(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE10

ASHGO_5.PE10         Location/Qualifiers
FT   CDS_pept        18240..20306
FT                   /codon_start=1
FT                   /gene_family="HOG000001103" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15755766"
FT                   /gene_name="SWC3"
FT                   /locus_tag="AEL336W"
FT                   /product="SWR1-complex protein 3 "
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52348.2"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG058914"
FT                   /db_xref="HOGENOM:HBG203633"
FT                   /db_xref="UniParc:UPI0001DB2933"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758T8"
FT                   /transl_table=1
FT                   /translation="MARLRSRTATTEKDATESSKVPVPRRRRGQHEDTEEPDTYGLEDD
FT                   EKSSGRPFRILEKLPCSAEPPRYDVLTHALSVRDSAVLYNSLLASRRTWIKAEMFELYW
FT                   SKQYMNMKERERMLKEGIDPDDIDQSAAREKMHKLCDGILTGGPHTLPVRLFILKNDEI
FT                   EQKWQFMQESRKKEKEVRRKREAEEKERRREERKRLQQLKKERKLKEVEHTKKEKIERK
FT                   RENDTERDQLRKGRKDNKGPSVLSRMGTTIKSKGLTTFSKAQQQEIDNQKMIANLNLLA
FT                   QRDPALNKLMIAVANGQAPPADVERFKVFIERARNMEPPPNWKPRLSSRPVIKRTEEPT
FT                   VEQQESASQTPSTPLPRKASPESSQVDNLSSPPHGSDPNSSFTEASMSDSRGELSETKS
FT                   GGSLVPDSTGSSGQALDKGPTDASGSANDLSRPGATLSSTDGAPPLKQETIPVRDMGDK
FT                   NADKPLEAHGAISEKGTTITIKAEEGTAPRQKRKYTKRKKEVEDEDKSMQLTTFQQKYL
FT                   NGADILFEYLENSNMRFLFPKDAILEQLENEESYLMSWIVVHNKKEIEQFKLKVLKGLN
FT                   KNKPNEEETEVQPCLFNVYEHPNCPEVLYTPMTVTLSNIPKKFTPIILNSVNPAESVRA
FT                   YMSTILARGRRLNGFNLWYQLDAYDDKDLAESLRCELKEYEQGFKSKRQKKQL"
     atggcaagac tacggagtag gactgctact acggagaagg atgctacaga gagctccaag        60
     gtacctgtgc cacgcagaag gcgcgggcaa cacgaagaca cagaggagcc tgacacatac       120
     gggcttgagg acgatgagaa aagctccgga cggccgtttc gtatactaga gaagctaccg       180
     tgctccgcgg agccaccacg gtacgatgtc ctgacgcatg ctttgtccgt ccgggactcg       240
     gcggtacttt ataactcgct acttgcgtcc aggcggacgt ggatcaaggc ggagatgttc       300
     gagctgtact ggtccaaaca gtatatgaac atgaaggagc gggagcggat gttgaaggag       360
     ggtattgatc cagatgacat cgaccagtct gccgcccgag agaaaatgca caaactgtgc       420
     gatgggatct tgacgggcgg accacacacg ctgcccgtcc gtctgtttat cttgaagaat       480
     gacgaaatcg agcagaagtg gcagtttatg caagagtcac gcaagaagga gaaggaagtc       540
     aggcggaagc gcgaagcgga agaaaaggag cgccgcaggg aagagcggaa acgtctgcaa       600
     cagctgaaga aagaacggaa gttaaaagag gtggagcata ccaagaaaga gaagatagag       660
     cggaagcggg aaaacgacac ggaacgagac cagctgcgga agggcagaaa ggacaacaag       720
     ggacccagtg tgttaagccg gatggggacc actatcaaga gtaaaggtct gacgaccttt       780
     agtaaagcgc agcagcagga aattgacaac cagaaaatga ttgcgaatct taacctgcta       840
     gcccagcgag atcccgctct aaacaaacta atgatagccg tagcgaatgg ccaggcaccg       900
     cccgccgacg tggagcgatt caaagtattt atagagaggg cgcgtaacat ggagccgccg       960
     cctaactgga aaccacgcct gtcttctcgt ccagttataa agcgcacaga agagccgaca      1020
     gtggaacaac aggaaagtgc gagccagact cccagtacgc cgctcccacg aaaagcgtca      1080
     cccgaatcat cgcaggtaga taatcttagc tcaccgccgc atggtagcga tcctaattcc      1140
     tcattcacag aggcatctat gagcgattcg cggggggaac tctctgaaac taaaagtggc      1200
     gggagtctcg tcccagatag taccggcagc agtggccagg ctttggacaa aggccctaca      1260
     gacgcctcag gcagcgccaa tgatctcagt cgacccggtg cgaccttatc gtcgacggat      1320
     ggggctccgc cgcttaaaca ggagacaatt cccgtgcggg atatgggtga caaaaatgca      1380
     gacaagccac tcgaggctca tggtgccatc tcagagaagg gaacaactat cacaataaag      1440
     gcggaagaag gaacagcgcc tcgtcagaaa cggaagtata ctaagaggaa gaaagaggtc      1500
     gaagatgagg acaaatcgat gcagctgaca actttccagc agaaatactt gaatggagcg      1560
     gacattctat ttgaatattt ggagaactca aatatgaggt ttctattccc gaaggatgca      1620
     attctagagc agttggagaa tgaagagagt tacctcatgt cttggatagt tgttcacaat      1680
     aaaaaagaga ttgagcagtt caagctgaaa gtgctcaaag gcttgaataa aaataaacct      1740
     aatgaggagg agaccgaagt tcagccttgt ttgtttaacg tatatgagca ccctaactgc      1800
     ccagaggttc tatacacccc aatgacggta actctttcca atataccgaa gaagttcacg      1860
     ccgatcatat tgaatagtgt aaatccggca gaatcggtac gtgcatacat gtccactatt      1920
     cttgcacgtg gtcgtcgtct gaatggcttt aatctatggt accaactgga tgcctatgat      1980
     gacaaagatt tagctgaatc tctgcggtgt gagctcaagg agtacgaaca ggggtttaag      2040
     tcgaaaaggc agaagaaaca gctatag                                          2067
//

If you have problems or comments...

PBIL Back to PBIL home page