(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE16

ASHGO_5.PE16         Location/Qualifiers
FT   CDS_pept        complement(27520..28548)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15755768"
FT                   /gene_name="ISR1"
FT                   /locus_tag="AEL330C"
FT                   /product="Serine/threonine-protein kinase ISR1 "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS52354.2"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058943"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00005C9357"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758T2"
FT                   /transl_table=1
FT                   /translation="MSAWASQEAAKEEEAVGDFARMLERRDAGLLARVLSRAQTGPEAY
FT                   VRGLWRAEVGLERWRLTRVLGCGSVACVFELGDGALALKVPTSRRKAPVLLHEVLIYSH
FT                   LAQQAGGRLAERHVVPFHGVAAVTRREYRRLRGGEVVPALVLERMDTTLEAVHRRAAVS
FT                   KGQWWRYARDLVAALQFLRESCVVHGDIKTANVLVRGQDAFLADFTSAAVCDAAPEPLT
FT                   TTLEYCAPGLIGGGQPTHSTDVYAAGLCLLALITRFEPFRELSMMKSHSSAPTHSLHET
FT                   QWLMNAISKGDPIKYNVLSQDLYDRWAEELHFLRRFFVPAAQDALSRWLAESNARVAEH
FT                   AF"
     atgagcgcgt gggcatcgca ggaggcggcc aaagaggagg aggcggtggg ggacttcgcg        60
     cggatgctgg agcggcggga cgcagggtta cttgcgcgcg tgctgtcgcg cgcgcagacc       120
     ggaccggagg cgtacgtgcg cgggctctgg cgggccgagg tggggctaga gcggtggcgg       180
     ctgacgcgcg tgctcgggtg cgggtctgtg gcgtgcgtgt tcgagctggg cgacggcgcg       240
     cttgcgctca aggtgccgac gtcgcggcgg aaggcgccgg tgcttttgca cgaagtgctc       300
     atatactcgc acctcgcgca gcaggcgggc gggcggctcg cggagcggca cgtggtgccg       360
     ttccacgggg tggcggcggt gacgcgtcgg gagtaccggc ggctccgcgg tggcgaggtg       420
     gtgccggcgc tggtgctaga gcggatggac accacgttgg aagcggtgca ccggcgcgcg       480
     gccgtgagca agggccagtg gtggcggtac gcacgtgacc ttgttgcggc gctccagttc       540
     cttcgcgaga gctgcgtggt gcacggggac atcaagaccg cgaacgtgct cgtgcgcggg       600
     caggacgcat tcttggcgga cttcacgtcg gcggcagtgt gcgacgcggc gccggagccg       660
     ctcacgacga cgcttgagta ctgcgcgccg ggcttgatcg gcggcggcca gccgacgcac       720
     agcacggacg tgtacgctgc ggggctctgc ttgcttgcgc ttatcacgcg gttcgagccg       780
     ttccgcgaat tgtcgatgat gaagtcgcac agcagcgcgc cgacgcattc gttgcacgag       840
     acacagtggc tcatgaatgc catctccaag ggcgacccga tcaagtacaa cgtactcagc       900
     caggacctct acgaccggtg ggcggaggaa ctccacttct tgcggcggtt cttcgtaccc       960
     gcggcgcagg acgcgctttc gcgctggctc gccgagtcga acgcgcgcgt ggcggagcat      1020
     gcattctaa                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page