(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE20

ASHGO_5.PE20         Location/Qualifiers
FT   CDS_pept        complement(37423..38280)
FT                   /codon_start=1
FT                   /gene_family="HOG000091082" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15755771"
FT                   /locus_tag="AGOS_AEL326C"
FT                   /product="AEL326Cp"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="AAS52358.2"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="HOGENOM:HBG434372"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="UniParc:UPI0001DB2950"
FT                   /db_xref="UniProtKB/TrEMBL:Q758S8"
FT                   /transl_table=1
FT                   /translation="MQSIVESLRRSPLEQELYEDQSELQEDFVVGRVPFQRLTPRISVA
FT                   PVDRPYEFLRAHTDDSKNPDCRIKIAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTV
FT                   KKVIEINPFLLGTMAGGAADCQYWETWLGAQCRLHELKEKERISVAAASKILSNLVYEY
FT                   KGAGLSMGTMICGYTKKEGPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDTNYRWDLS
FT                   VEDALYLGKRSILAAAHRDAYSGGSVNLYHVTENGWVYHGNHDVGALFWEIKEKEKSFN
FT                   NVLG"
     atgcagagca ttgtcgaatc attgcggcgg tcgccgctag agcaggagct gtacgaggac        60
     cagtcagagc ttcaggagga cttcgtggtg ggccgggtcc cattccagag actcacccct       120
     cgaatctcgg tcgcacccgt ggaccgtccc tatgagttct tgcgtgcaca cacggatgat       180
     tcgaagaacc cagactgccg gattaagatt gcgcacggta cgacgacgct ggcgttccgt       240
     ttccaggggg gcatagtggt ggctgtggac tcgcgtgcaa cggctgggca atggattgcg       300
     tcccagacag tgaagaaagt gattgagata aacccttttc tacttgggac tatggcgggt       360
     ggtgcggccg actgtcagta ctgggagact tggttgggag cacagtgccg actacacgag       420
     ttgaaggaaa aggagcgcat ctcggtggcc gctgcgtcga agatcttgag caaccttgta       480
     tacgaatata agggcgcagg gttgtctatg ggaactatga tttgtggata cacgaaaaaa       540
     gaggggccaa ccatttacta cgtcgactcc gatgggaccc gtctaaaggg tgatctcttc       600
     tgcgtgggat ctgggcagac gttcgcatac ggtgtccttg atacgaacta ccgctgggat       660
     ctgagcgtcg aagatgcttt ataccttggt aaaagatcca tcctagcagc tgcacataga       720
     gatgcctact ccggtggttc ggtaaaccta taccacgtga ctgaaaacgg ttgggtctac       780
     catggcaatc atgacgtcgg tgccctcttc tgggagatca aggagaagga gaaatccttc       840
     aataatgtcc ttgggtaa                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page