(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE144

ASHGO_5.PE144        Location/Qualifiers
FT   CDS_pept        246099..248480
FT                   /codon_start=1
FT                   /gene_family="HOG000234202" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756878"
FT                   /gene_name="CLA4"
FT                   /locus_tag="AEL205W"
FT                   /product="Serine/threonine-protein kinase CLA4 "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS52480.1"
FT                   /db_xref="EMBL:AAG17720.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR015750"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000006B481"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HFW2"
FT                   /transl_table=1
FT                   /translation="MSLSAAARELSESDFQDIGPAPKPPPVAYNQTKPLVNYMSQMDLG
FT                   AKSGGKMRAVQRKKSGWVSYKDDGLLSFLWQKRYMVLNDNYLSLYKGDSGREDAVVQIP
FT                   LTSIVSVSRNQLKQNCFEVVRSSDRSGAPAAGAGGDSSKKSVFIATKTELDLHTWLDSI
FT                   FSKCPLLSGVSSPTNFTHKVHVGFDPETGSFVGMPFNWEKLLKHSRITGEDWNNNSAAV
FT                   IQVLQFYQEYNNGTATPTAQAAAQAAGAPGRPPMLTLSSNSSQASMQQIASTPPYSGGE
FT                   MIPQRKAPTPPKPVVTSGSAIPSAKGGPNVGVTTSPSVHHQNTQHGKQQSPTQSGPPKS
FT                   LPPLHRDEEGPTAPLGNSVSSVATKESPTERLLNNLSETSLMQKQLPAKPVAPPSSVGP
FT                   VAPPLRLQPQRVAPGRPAQPGPHAPDTRPGGPNAMKQQHGPPAAASGQLGPDSKKPEGA
FT                   PGHPTAVAKKKKAGRPTMSNAEIMTRLAAVTFNTDPSPFFQMIEKAGQGASGSVYLAQR
FT                   LKIPPYDENSGVSQHELNDNIGDKVAIKQMILSKQPRKELIVNEILVMKDSQHKNIVNF
FT                   LEAYLKTEDDLWVVMEYMEGGSLTDVIENSIGSDASESPMTEPQIAYIVRETCQGLKFL
FT                   HDKHIIHRDIKSDNVLLDTHGRVKITDFGFCAKLTDKRSKRATMVGTPYWMAPEVVKQR
FT                   EYDEKVDVWSLGIMTIEMLEGEPPYLNEEPLKALYLIATNGTPKLKHPELLSLEIKRFL
FT                   SVCLCVDVRYRASTEELLHHSFFETSCEPEELANLLKWKK"
     atgtcgctgt cggccgctgc gagagagctg tccgagtcgg acttccagga tattgggccg        60
     gcgcccaaac cgccgcctgt ggcgtacaac cagacgaagc ccttggtgaa ctatatgagc       120
     caaatggacc tcggagcgaa gagcggaggc aagatgcggg ctgtgcagcg caagaagtcg       180
     gggtgggtgt cgtacaagga cgacgggctg ctgtcgtttc tttggcagaa gcgctacatg       240
     gtgctgaacg acaactacct ttcgctgtac aagggcgact cggggcgcga ggacgcggtg       300
     gtgcagattc cgctgacgtc gatcgtcagc gtatcgcgga accagttgaa acagaactgc       360
     tttgaggttg ttcggagcag cgaccggtcg ggcgcgcccg cggccggcgc gggcggcgac       420
     tcgtccaaga agtcggtctt cattgcgacg aagaccgagc tggacctgca cacctggctg       480
     gactcgatct tttccaaatg tcctctgctc agtggtgtct catcccccac caatttcacc       540
     cacaaagtgc acgtgggttt tgatccggag accggttcct ttgtaggcat gccgttcaac       600
     tgggagaagc tgctgaagca ttcgcggatc actggcgagg attggaacaa caattctgcc       660
     gctgttattc aggtcctgca attctaccag gagtataata acgggaccgc aacacctacg       720
     gctcaggccg cggctcaggc tgctggtgca cctggccgtc cgccgatgtt gactctgtcg       780
     tctaacagct cgcaggcctc tatgcagcaa atagcctcta cgcccccata ttcgggcggc       840
     gaaatgatac cccagaggaa ggcgcccacg cctccaaaac ccgtggttac ttcggggtct       900
     gcgatccctt ccgctaaagg aggcccaaat gtcggcgtca caacttcgcc aagtgtgcac       960
     catcaaaata cgcagcatgg caagcagcaa tcgccaacgc agagtggtcc tccaaagtca      1020
     ctacctcctt tgcaccgtga tgaggaggga ccgactgctc ccttgggaaa ctccgtatct      1080
     tcggttgcta ctaaggagtc cccaactgaa aggttgttga acaacctttc agaaacttcg      1140
     cttatgcaga aacagcttcc tgcgaagcct gttgcgccgc catcttcggt cggccccgtt      1200
     gctccgccat tgaggttaca gccgcaacgc gtggcgccag gtaggcccgc tcagccaggt      1260
     cctcacgcgc cagatacccg tcctggtggt ccaaacgcta tgaaacagca gcatggtccg      1320
     ccggctgctg ccagcggtca attgggccca gattcgaaga agccagaagg ggcccctggg      1380
     catccgacgg cagttgccaa gaagaagaag gctggaaggc caactatgtc caatgctgag      1440
     attatgacta ggctggcggc tgtgaccttc aacacagatc ccagcccatt ttttcaaatg      1500
     attgaaaaag ccggtcaagg tgcaagtggg tctgtttatt tggcgcagag attaaaaata      1560
     cccccatatg atgagaattc tggtgtaagt cagcatgagt tgaatgataa catcggtgac      1620
     aaggtggcga tcaaacagat gattctttct aaacaaccac gtaaggaatt gatagttaat      1680
     gaaattttgg ttatgaaaga ttcgcaacat aagaatatcg tcaacttttt ggaagcatat      1740
     ttgaaaacag aggacgattt gtgggttgtc atggaataca tggaaggcgg gtctttgacg      1800
     gatgttattg aaaactccat tggcagtgat gcctctgagt ctccaatgac tgagcctcaa      1860
     attgcataca ttgtccgcga gacgtgtcag ggtttaaagt ttctacatga caaacatatc      1920
     attcataggg atatcaagtc ggataacgtg cttctagata cacatggtcg cgttaaaatc      1980
     accgatttcg gcttttgtgc taagttaact gataagagaa gcaagagagc aacaatggta      2040
     ggtactcctt actggatggc acctgaggtt gtcaaacagc gggaatatga tgagaaggtt      2100
     gatgtttggt ccttaggaat catgacaatt gagatgctag aaggtgagcc tccgtacttg      2160
     aatgaagagc cattaaaagc attgtattta attgcgacaa atggtacacc caagttgaaa      2220
     catccagaac tcttgtcctt ggaaataaag cgtttcctaa gtgtttgtct ttgcgttgat      2280
     gtcagataca gagcttctac tgaggaattg ttacaccatt ctttctttga aacgagctgc      2340
     gagccagagg agctggcaaa cctactaaag tggaaaaagt aa                         2382
//

If you have problems or comments...

PBIL Back to PBIL home page