(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE173

ASHGO_5.PE173        Location/Qualifiers
FT   CDS_pept        complement(304264..305682)
FT                   /codon_start=1
FT                   /gene_family="HOG000248043" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18929704"
FT                   /gene_name="TIM54"
FT                   /locus_tag="AEL177C"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit TIM54"
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS52508.2"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058949"
FT                   /db_xref="HOGENOM:HBG397749"
FT                   /db_xref="InterPro:IPR021056"
FT                   /db_xref="UniParc:UPI0001DB2A09"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758C9"
FT                   /transl_table=1
FT                   /translation="MMGEFKHPPQEKQKMSSTKKAGYSNPAFAAMGIPALRLPGPKWCA
FT                   FWLVVGAGIAGVVYDKREQRRICKHYSSLVKDQGAAHMDTWLKPRRLTVFVAPPPGDYL
FT                   ETSMKVWRRYVKQVLFEAGLDYEVFTEERQGVIRHEVAERVRQLRRDIAAAEAAEQRAL
FT                   DEKRWLNRMRSWWRREKLSEEELERIRAQKFRDEFTYKQLLGVFYKNAPLREQKVWDAD
FT                   ALVEDPVLAGGVICIGRGAYKEYIAGIHEGTLGPLDPPTLTPEAPTELSAAAEDLTQAP
FT                   EQPEPSAAAEALKQAPEQAEHSPAEPDSAATDAPDEKSNNAPAPPPAPYVSPDEYSSLS
FT                   LSQELVGDVRHPSSHIPALFHQPLLVIPVPNLSGFLQTPRKIYRFYTRRYYAEECCKAA
FT                   AAMVLQTIRPFQPDDLNLGISEEEDWPRRWVEQGRERKSEWVQDLKADPRVIAELHVVD
FT                   PALMADLAATMNLN"
     atgatgggtg agttcaagca tcccccacag gagaagcaga agatgtctag cacgaagaag        60
     gctgggtaca gtaatccagc tttcgcggct atgggtatac cggctctgcg gttgcccggg       120
     cctaagtggt gcgcgttctg gcttgtggtt ggagccggca ttgctggagt ggtatacgac       180
     aaacgggagc agcggcgcat atgcaagcat tattcgtcgt tggtgaagga ccaaggcgca       240
     gcgcacatgg acacatggct caaaccgcgg cggctcacgg tgtttgttgc gcctcctccg       300
     ggcgactatc tcgagacgtc gatgaaagta tggcggcgat acgtgaagca ggtgttgttc       360
     gaagctgggt tggactacga ggtcttcaca gaagagcggc agggcgtcat ccgtcatgaa       420
     gtggcggagc gcgtacggca gctgcgccga gatattgctg cggcagaagc ggcggaacag       480
     cgggcactcg acgaaaagcg ctggttgaac cggatgagaa gctggtggcg ccgtgaaaag       540
     ctttccgaag aggagctgga gcgaattcgc gcccagaaat tccgcgacga gttcacctac       600
     aaacaactgt tgggcgtttt ctacaagaac gcgccactgc gtgaacagaa ggtatgggac       660
     gccgacgctc tggtggagga tcctgtcctc gcaggaggcg tgatctgtat cggccggggt       720
     gcctataagg aatacattgc aggaattcat gaaggtacac tggggccctt ggaccctcca       780
     accttaacac cggaggcacc tacagaactc tcggctgctg ctgaagatct cacgcaggct       840
     cctgaacagc ccgagccctc ggccgctgcg gaagctctca agcaggcccc tgaacaggct       900
     gagcactctc ccgctgagcc cgactcggcg gcgacagatg cgccagatga aaaatccaac       960
     aacgcacctg cacctccgcc agccccctac gtctcgcctg acgagtatag cagtctgtcg      1020
     ctctcacagg agcttgtcgg cgacgtccgc catccgtctt cgcatatacc agctcttttc      1080
     caccagcctc tgctggtcat tccggtgcct aacttgtcag gcttcttgca gactccacgg      1140
     aagatctacc ggttctatac acggcgctac tacgcggagg agtgctgcaa ggcagctgcc      1200
     gcaatggtct tgcagactat caggccattt caacccgatg atttgaacct gggcatctcc      1260
     gaagaagaag attggcctcg ccgctgggtt gaacagggcc gcgagcgcaa aagtgagtgg      1320
     gtacaggact tgaaggccga tccccgcgtt attgcggaac ttcatgtagt ggatccggct      1380
     ctcatggctg atttggcagc caccatgaac ttgaactga                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page