAENGESPIYYLPQRAYMSNLSTFREQI
FT                   IYPDKINAFEKKYNGDYQRGDKELADILSVLELDDLIAENMALIMAKRSSTEGSGQPTE
FT                   VSLTEAFGITRNWSEELSVGIQQRLAMARMYYHRPKFAVLDECTSAVSPEMEQKMYTHA
FT                   QSLNISLISVCHRTTLWHFHNLLLKFDGNGGYTFGPFDPEQRLTDEQRLAELNKIIEQD
FT                   VPIWKKKLDELVIAKKSNVLRKSQTNLKSLQESRLPLIQGMSPMTSNT"
FT   CDS_pept        811542..813128
FT                   /codon_start=1
FT                   /gene_family="HOG000067728" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15759145"
FT                   /locus_tag="AER092W"
FT                   /orf_name="AGOS_AER092W"
FT                   /product="AER092Wp"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS52776.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059077"
FT                   /db_xref="HOGENOM:HBG202585"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR007286"
FT                   /db_xref="InterPro:IPR021648"
FT                   /db_xref="UniParc:UPI0000252DC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q757C1"
FT                   /transl_table=1
FT                   /translation="MGSTVNYLSYWQYAETTASGHPVLREGERDIYVEQDVGLYHGKIK
FT                   ILNKQKGRCYLTSQRIIYVDDTFHAKESVSIELDDVEKARYNAKFLKRATKTVLFLKPN
FT                   SKHSLGGKASRSNVDQKTFKRIVEKSQWTCAICMAHNEVNMEIQGYMPPCVNCGISVDF
FT                   EMISKSLTIVYADDATDAAKNKCPACTFDNHVHMNNCEMCGTRLPNMCPTALTRNQQLG
FT                   GDPRVHIELEGNPGFTSRDIPFVQLSFRRSDGSLFFEALCKQLEDWESDQKKHMFNQDL
FT                   TKVNGVGLETPIFEQDTRFSTLGIASLEKSREEQLLKNDILLNKALTDLGNLAALASDI
FT                   EKLYHDGESAPSNTNPTLVIDRDKFLSKSAFIDEIAREIYQLTVSEFKDQREKHGTILV
FT                   PLVDLYALYNKSMRIGTGYVSPEEMREACERFGKLGLTDLSLSRINGRVLCIASANSFE
FT                   AVKRKIMSTIEHSPGADLLQITKQLNRENDNAWAIGIIMEVLQNCVKEGNLLIDEQISG
FT                   IHYYINVCWRI"
FT   CDS_pept        complement(813241..814329)
FT                   /codon_start=1
FT                   /gene_family="HOG000234711" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15759146"
FT                   /locus_tag="AER093C"
FT                   /orf_name="AGOS_AER093C"
FT                   /product="AER093Cp"
FT                   /function="binding"
FT                   /protein_id="AAS52777.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG017984"
FT                   /db_xref="HOGENOM:HBG331109"
FT                   /db_xref="InterPro:IPR013878"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0000252DC1"
FT                   /db_xref="UniProtKB/TrEMBL:Q757C0"
FT                   /transl_table=1
FT                   /translation="MTFWWKKSPKTPGDYVKHLTEQLARFELAVSDNRKKIQDECTKYI
FT                   TGTKDFILGETDPAPSGEAIDELYFAIYDADLLYDLLVHFHELDFESRKDVALIYATCL
FT                   RRSKDNKFTTVDYLVTKPKILAYMLRIAEMALNKPNGTEVFLTTGGMILESIKYEQLCR
FT                   LLLKNPQIWTFFDFARLSSFEVSTESLQILTELFTTHTKLVATEFFNQDANIKKFIDRI
