(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE191

ASHGO_5.PE191        Location/Qualifiers
FT   CDS_pept        332422..332973
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756904"
FT                   /locus_tag="AEL159W"
FT                   /orf_name="AGOS_AEL159W"
FT                   /product="AEL159Wp"
FT                   /function="sequence-specific DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52526.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG058959"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI0000252CC9"
FT                   /db_xref="UniProtKB/TrEMBL:Q758B1"
FT                   /transl_table=1
FT                   /translation="MMEDKGKAAMPRLPISKCKRIAKTDPDYIMTTQAAYIATAFATEL
FT                   FVQAISEDAMAQAQLDGRRAGGRAARLTYNDLARSVAREERYAFLADVIPETKTLAHLV
FT                   RQNKVRYSAPLAQGQATLPFARRAVEGGESDAASEDEDVEEGELQKDLAEVAKMNQIVD
FT                   LDAESSAGEADGDENEPEDD"
     atgatggaag acaagggcaa agcggccatg ccgcggctac cgatctccaa gtgcaagcgg        60
     atcgccaaga cagacccaga ctatataatg acgacgcagg cggcgtacat tgcgacggcg       120
     tttgcgacgg agctgttcgt gcaggcgatc agcgaggacg ctatggcgca ggcgcagctt       180
     gacgggcggc gtgctggcgg cagggcggcg cgcctgacgt acaacgacct ggcgcggagc       240
     gtggcgcgcg aggagcggta cgcgtttctg gcggacgtga tcccggagac caagacgctg       300
     gcgcacttgg tgcgccagaa caaggtgcgg tactcggcgc cgctggcgca agggcaggcg       360
     acgctgccgt tcgcgcggcg cgcggtggag ggcggcgaga gcgacgcagc gagcgaggac       420
     gaggacgtgg aggagggcga gctgcagaag gacctggcgg aggtggcgaa gatgaaccag       480
     atcgtggacc tggacgcgga gagcagcgcg ggcgaggcgg acggcgacga gaacgagccc       540
     gaggacgact ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page