(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE106

ASHGO_5.PE106        Location/Qualifiers
FT   CDS_pept        180186..181547
FT                   /codon_start=1
FT                   /gene_family="HOG000160667" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756861"
FT                   /locus_tag="AEL243W"
FT                   /orf_name="AGOS_AEL243W"
FT                   /product="AEL243Wp"
FT                   /function="glycolipid 2-alpha-mannosyltransferase activity "
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS52442.1"
FT                   /db_xref="GO:0004377"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG192431"
FT                   /db_xref="HOGENOM:HBG396033"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="UniParc:UPI0000252C7A"
FT                   /db_xref="UniProtKB/TrEMBL:Q758K5"
FT                   /transl_table=1
FT                   /translation="MLCLRKCLRRPILLLAIALTGIVCFLIYRINHILEVRAYFANTVE
FT                   SVGATLSDIASKTTHADRASEFDALIEKLTTPLHSGAELSGATREEGLRAYARFMDQPI
FT                   DEPKGTPLVRPGTDAAGKAPATILCLVRNKDLEGIRSSITELEKAFNGKFKYPYTFLND
FT                   EPFTPEFKEAIQKLIPEHESEFATIDKEFWSIPEAINREKYDVQKLKLLTLKVGHAEED
FT                   SYHLMCRFYSRYFYKVPELAKYRYVWRLEPNVNFHSELNYDVFQFMKAANKIYGFTISL
FT                   YDNPWSVESLWDHTMDFVRAHPHYLNQAGATDWLRENIQKSENFKITRGYSTCHFWSNF
FT                   EIIDLEFLRSEAYEQFVEYLDQTGGFFYERWGDAPVRSLALALFANASDIHWFRDIAYN
FT                   HLPYFNCPTFLPDSRRSFGTCKSGKFSNWDELNVENCAGNWILHAMTDADRAAY"
     atgctatgct tgagaaagtg ccttagacgg cctatccttc tcctggctat tgcgctgact        60
     ggtattgtgt gtttcctcat atatcgtatc aaccatatcc tagaagttcg ggcctacttc       120
     gcaaacacag ttgaatctgt cggcgccacc ctatctgata tagctagcaa aactacacat       180
     gctgatagag ccagcgagtt tgatgcacta atagaaaagc tcactactcc gctacattct       240
     ggagcggagt tgtcgggcgc tacaagagaa gaagggctac gggcgtatgc acgcttcatg       300
     gaccagccca tcgatgagcc gaaaggaact cccctggtgc ggcctggcac agatgcagca       360
     gggaaggcgc cggcgaccat tttatgccta gtgaggaaca aagatcttga aggaataagg       420
     agctcgatta ccgagctcga aaaagcgttt aatggcaagt tcaagtaccc gtatactttt       480
     ttgaacgatg aaccgtttac tccagagttc aaggaggcta ttcagaagct tattcctgag       540
     catgaatcgg aatttgcaac tattgacaag gagttctggt ctataccgga ggccatcaat       600
     cgtgagaaat atgatgttca aaagctaaag cttttaaccc tcaaagtggg ccatgcagag       660
     gaggattcct atcacctcat gtgtaggttt tactctcgat acttctacaa agtgccagaa       720
     cttgcaaagt accgctatgt atggcggctt gaaccgaacg tcaacttcca cagcgaacta       780
     aactacgatg tgttccagtt tatgaaggct gcaaataaaa tttatgggtt tacaataagc       840
     ctatatgaca acccatggtc cgtggagtcg ttatgggacc atactatgga ttttgtccgc       900
     gctcatcccc actatctcaa ccaggccggc gccaccgact ggctacggga aaacatccag       960
     aagtccgaaa acttcaaaat cacccgcgga tacagcactt gccacttttg gagcaatttc      1020
     gagatcattg acttggagtt cttacgcagt gaagcttacg aacaatttgt tgaatacctt      1080
     gatcagacag gcgggttctt ctacgagcgt tggggcgatg cacctgtaag aagcctcgcg      1140
     ctggccctct ttgcaaacgc ttctgatatt cattggtttc gtgacattgc atacaatcac      1200
     ttgccatact ttaactgtcc cacctttctc ccggattctc gaaggtcttt cggtacctgt      1260
     aaatcgggga agttttccaa ttgggacgag ctaaacgtgg agaattgtgc gggcaactgg      1320
     atactccacg ccatgacgga tgcagatcgc gctgcctact ga                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page