FT                   NMLMAHGNYVTKRQSVKLLRTMILNRAYGQLMNSYINSPENLKLNMILLSDRSKNLQLE
FT                   SFNVFKVVVANPRKSKPVLDILIKNRDKLLKFFENFGVDTKDTTLLDEKEFVVAQIEGL
FT                   PRLMSSNTENNLGSSPQKNLVA"
FT   tRNA            815576..815659
FT                   /gene_name="tRNA-Leu"
FT   CDS_pept        complement(815696..819892)
FT                   /codon_start=1
FT                   /gene_family="HOG000167651" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15759147"
FT                   /locus_tag="AGOS_AER094C"
FT                   /product="AER094Cp"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="AAS52778.2"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG525455"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI0001DB297B"
FT                   /db_xref="UniProtKB/TrEMBL:Q757B9"
FT                   /transl_table=1
FT                   /translation="MAKKSSKGKPAASPAPIDDAKGKKGKKNKEETPKDDGKAKQRENR
FT                   VKVSATVSWTGKLPHTLLHETVQKRKWNKVEYEMKKIGDKGMLAIAILSYTDPKTKEVL
FT                   SVRMHDPSYDKATGKGLLVPQETPIEARHYAATVALHRIAFNTNMHMMLPPNHKKLWYA
FT                   LEDFRKQLAKADTRQCDRTFSVDPFKVLLDDRIVKESRKREMEIKKQQEDKMRKPPTLV
FT                   TSIGQSKANQGKINKPVAARRAVSFPKSVWQSAPFIDLEESSRNLIEITLKKHIDWQSR
FT                   LHGDVEMQSREDLELQLLFFGFRKAHVTEAMQYKDPLSFLIFNLPEDDLPPFFHKRQED
FT                   SKVKVELATLPLATRNMISRLMEFGASYDEVLLALEKTEYNEPEAAGLLTRSVTPMTMS
FT                   PIEFSEEESSNIWRDELESLSSIYTDKIEVIDRDSCYMIDISGKFNLKLKVYKTKQYPG
FT                   TLPGIIISTFDKNYKLPNYIKQQIIKNLLHHVINSGLVGDMLVFDMFEWLNENLEGIIE
FT                   NPGPLLIFNGVEDKRQKIITSTDSGVNMKKKSNIRKTLNAAQLKQVKADYKARIESAAF
FT                   GKMLKARSKLPAWNKQESITNMVLKNDVVLITGETGSGKSTQIVQFILDHLIKVEEDYG
FT                   VKIICTQPRRISAIGLAERVSEERATQCGGEVGYVIRGTNKSTAATRITFMTTGILVRI
FT                   LQGDITFLKNAIVVVDEVHERSVDTDLIVIMLKNLLGKIQGLKIILMSATVNVDVFKAY
FT                   FKDLQTCHIEGRTFPVEDYYLEDVLEALDFKVKRDRFHQDDMRGDHDSAFIRPNVDSKI
FT                   FKSGQINYELVVETALHIHQRLLDEENDGSIIIFMPGVAEINRCCDKLEQCKFSKEFMV
FT                   LPLHSALPPDSQKRVFKRFPGKRKIIVSTNIAETSITIDDCVATVDTGRAKVMHYDPKN
FT                   HSTALIEAFISKAEANQRRGRAGRVRNGYSYKLYSKDTYTNMANSPLPEIKRIPLENLY
FT                   LSVKAMGINDVIKFLGTGIDPPPMNSILKAEQMLTTTGLLDESGKSLTELGRYISLMPV
FT                   MDSKHGKLLIYSIIFGCTDLGVLIASVLSIGMTPFIAPFENRDKIKSILSRYKHKGDIL
FT                   ATVEVVRQYLAQREKSARRRYMDENLLSYAKLNEIMSARSQFYSNLEDVGFLPLGYKPG
FT                   DIPALNKNCDNLNVIKCILTGAFYPQVARVQLPDPRYMATSSGSMEMDADAKATKLWIR
FT                   NEEYIDLISTADPATSIDANKLPATRAFLHPSSVFFAGSVPREQDLVTLDESTANLMVA
FT                   TKMPALNAPFAIYGTANATSKLFLRDLTLTSVLAVLLFGGPLRYDINGTTHSPGMVVDN
FT                   WLPIRTWCKNGVLIKELRLLLDQAIKQRLERSPILNTDNPEEEFIRLVLQIVQLE"
FT   CDS_pept        820095..821162
FT                   /codon_start=1
FT                   /gene_family="HOG000163861" [ FAMILY /