(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE13

ASHGO_5.PE13         Location/Qualifiers
FT   CDS_pept        join(23514..23537,23606..25474)
FT                   /codon_start=1
FT                   /gene_family="HOG000067326" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20623887"
FT                   /locus_tag="AGOS_AEL333W"
FT                   /product="AEL333Wp"
FT                   /function="binding"
FT                   /function="protein phosphatase type 2A regulator activity "
FT                   /biological_process="signal transduction"
FT                   /cellular_component="protein phosphatase type 2A complex "
FT                   /protein_id="AAS52351.2"
FT                   /db_xref="GO:0000159"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0008601"
FT                   /db_xref="HOGENOM:HBG067378"
FT                   /db_xref="InterPro:IPR002554"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001DB2935"
FT                   /db_xref="UniProtKB/TrEMBL:Q758T5"
FT                   /transl_table=1
FT                   /translation="MMRGFKQKLIKKTTGSSSSTQKKKDKETGKKPGSANGAAGAVGGS
FT                   GGRATVDKKEQKGSGAKQPKAKDAGKSGAGAAPKVKVAAKKEERSYPTMIAAAVSPGST
FT                   SGPPSPKEAEAASPNGIDIPRSSHSFERLPTPTKLNPDTDLELIKTPQRHSSSRFEPSR
FT                   YTQISKLPGFDDVPPEEQISLFIAKVDQCNIMFDFSDPSFDIHGKEIKRITLQELIEFI
FT                   VTNRFTYTEEMYGHVVNMFKVNLFRPIPPPVNPIGDVYDPDEDEPVNELAWPHMQCVYE
FT                   FFLRFVESPDFNHQIAKQFIDQEFILKLLELFDSEDIRERDCLKTTLHRIYGKFLSLRS
FT                   FIRRSINNIFLQFVYETERFNGIAELLEILGSIINGFALPLKEEHKVFLVRILIPLHKV
FT                   RCLSLYHPQLAYCIVQFLEKEPMLTEEVIMGLLRYWPKVNSTKEIMFLNEIEDIFEVIE
FT                   PLEFIKVEVPLFVQLAKCISSPHFQVAEKVLSYWNNEYFLNLCIENAEVILPIIFPALY
FT                   ELTSQLDLDSQTDEEGNPNQDPYMLVEQAINSGSWNRAIHAMAFKALKIFLETNPVLYE
FT                   NCNSLYLSSLKESQKRREKREENWNKLQEYVRNLHISSVDNPVAVDRIGTGDLH"
     atgatgcgtg gttttaagca aaagttgata aagaaaacta caggatcgtc gtcgtcgact        60
     cagaagaaga aggacaagga gacggggaaa aagccgggga gcgccaatgg cgcggcaggg       120
     gccgtgggcg ggagcggggg ccgggcgacg gtggacaaga aggagcagaa gggctccggg       180
     gcgaagcagc cgaaggccaa ggacgcgggc aagtctgggg cgggcgcggc gcccaaggtg       240
     aaggtggcgg cgaagaagga agagcgctca tacccgacga tgattgcggc ggctgtgtcg       300
     ccggggagca cgtccgggcc gccgtcaccc aaggaggcgg aggcggcgtc gcccaacggc       360
     atcgacatcc cgcggtcgtc gcactcgttc gagcggctac ccacgcccac gaagctgaac       420
     cccgacacag accttgagct gatcaagacg ccgcagcggc actcgtcgtc gcggttcgaa       480
     ccgtcgcggt acacacagat ttccaagttg ccggggtttg acgacgtgcc gccggaggag       540
     cagatttctc tattcatagc gaaggtcgac cagtgcaata tcatgtttga cttcagcgat       600
     ccgagttttg acatccatgg gaaagagatc aaacgcatca cgctgcagga gctaattgag       660
     tttatcgtga ccaaccggtt cacgtacacg gaggagatgt acgggcacgt cgtaaatatg       720
     ttcaaggtta accttttcag gcccatcccg ccgcctgtga atccgattgg agacgtgtac       780
     gaccccgacg aagacgagcc ggtcaacgag ctggcctggc cgcacatgca atgtgtctat       840
     gagttcttct tgcgtttcgt ggagtcgcca gacttcaacc accagattgc aaagcagttc       900
     attgaccagg agttcattct aaagctcctc gagctattcg atagcgaaga tatccgcgaa       960
     cgggactgcc tcaaaaccac gcttcacagg atctacggca agttcttgtc tctccggtcg      1020
     tttatccgcc gctccatcaa caacattttc cttcagtttg tctacgagac agagcgtttt      1080
     aatggtattg cagagttgtt ggagatcctc ggttccatca tcaacggatt cgcattgccg      1140
     ttaaaagaag aacacaaggt attccttgtc cgcatcctaa ttccattgca taaagttcgc      1200
     tgtttatcgc tctatcaccc ccagttggca tactgtattg tgcagttctt agagaaagag      1260
     ccgatgctga ccgaggaagt cattatgggt ttgctacgct attggccgaa agtgaattct      1320
     accaaagaaa ttatgttttt gaatgaaatc gaggatatct ttgaagtcat tgaaccgcta      1380
     gagttcatta aagttgaagt gcctctattt gtccagctag caaaatgcat ctcctcacca      1440
     catttccagg tggcagagaa ggtgctcagt tactggaata acgaatactt tctaaatcta      1500
     tgcattgaaa acgcagaggt aatcctgcct atcattttcc ccgcgctgta tgagttgacc      1560
     tcccagttag acttagactc tcaaaccgat gaagagggca atccaaatca ggacccctac      1620
     atgctagttg agcaagccat aaactccggt tcatggaatc gggctattca tgcaatggct      1680
     ttcaaagcat taaagatatt tctcgagaca aacccggttc tctatgagaa ttgcaactct      1740
     ctctaccttt cgagtctgaa ggaatcccaa aagcgccgtg agaagcgcga agaaaactgg      1800
     aacaagctac aggagtatgt aaggaacttg cacatcagca gtgtagataa tcctgtcgcg      1860
     gtagacagga tagggacggg ggatcttcat taa                                   1893
//

If you have problems or comments...

PBIL Back to PBIL home page