(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE157

ASHGO_5.PE157        Location/Qualifiers
FT   CDS_pept        268941..271739
FT                   /codon_start=1
FT                   /gene_family="HOG000184434" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19776715"
FT                   /locus_tag="AEL193W"
FT                   /orf_name="AGOS_AEL193W"
FT                   /product="AEL193Wp"
FT                   /function="binding"
FT                   /function="structural molecule activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="COPI vesicle coat"
FT                   /protein_id="AAS52492.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030126"
FT                   /db_xref="HOGENOM:HBG022373"
FT                   /db_xref="HOGENOM:HBG631201"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013040"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR014863"
FT                   /db_xref="InterPro:IPR015873"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017106"
FT                   /db_xref="UniParc:UPI0000252CA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q758F5"
FT                   /transl_table=1
FT                   /translation="MSTHTYKSGFRVTVSNKAPEEAQAGHLPDKMTVYQDCLNEFNESP
FT                   VKPARCRMLIGKLLKLLSHGETFPANESTALFFSISKLFQHPNNSLRQAVYLALKELCR
FT                   NSEDVLMATSSVMKDVQNGTDLVKPNAIRALTRVLDASTAFSAERLYKSAVVSKDPSIS
FT                   SAALVSSYHMLPIAESTVKRYANETQEAVSDLKTYPHSAGPTDFYRVSSYISQYHALGL
FT                   LYKLKSHDKIAMMKLIQQFSANNVLRNQLAQVQMVRLVHELLRMDNQLVPQFVPQLQSW
FT                   LTSRYDAVKLEACKLISSLNSYMPSDIHTAMIHTLQGMLSVPQVCSRFAAVRLLNSISM
FT                   TAPEKVIICNPELESLINDSNRNISTYAITTLLKTGTSKNISSLIKTITKFIHEVSDDF
FT                   KVIIIDAIRTLSLKFPDEWKNILSFLIDTLKSAEGGYTFKNNIVDALFDLIQHVPQSRE
FT                   QALEHLCDFIEDCEFNEISVRIIYLLGKEGPSTEKPSLYVRHHYNRVVLENSIIRSAAV
FT                   SALSKFSSPKKDPSLAYSIEKLLKGIQTDEDDEVRDRATILVKLLEENKEKPGVADEFI
FT                   QPKHSYDLHALESKLTNYLHHNEDGFATPFDASSIPKYTEEELKAINLKQKQQQFFANA
FT                   EPSNSGKKTSGSDPKLSASATDIAAEAVQPSSIDYAEQLSSIEEFASYGAIIHSSKPIP
FT                   LTEPEAEFTVAGVKHLFQDHLVLQFNITNTLTDVALDKVTVICTPEEDAEMTELCAIPL
FT                   DRLLPGDTGSCFISYEKPTATTVGFFNNLNFTTLELDPATNAPFEGDEGFQDEYEIDAL
FT                   YLQPGDYIKSVFVGDFAATFEELPHEEVAVYNLSQSGASLQDIVNKLVLSTNCLPLENS
FT                   QFVSTESNSAVVKLFGKHITSEDRVALLVRLIKSTKGIALKVQCKSDSAELCGDLANGL
FT                   VL"
     atgtcaacgc atacgtataa gtctgggttc agagtgacag tgtcgaacaa ggcgcccgag        60
     gaggcccagg cgggacacct gccagataaa atgacagtgt accaggactg tctcaacgag       120
     ttcaacgagt ctccggtgaa gccggcgcgg tgccggatgt tgattggcaa gctgctaaag       180
     ctgctctcgc acggggagac gtttccggcg aacgagtcga cggcgctgtt tttctccatc       240
     tcgaagctgt tccagcaccc caacaactcg ctgcggcagg cggtgtacct ggcgctcaag       300
     gaactgtgcc gcaactcgga ggatgtgttg atggcgacgt cgtcagtgat gaaggacgtg       360
     cagaacggga cggacctggt gaagccgaac gcgatccggg ctctgacgcg tgtgctggac       420
     gcctcgacgg cgttttcagc ggagcgtctg tacaagagcg ctgtggtgtc gaaggacccg       480
     tcgatctcct ctgctgcgct ggtgtcgtca taccacatgc tgccaatagc ggagtctact       540
