(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE19

ASHGO_5.PE19         Location/Qualifiers
FT   CDS_pept        33827..37231
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15755770"
FT                   /locus_tag="AGOS_AEL327W"
FT                   /product="AEL327Wp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52357.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG124794"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="UniParc:UPI0001DB294F"
FT                   /db_xref="UniProtKB/TrEMBL:Q758S9"
FT                   /transl_table=1
FT                   /translation="MEFERQENTSLPRASIQAIGALSVATDDLPKKHIDYPTREPGKYP
FT                   LRADEESKIGYASYDSEKPSEGADVSCTNESSGDAEHASDRPAESNADKTASEVKSANA
FT                   GEGFASDRVPDSREGEKLKGKRLNSDLQPTTAVDSSHADGLTNFPLVQEQEVAKNEPPT
FT                   TPGPPKGTDSIGLAAREVSQASHGGEKEDLKPDGSAYMEVAGSGDAPITPTPNSTPLKN
FT                   IPKPAGSIGTDDTRLMASDMEQGQDQQELLNRLQRPSMSYGPNTRRRSSLILKEHDSKT
FT                   PDIRAASTLQTTELKLELPENLDHEDFSKLFKLDAKNDDDLFSAEDLLAHGIGSQRRSS
FT                   EDDAAATRHKLDIEQSPRGSVSLTPEILDNKHMCTKTEDTNTSNEEGLSPRQHVAAKKT
FT                   GDSSQQLSISNNSMANPHTVKSSTHDGSVKFNYTTHLENTPASIIQGKNHLFYARRHNS
FT                   LTPMVSQPTNKHSPATFKPSPESERQTSTDINAGNHTEHSDGHILPAGQFMTSSHGSNL
FT                   AEEQSKISAYACLDFQNFTFYVQTLQVIIGRRSENDFAHKVDVNLGPSKSISRRHAKIF
FT                   YNFGTERFELSIMGKNGAFVDDTFVERGITVPLRNKSKIQIGQIPFQFVLPEQEGKEKH
FT                   VIPSKIKDTPTVKTESVKDPLDSQIKAPDISVTSKKKEKKPSKPPKPPKKVYSLEEIPP
FT                   EYRTKPTCSYSNLITTCLRKYSSPKGMSLSEIYAGIRELYPYYKYCPDGWQSSVRHNLS
FT                   LNKSFRKVSKEGKGWLWGLDEEYIAEREKQRKKQAEAQAAKAKAAELKQLQLQARKQAT
FT                   VSNNLASFTKQPNISQTLAANRSEKRILQDDNQRTMKYLQQQLILLTKDRKGLEKPVMA
FT                   QILTQALAMTINQVTQAAKNKGITGNPLTALIDKNPQHLNLILTAAVNAATVKVTDGKV
FT                   KKLVNMSPVSQVSAQNPALIAKQGSSKRASPPALRNILQKPPTPSIANPTSSSTLKAGE
FT                   PFDPTSLSKFFQPKQPVRLSVAGTPGHAGSRSNNGNLLPRKRSASDTESSDDDSDTSVN
FT                   EDSSDEDSGDSSDDNTGSSDSGTAGDDTSSSSTSDNGDDDDDDDDDDDDDDDDDDDDDD
FT                   DDDDDDEDDDDDDEDDDDDDQSSNITD"
     atggagttcg agcgtcagga gaacacatct ctgcctcggg catcgattca agcgattggc        60
     gcgctctctg tcgcgacgga tgaccttccg aagaagcaca tagactaccc gacccgcgaa       120
     ccaggaaagt atcccctacg tgccgatgag gaaagcaaaa taggatacgc tagctatgat       180
     agcgagaaac cttcggaagg tgcagatgtg agctgtacaa atgagtcgtc gggagacgcc       240
     gaacatgcaa gtgaccgccc agcagagagc aatgctgaca agacagcttc ggaagtaaag       300
     agtgctaatg caggagaagg ttttgcaagt gaccgagtgc cggactctag ggaaggcgaa       360
     aagctgaagg gaaagaggct aaattccgat cttcagccaa caactgctgt tgactcgtcg       420
     catgcggacg gtctaacaaa tttccctttg gtacaagagc aggaggtagc taaaaacgaa       480
     cccccaacaa cacctggccc gccaaaaggc accgattcta tcggcctagc tgctcgggaa       540
     gtttcacagg cctctcatgg tggcgaaaag gaagatttaa aaccagacgg ctcggcgtat       600
     atggaggtag cagggtctgg agatgctcca attacaccta caccaaattc tacaccgtta       660
     aagaatatac ctaagcctgc gggttctata ggaacggatg ataccagatt aatggcatcg       720
     gacatggagc aagggcaaga ccaacaagaa cttttgaata ggttgcagcg cccatccatg       780
     tcatatggac ctaacacgag gcgccgcagc agtttaattc taaaagagca tgacagcaag       840
     accccggata tacgagccgc gtctactctt cagactacag agttaaaatt ggagttacca       900
     gaaaatctag atcatgaaga tttttcgaag ctatttaagc tagatgccaa gaacgatgat       960
