(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE15

ASHGO_5.PE15         Location/Qualifiers
FT   CDS_pept        26839..27468
FT                   /codon_start=1
FT                   /gene_family="HOG000212457" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18080750"
FT                   /gene_name="YTH1"
FT                   /locus_tag="AEL331W"
FT                   /product="mRNA 3'-end-processing protein YTH1 "
FT                   /function="RNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52353.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG210860"
FT                   /db_xref="HOGENOM:HBG330017"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniParc:UPI0000252C21"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758T3"
FT                   /transl_table=1
FT                   /translation="MSLVHPDTSNYPFRFAPFLRQEYSFSLDPDRPVCQYYNSKEGASS
FT                   CPNGTLCPNKHVLPIFQNKIVCKHWLRGLCKKNDQCEYLHEYNLRKMPECVFFTKNGYC
FT                   TQSPECQYLHIDPTSKVQQCEDYRMGFCPLGTACPCKHVKKIICPKYVTGFCPLGRDCD
FT                   WEHPPFYVPNELSKIRIKRDDEINTKKLDEEKERRLNAIINGELVI"
     atgtcgctag tacatccaga tacatctaat tatccttttc ggtttgcacc gtttcttcgg        60
     caggaatatt ccttctctct tgatcccgac agaccagtat gccaatacta caactccaag       120
     gaaggcgctt cctcatgtcc caacggcacg ctgtgcccca acaaacacgt cctgcccata       180
     tttcagaaca aaatcgtctg caagcactgg ctgcgtggac tgtgtaagaa gaacgatcaa       240
     tgcgagtacc tacatgaata caacttacgc aagatgcccg agtgtgtgtt cttcacgaaa       300
     aacggttact gcacacagag ccctgagtgc caatacctgc atatagaccc cacgtccaag       360
     gttcaacagt gcgaggacta ccgcatgggc ttctgtccat tgggaaccgc ctgtccgtgc       420
     aagcacgtta agaagatcat ctgcccgaaa tacgtgacgg gcttctgccc gctgggccgc       480
     gactgcgact gggaacatcc gccgttctac gtacccaatg agctcagcaa gatccgcatt       540
     aagcgcgacg acgaaatcaa taccaagaag ctcgacgagg agaaggagcg gcgcctcaac       600
     gccatcatca acggggagct agtcatataa                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page