     gtgaagcgct acgcgaacga gacgcaggag gctgtgtccg acctgaagac ctatccacac       600
     agcgcgggcc ccacggactt ctaccgcgta tcatcgtaca tctcacaata ccacgcgctg       660
     gggctgttgt acaagctgaa gtcgcacgat aagatagcca tgatgaagct gatccagcag       720
     ttcagcgcca acaatgtgct aagaaaccag ctggcccagg tgcagatggt ccgtttggtg       780
     catgagctgc tacgcatgga taaccaattg gtgcctcagt ttgttccaca gctacagtcc       840
     tggctcacta gccggtatga cgccgttaag ctcgaggcat gcaagcttat ttcttctttg       900
     aacagttaca tgccttcaga catacacact gcaatgatcc acacactgca ggggatgttg       960
     agtgtgccac aggtgtgttc taggtttgca gcagttcgct tgttgaacag catttcgatg      1020
     actgctccag aaaaggttat catctgtaat ccggagttgg aatcattgat aaacgactct      1080
     aatagaaaca tttcaactta tgccatcacc actctgttga agactggcac ctcaaaaaat      1140
     atatcgtctt tgatcaaaac catcaccaag tttattcatg aagtgtccga cgatttcaag      1200
     gtcatcataa tcgacgcaat tcgtactttg tcgctaaagt tcccagatga gtggaagaat      1260
     attctatcct ttttaattga cactttgaaa agtgcagagg gtgggtatac attcaaaaat      1320
     aatatcgtag atgcgctgtt tgacctgatc caacatgtac ctcagtcaag ggaacaggct      1380
     ctggaacact tgtgtgactt tattgaggac tgcgagttca atgaaatctc agtcaggatc      1440
     atttacttat tgggtaagga gggcccctcg acagaaaagc cttcgcttta cgttagacac      1500
     cattacaaca gagttgtctt ggaaaattca atcatcagat ctgctgctgt tagcgcattg      1560
     tccaagtttt cctctccgaa gaaagatccg tcgttagctt attccatcga aaaattgcta      1620
     aagggtatcc aaaccgatga ggatgacgaa gtgagagaca gggcaaccat tctagtaaag      1680
     ctccttgagg agaacaagga aaagcctggt gttgccgatg aatttattca gccaaagcat      1740
     agttacgatc tacatgccct ggaaagtaaa ttaacgaact atctccacca taatgaagat      1800
     ggctttgcca caccatttga cgcgtcgagc attccaaagt acacagaaga ggagctcaag      1860
     gctattaatt tgaagcagaa acagcagcag ttctttgcca atgccgagcc gagcaacagc      1920
     ggcaagaaaa cctcaggcag cgatcctaag ctatcggcgt cggctactga tatagccgcc      1980
     gaagctgtcc agccttcgag catcgactat gcggagcagc tctcctcaat agaagaattt      2040
     gcctcctatg gcgccattat ccatagctcg aagccaatac ccctcactga gccagaagca      2100
     gagtttaccg ttgctggtgt caagcatttg ttccaggacc accttgtgtt gcagttcaac      2160
     attacaaata ctttaactga cgtggccttg gacaaggtta ctgttatttg cacaccagaa      2220
     gaggatgctg aaatgacaga gctctgcgcc atcccattag acagattgtt gccgggcgac      2280
     accggttcct gcttcatctc atacgagaaa ccgacggcaa ctacggtggg cttctttaac      2340
     aacctcaact tcaccactct ggagcttgat cctgctacca atgctccgtt cgagggcgat      2400
     gaaggcttcc aagatgagta cgagattgat gccctatacc tccagccagg ggactacatc      2460
     aaatccgttt ttgttggtga ctttgccgct acgtttgagg agctaccaca cgaggaggtg      2520
     gcagtttaca acctatcgca gtcaggcgca tccctgcagg atatagtgaa caagctcgta      2580
     ttatcgacca actgcttgcc gctcgaaaac tcccagtttg tgtccaccga atcaaattcc      2640
     gcagttgtca agcttttcgg aaagcacatc actagcgagg atcgcgtcgc cctccttgta      2700
     agactcatta agagcaccaa gggtatcgcc ctgaaggtcc agtgtaaaag cgacagcgcg      2760
     gagctttgcg gtgaccttgc caacgggttg gtgttgtaa                             2799
//

If you have problems or comments...

PBIL Back to PBIL home page