(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE200

ASHGO_5.PE200        Location/Qualifiers
FT   CDS_pept        join(346738..346743,346893..347042)
FT                   /codon_start=1
FT                   /gene_family="HOG000230627" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19776721"
FT                   /gene_name="RPL39"
FT                   /locus_tag="AEL150W"
FT                   /product="60S ribosomal protein L39 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS52535.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG506293"
FT                   /db_xref="HOGENOM:HBG727906"
FT                   /db_xref="InterPro:IPR000077"
FT                   /db_xref="InterPro:IPR020083"
FT                   /db_xref="UniParc:UPI0000252CD2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758D8"
FT                   /transl_table=1
FT                   /translation="MAAKKSFKIKQKLAKAKNQNRPLPQWFRLKTNNTIRYNAKRRHWR
FT                   RTKMGI"
     atggctgcta agaagtcctt caagatcaag caaaagttgg ctaaggccaa gaaccagaac        60
     agaccattgc cacaatggtt cagattgaag accaacaaca ccatccgcta caacgccaag       120
     agaagacact ggagaagaac taagatgggc atctaa                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page