(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE177

ASHGO_5.PE177        Location/Qualifiers
FT   CDS_pept        312486..314081
FT                   /codon_start=1
FT                   /gene_family="HOG000113025" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19776717"
FT                   /locus_tag="AEL173W"
FT                   /orf_name="AGOS_AEL173W"
FT                   /product="AEL173Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS52512.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058952"
FT                   /db_xref="HOGENOM:HBG202197"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000252CBC"
FT                   /db_xref="UniProtKB/TrEMBL:Q758C5"
FT                   /transl_table=1
FT                   /translation="MVSRNREMSLVLYNRNNQNDTSIVVHDARTRSLVLFHEAAGRLSL
FT                   AASDSASYEGGRCPHCGHLLGLQSYFIHDQYFQLLEDLPRPGTVEAPDTFIPQNLFTQG
FT                   YYQNFFQELEVLGNGARGAVYKVEHTFLEHSLGVYALKKIAIGDDMAWLNKCIQEVKFM
FT                   NSITQDCLHLVKYNHVWLERTSSVGHVTAQAGANKTTTATDDVPYMFILQQFCPGGNLE
FT                   GVINTKVFQRLTGSESTEERKRLFRMRRRGLTGTRKGLSTRQVLSVASDLAHGLRELHS
FT                   LDIIHRDLKPSNCLLLGEYDPSSTENFPKILIGDFGESQLRGQLRTATGATGTLEFTAP
FT                   ELVLFEDDVRVKAMTSSAPQFTFESDMYSLGMILYFVVFGELPFGPGGDMRLLKTQIKK
FT                   YSCSASALQQRHSGYFLKPIDPRIFELISSLLSPSAADRPDADEAIAIINDILASCNSA
FT                   DAHVPAKGLVMHREAAMNLAVRSAQLAVSLAYMRWHYASPWNNLNLFLLGFSFNCSSST
FT                   RPYLLAITLALFLM"
     atggtgtcac gaaatcgcga gatgtcatta gtgctataca atcgtaacaa tcagaatgat        60
     acgtcgatag tggtgcatga tgcgcggacg cggtcgctcg tgctattcca cgaggccgcg       120
     gggcgactgt cgttggcggc atcagacagt gcaagctacg agggggggcg gtgcccacac       180
     tgcgggcacc tgctcggact acagtcttac tttatccatg accaatactt ccagctgctc       240
     gaggatttgc cgcggccggg cacggtggag gcgccggaca cgttcatccc gcagaacctg       300
     tttacgcagg gatactacca gaacttcttc caggagttgg aggtgttggg aaatggggcc       360
     cgcggagcgg tgtacaaggt ggagcacacg tttctggagc acagcctggg cgtttacgcg       420
     ctgaagaaga ttgccatcgg ggatgacatg gcgtggctca acaagtgcat ccaggaggtg       480
     aaattcatga actctatcac gcaggactgc ctccatcttg tgaagtacaa ccatgtgtgg       540
     ctggagcgga ccagctctgt ggggcacgta accgctcagg cgggcgcgaa taagactacg       600
     acggcgacag atgacgtacc atacatgttt atcctccagc agttttgccc cggcggtaac       660
     cttgaaggcg tcatcaacac caaggtgttc cagcggctta cgggcagcga gagcacggag       720
     gagcgcaaga ggcttttccg catgaggcgc cggggtctca cgggaacgcg gaagggcctg       780
     agcacgcgcc aagttttgtc tgtggcttca gatctggccc acggactgcg cgagctgcat       840
     tcgctagata tcatacaccg cgacctgaag ccgtcgaact gtctgctgct cggcgaatac       900
     gacccgtcgt ccacagagaa cttccccaag atcctaatcg gtgacttcgg ggaaagccag       960
     ttgcggggcc aactgcgcac cgctaccggt gccacgggca cgctcgaatt caccgccccc      1020
     gagctcgtgc tgtttgagga tgacgttcgc gttaaggcga tgacgtctag cgccccgcag      1080
     ttcaccttcg agtctgacat gtattccttg ggtatgattc tctactttgt ggtctttgga      1140
     gagctgccct ttggccctgg cggcgatatg cggctactca agactcaaat aaagaaatac      1200
     tcatgcagtg cctcggcgct gcagcagcga cacagcggtt acttcctcaa gcccattgac      1260
     ccccgcatct ttgagctcat aagcagcctc ctctccccct ctgccgcaga tcgcccggac      1320
     gcagacgagg caattgccat catcaatgat attctagcgt cctgtaactc tgctgatgca      1380
     catgtgcctg ccaaagggtt ggttatgcac cgcgaagccg ccatgaatct cgcggtacgc      1440
     tcagctcagc tggcggtaag ccttgcatac atgagatggc actacgcatc accttggaac      1500
     aatctcaatc tcttcctact gggcttttcc ttcaattgct ccagttctac caggccctac      1560
     cttttggcca ttactttggc ccttttccta atgtag                                1596
//

If you have problems or comments...

PBIL Back to PBIL home page