(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE165

ASHGO_5.PE165        Location/Qualifiers
FT   CDS_pept        complement(290357..291904)
FT                   /codon_start=1
FT                   /gene_family="HOG000216658" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756888"
FT                   /locus_tag="AEL185C"
FT                   /orf_name="AGOS_AEL185C"
FT                   /product="AEL185Cp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS52500.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG333050"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015729"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI0000252CB0"
FT                   /db_xref="UniProtKB/TrEMBL:Q758E7"
FT                   /transl_table=1
FT                   /translation="MESSQAECLPEIKELELGETIGQGTFAFVKTASLRADPQTIVAVK
FT                   FVHVERCKARGMTDEDLTREVVLQTRCAGHRHVVRVLDCNVSREYLWIAMELADGGDLF
FT                   DKIEPDVGVDSEVARFYYQQLVRALTHLHEACGVAHRDIKPENMLLDRAGNLKVADFGL
FT                   ATRFRRRDGTRRLARDRRGTLPYLAPEVVGERAYHADTADIWSAGVLVFVLLTGETPWS
FT                   EPSVDDGMFRAFVADGGNLSDGPWGKIGLVELNLLRKMLQQRPAARATLAQLRQHPWFK
FT                   APVVFADPDGMCADPAQLARRLLFKLRVPLSDAAYVQFTQDAPCSGPALTATQPVENEL
FT                   AHLEHDSYNSKTPIFSQCNLDRATADELQKRPATQSVRFDREVAVMQFRDEVDPTLSFD
FT                   FNPAKFTKFFTADDMASVLPQLEFALRESSIPVRAGMYDSFCELERIMGADKVFPVSID
FT                   IKARDRKGWLLSGIVCIREVADGLKVVCFERKAGDPLEWRRLFKRIALFCRHLIYIA"
     atggagtcgt cgcaggctga atgcctgccg gagattaagg aactagagct cggggagacg        60
     attgggcagg gcacgttcgc gttcgtcaaa accgcctcgc tgcgcgcaga cccgcagacg       120
     atagtggctg tgaagttcgt gcacgtcgag cgctgcaaag cgcgagggat gacggacgag       180
     gatctgacgc gcgaggtggt gctgcagacg cggtgcgcgg ggcaccgaca tgtggtgagg       240
     gtgctggact gcaatgtgtc acgtgagtac ctatggatcg cgatggagct ggcggacggg       300
     ggcgacctgt tcgacaagat cgagccggac gtgggggtgg actcggaggt ggcgcggttc       360
     tactaccagc agctggtgcg ggcgctgaca cacctgcacg aggcgtgcgg cgtggcgcac       420
     cgggacatca agccggaaaa catgctgctg gaccgggcgg ggaacctgaa ggtggcggac       480
     ttcgggctgg cgacgcggtt ccggcggcgc gacgggacgc ggcggctggc gcgcgaccgg       540
     cgggggacgc tgccgtacct ggcgccggag gtggtgggcg agcgggcgta ccacgcggac       600
     acggcggaca tctggtctgc gggagtgctt gtgtttgtgc tgctgactgg ggagacgccg       660
     tggagcgagc ccagcgtgga tgacggcatg ttccgggcgt ttgtggcgga cggggggaac       720
     ttgagcgacg ggccgtgggg caagatcggg ctggtggagc tgaatctgct gcgcaagatg       780
     ctgcagcagc ggccggcggc gcgcgcgacg ctggcgcagc tgcgacagca cccatggttc       840
     aaggcgccgg tggtgtttgc ggacccagac gggatgtgtg cggacccggc gcagctagcg       900
     cggcgcctgc tgttcaagct gcgggtgccg ctgtcggatg ccgcgtacgt gcagttcaca       960
     caggacgcgc cttgctccgg cccggcgcta accgcgacgc agcctgtgga gaatgagctg      1020
     gctcatttgg aacacgactc gtacaattcc aaaacgccca tcttctcgca gtgcaatctt      1080
     gaccgcgcca cggccgacga gctgcagaag cggccggcca cgcagtccgt gcgcttcgac      1140
     agggaggtcg cggtgatgca gttccgcgac gaggttgatc cgacgctctc gttcgacttc      1200
     aatccagcaa agttcacgaa gttcttcacg gcagatgata tggcgtcagt gctgccacag      1260
     ctggaattcg cgctccgcga gtcctcgatt ccagtccggg ccggtatgta tgacagcttc      1320
     tgcgagctgg agcgcatcat gggggccgat aaagtcttcc ccgtcagcat cgacatcaag      1380
     gcgcgcgatc ggaagggctg gttgctttct ggtattgtat gcatccggga ggtggctgat      1440
     gggctcaagg ttgtgtgctt tgagagaaaa gcaggagatc ccctcgagtg gcggcgcctc      1500
     ttcaagcgca tagctctctt ctgtagacac ttgatataca tagcataa                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page