(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE171

ASHGO_5.PE171        Location/Qualifiers
FT   CDS_pept        302174..303043
FT                   /codon_start=1
FT                   /gene_family="HOG000141793" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081024"
FT                   /locus_tag="AEL179W"
FT                   /orf_name="AGOS_AEL179W"
FT                   /product="AEL179Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS52506.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG104444"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI0000252CB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q758D1"
FT                   /transl_table=1
FT                   /translation="MELRVWKLWRRWERRQEVGRGTTCYVEVWQRKGVTCAVKRVRGDD
FT                   PSEHHNREVRAMLTKEYNILRSLHSVHVVAVVEQRLSKGWILLEYVPFCVQKVMRMDLA
FT                   PGAEERRCLLGQLVEGVAYLHSSGVVHRDLKLDNMMLAPDCHTLKLIDFGHAVKLQAGK
FT                   TKCYGIGGTEPLIAPEALNQLSYEGYPVDMWSIGIIMYMLFNDIADLRYPWRIARSSDE
FT                   AFLAYEEEGLLHISTEEHLCRRFLTPDPALRITAAEAVEIPFLQYNCDGHVHERTRRLC
FT                   QKFWGTYM"
     atggagctaa gagtctggaa attgtggagg cgatgggagc ggcggcagga ggtagggcgc        60
     ggaacgacgt gctacgtaga ggtgtggcag cgcaagggcg tgacgtgcgc agtgaagcgg       120
     gttcgagggg acgatccgtc ggagcaccac aaccgcgaag tgcgggcgat gctgaccaag       180
     gaatataaca tcctgcggag cctacacagc gtgcatgtgg tagcggtggt ggagcagcga       240
     ctatcgaagg ggtggattct gctcgagtac gtcccgtttt gcgtgcagaa agtaatgcgg       300
     atggatctag ccccgggggc cgaggagagg cggtgtctgc tggggcaact ggtcgagggc       360
     gtcgcatact tgcattccag cggcgtggtg catcgggacc tcaagctgga caatatgatg       420
     ttggcacccg actgccacac tctcaagctg atcgactttg ggcacgcggt gaagctgcag       480
     gcggggaaaa cgaagtgcta cggaatcggt ggcacagagc ctctgatagc gccggaggcg       540
     ctgaaccagc tgtcgtatga ggggtatcca gtggatatgt ggtctattgg aatcatcatg       600
     tatatgctat tcaacgatat agccgacctg cgatacccgt ggcgaattgc acgatccagt       660
     gacgaggcgt tcctagcata cgaggaagaa ggcctgctgc atatatctac ggaggagcat       720
     ttgtgtcgtc gctttctgac gcctgacccc gcgttacgta taacggctgc agaggcggtg       780
     gagatacctt ttctgcaata caactgcgat ggccatgtgc atgagcgaac tcgtaggttg       840
     tgtcagaaat tttggggcac atatatgtaa                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page