     gatttgtttt cagcagaaga tcttttagct catggaatcg gatctcaacg gcgttcctca      1020
     gaagatgatg ccgcggctac caggcataag cttgatatag aacaatcgcc gcgtggatca      1080
     gtctctctta cacctgaaat tctggataac aagcatatgt gtaccaaaac tgaagacacg      1140
     aacacgagca acgaagaagg cctatctcca aggcagcatg tcgcagccaa gaaaactggt      1200
     gattcatcgc agcagctgag tatttctaat aattcaatgg ccaatccaca cacagtcaaa      1260
     agcagcacac atgatggttc tgtgaaattt aattatacca cacatttgga aaacacacca      1320
     gcatcaatta tccaaggtaa gaaccatctg ttttatgctc gaagacataa ctcattaact      1380
     ccaatggtct cgcaaccaac caacaagcat tctcctgcaa cctttaaacc atcgccggaa      1440
     tctgaacgcc agacgagtac agacataaat gcaggtaatc atacggaaca ctcagatggg      1500
     catattcttc cagcaggtca gtttatgacg tcatcccatg gttcgaatct tgctgaagaa      1560
     caatctaaaa tatctgcata tgcatgtctt gactttcaaa acttcacctt ttatgtccag      1620
     acccttcaag ttattatcgg taggcgatca gaaaatgact ttgctcataa agtggacgtt      1680
     aacttaggtc cgtcaaaatc tatatccagg agacatgcga aaatattcta caattttggg      1740
     acagaaagat ttgaactgtc gataatgggg aaaaatggtg cctttgtcga tgacacgttt      1800
     gtagaacgtg ggattactgt acctttaagg aacaaaagca aaattcaaat tggtcaaata      1860
     ccgtttcaat ttgtcttacc tgaacaggag ggcaaagaaa agcatgtaat accctcgaaa      1920
     atcaaggata caccaactgt taaaacagaa tctgtaaagg atccgcttga cagtcagatc      1980
     aaggcgccag atattagcgt cacttcaaaa aagaaggaaa agaagccttc aaaaccacca      2040
     aaacctccca aaaaggtata ttcattagaa gaaataccgc cagaatatcg tactaagccg      2100
     acgtgttctt attctaattt gattacgaca tgtttgcgaa agtattcttc tcctaaaggc      2160
     atgtctctgt cagagatata tgccggtatt agggaactgt atccatatta taaatactgc      2220
     cctgacgggt ggcaaagttc ggtgagacat aacttgtcat tgaataaatc cttccgaaag      2280
     gtttccaagg aagggaaagg atggttatgg gggttagacg aggaatatat tgcagaacgt      2340
     gagaagcaga ggaaaaagca agccgaagca caagctgcca aggcaaaggc tgcggaacta      2400
     aaacaattac agttacaagc cagaaaacaa gcaactgtgt ccaataattt agcatcgttt      2460
     accaaacagc ctaatatttc acaaaccctt gcggctaacc ggtcagaaaa gcgtatatta      2520
     caagatgata atcagcgcac catgaaatat ctacagcagc aacttatatt actcaccaag      2580
     gaccgcaaag gtctagaaaa gcctgttatg gctcagattt taacacaggc tttggctatg      2640
     actatcaacc aggttacaca ggctgcgaag aataagggaa tcacgggtaa tccacttaca      2700
     gcgctaatcg ataagaatcc gcagcaccta aacctgattt tgacagctgc tgtcaatgct      2760
     gctacagtaa aagttacaga cggaaaagtg aaaaagctcg tcaatatgtc ccctgtgagt      2820
     caagtttctg ctcaaaatcc agcattgatt gcgaagcagg gttcttcgaa aagggcttct      2880
     ccgccggcac ttcgtaacat tctccaaaag ccgccgacgc caagcattgc aaaccctacg      2940
     agctcatcca cgctaaaagc tggtgaaccg tttgatccca catctctatc aaagttcttc      3000
     caacctaagc agcccgtcag gctctctgtg gcgggcaccc caggccatgc gggctcgcgt      3060
     tctaacaatg gcaatctttt acctcggaaa cggtcggcca gtgacacaga atcaagtgac      3120
     gatgacagtg acactagcgt caatgaagat tctagcgacg aggattcagg ggattcaagc      3180
     gatgacaaca cgggttcttc tgactctggc actgcaggtg atgacactag tagtagctct      3240
     acgagtgaca atggagatga cgacgacgac gatgacgacg acgacgacga cgatgacgac      3300
     gacgatgacg acgacgatga tgacgacgac gacgacgacg aagacgacga cgacgacgac      3360
     gaagacgacg acgacgatga ccaatccagt aatatcaccg actag                      3405
//

If you have problems or comments...

PBIL Back to PBIL home page