(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE167

ASHGO_5.PE167        Location/Qualifiers
FT   CDS_pept        complement(293068..294321)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756890"
FT                   /locus_tag="AGOS_AEL183C"
FT                   /product="AEL183Cp"
FT                   /biological_process="protein transport"
FT                   /protein_id="AAS52502.2"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG058946"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI0001DB29E9"
FT                   /db_xref="UniProtKB/TrEMBL:Q758E5"
FT                   /transl_table=1
FT                   /translation="MLPESRLASLYSDFRKLQELNPDGFQANVLTWKDHLMNTVWRDEL
FT                   LIEGGDELLERLSTKETGFPKSIDVAIDQLVMDRRLVPLGRFVRGPDFGLLSWVRWTLH
FT                   KVVDLSWRSRVRENGRYLRNCAYVNMDVLAARHGAVEGALEERVVARATRYTDLVFSRE
FT                   EFYGVVRESLRGRGEYDVVLADLDKHRKAILVDGDVVKVVMPAVRALVQPFGPDRVTAN
FT                   DRHIAEFKGSLRLVERQVQAIHGHVEETARALRGAVAAGAARDVQRRYLRMNKLAQASL
FT                   SRALNQFTNLMEIKDHIDKSVDNLHLVEVLSGASRALADINRQIGSLDDVERLLDDVHE
FT                   HMEDSERISGALTASVAEDDGELDSELAAMEQELQQELQQEETLLGVLERLQVSDREPQ
FT                   ALARSASPAKLAEPPQTL"
     atgttgccgg agtcaaggct tgcctcgcta tattccgact tcaggaagct gcaagagctc        60
     aatccagatg ggttccaggc taacgttcta acatggaaag accacctgat gaacacagtg       120
     tggcgggacg agcttctgat agaagggggc gacgagctgc tggagcgatt gagcaccaag       180
     gagacggggt ttccgaaaag catcgatgtg gcgatcgacc agctggtgat ggataggcgg       240
     ctggtgccgc tggggcgctt cgtgcggggg cccgattttg ggctgttgtc gtgggtgagg       300
     tggacgctgc acaaggtggt ggacctgtcg tggaggagcc gggtgcggga gaacggacgg       360
     tacctgcgga actgcgcata cgtgaacatg gacgtgctgg cggcgcggca cggcgcggtg       420
     gagggggcgc tggaggagag ggtggtggcg cgggcgacgc gatatacgga ccttgtgttc       480
     tcgcgggagg agttctacgg cgtggtgcgg gagagcctac ggggacgcgg ggagtacgat       540
     gtggtgctgg cggacctgga caagcaccgc aaggcgattc tagtggacgg agacgttgtg       600
     aaggtggtga tgccggcggt gcgcgcgctg gtgcagccgt tcgggcctga ccgcgtgacc       660
     gcaaacgacc gccacatcgc agagttcaag ggctcgctgc gattggtgga gcggcaggtc       720
     caagcgatcc acgggcacgt cgaggagaca gcgcgggcgc tgcgtggcgc ggtcgcggcg       780
     ggcgcggcac gcgatgtgca gcggcggtac ctgcggatga acaagctcgc gcaggccagc       840
     ctgtcgcgcg cgctcaacca gtttacgaac ctaatggaga tcaaggacca catcgacaag       900
     agcgtggaca acctgcacct ggtggaggtg ctgtcgggcg cgtcgcgcgc ccttgcagac       960
     atcaaccggc aaatcggctc gcttgacgac gttgagcggc tgttggacga cgtgcatgag      1020
     catatggagg acagcgagcg catctcgggc gcgctgacgg cgtcggtggc cgaggacgac      1080
     ggcgagctcg acagcgagct tgccgccatg gagcaggagc tgcagcagga gctgcagcag      1140
     gaggagacgc tgctgggcgt gctggagcgg ctacaggtca gcgaccggga gccgcaggcg      1200
     ctcgcgcggt ctgcgtcgcc ggccaagctc gcggagccgc cccaaacgct ataa            1254
//

If you have problems or comments...

PBIL Back to PBIL home page