(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE114

ASHGO_5.PE114        Location/Qualifiers
FT   CDS_pept        191225..191539
FT                   /codon_start=1
FT                   /gene_family="HOG000133897" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19776707"
FT                   /locus_tag="AGOS_AEL235W"
FT                   /product="AEL235Wp"
FT                   /function="ATP binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS52450.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG279789"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="UniParc:UPI0001DB29AD"
FT                   /db_xref="UniProtKB/TrEMBL:Q758J7"
FT                   /transl_table=1
FT                   /translation="MSFLKSAKSIVPLMDRVLVQRIKAEAKTASGLYLPEKNVEKLNQA
FT                   TVLAVGPGYTDAQGRQVSPSVQVGDKVLIPQFGGSSIKLGKDDEVLLFRDSEILAKIQE
FT                   "
     atgtcgtttt tgaagtccgc gaagagtatt gttcctctaa tggaccgggt gctggtgcag        60
     cgcatcaagg ccgaggccaa gacggcgtcc ggtctgtact tgcctgagaa gaacgtggag       120
     aagttgaacc aggcgacagt gctcgccgtg ggcccagggt acaccgacgc gcagggccgg       180
     caggtgtcgc catctgtgca ggtgggtgac aaggtgttga tcccgcagtt tggcgggtcg       240
     tcgatcaagc tcggcaaaga cgacgaagtg cttctgttcc gcgactcgga gatcctggcc       300
     aagatccagg agtaa                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page