(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE209

ASHGO_5.PE209        Location/Qualifiers
FT   CDS_pept        361378..363000
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20624167"
FT                   /locus_tag="AEL141W"
FT                   /product="UPF0508 protein AEL141W "
FT                   /protein_id="AAS52544.2"
FT                   /db_xref="HOGENOM:HBG058968"
FT                   /db_xref="UniParc:UPI00015E166B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758A1"
FT                   /transl_table=1
FT                   /translation="MAPEKLMHVEQDHQIVLARLEKYLRLGQQCALAVQDPCVLHAFKV
FT                   EKLGWLARGLAEEHRLMLSRLARAGEAGGCAELVCAWLDGEGGVVGRYGALLVGCADLL
FT                   FESGMVRYQMRPRSEFLICVLQLYTKLEVLCGALAHDGLAQQLQNFEEAFVARWNRKNM
FT                   SLLLFDEVVDVLAVDAPFVSPPLFSLDNVVKRDFFELTLPKFGYTQLLVEVFQLDTGEI
FT                   AIFRVNSERLPYRADQGKRLLRQITSCGEPLTCIGRSLLFSTFRKSDLTVLEEMPSAMH
FT                   LTTRIDSDVHMVLRAVYQFEWDTFWRCTLHTMFSASPPSLGGIAAIASARRISHPPQNF
FT                   KIKHQKLAETLCCGTQGLGLQLQPSRPTTHERQLQDAGSDCSMQTSLLPPAPKLLSHAW
FT                   TAVPEESGEDSQSSSGYDNTPQQLQLFELEDSTSTRGSQNDSSLRLLELADSKRTDSGS
FT                   LVLQYPSFRSSIASSLHLRSPSPHSEDTASEGSARKRPQPDNGTRNAEHDDFEESFASH
FT                   KPENMKRRNAYLLQFLNHMRPAS"
     atggcgcctg agaagctgat gcacgtggaa caggaccacc agatcgtgct ggcacgcctg        60
     gagaaatacc tgaggctggg gcagcagtgt gccttggcgg tgcaggaccc ttgcgtgcta       120
     cacgcgttca aggtcgagaa actgggatgg ctggcacgcg ggctggcgga ggagcaccgg       180
     ctgatgctga gccggctggc gcgggccggc gaggcggggg gctgcgcgga gcttgtgtgt       240
     gcgtggctgg acggggaggg cggcgtagta gggcggtacg gcgcgctgct ggtgggctgc       300
     gcggacctgc ttttcgagtc ggggatggta cgataccaga tgcggccgcg ctcggagttc       360
     ctgatttgcg tgctccagct gtacacgaag ctggaggtgc tgtgcggggc gctggcgcac       420
     gatggcctcg cgcagcagct gcaaaacttc gaggaggcct tcgtagcgcg gtggaaccgg       480
     aagaacatgt cgctgctgct gtttgacgag gtggtggacg tgctggcggt ggacgcgccc       540
     ttcgtgagcc cgccgctctt cagcctcgac aatgtggtga aacgggactt cttcgagctg       600
     acactgccca agtttggtta cacgcagttg ctggtggagg ttttccagct ggacactggt       660
     gaaatcgcca tcttcagggt caacagcgag cggctgccgt acagggcgga ccagggcaag       720
     cggctgctga ggcagataac gtcctgtggc gagcccctga cgtgcatcgg gcgctcgctc       780
     ctgttttcga ccttccggaa gtcggacctg acggttttgg aggagatgcc ctccgctatg       840
     catctcacca cccgcataga tagcgacgtc cacatggttt tgagggcggt ctaccagttt       900
     gaatgggaca cgttttggcg gtgcacgctg cacacgatgt tcagtgcgtc gcccccctcg       960
     ctcggcggga tcgccgctat cgcctccgcc cggaggatct cgcacccgcc gcagaacttt      1020
     aaaataaaac accaaaagct ggctgagacc ctgtgctgtg gcacacaggg gctgggtctg      1080
     cagctgcagc catcgcgacc aaccacgcat gagcgccagc tccaggacgc ggggtccgac      1140
     tgctcaatgc agacctcgct gcttccgccg gcgccgaagc tattaagcca cgcgtggact      1200
     gctgtgcccg aggaatctgg cgaagactca cagtcatcca gtggctatga caacacccct      1260
     cagcaattgc agctcttcga gctggaagac agcaccagca cacgaggctc gcagaatgac      1320
     tcttcgttgc gactgttgga gctagccgac agcaagcgca cagattctgg gagtcttgtg      1380
     ctccagtacc cgtcattccg gagctcaatc gccagctcct tacatctgcg cagtccgtct      1440
     ccgcattctg aggacacggc atctgaggga tctgccagga agcggccaca gccagataac      1500
     ggcaccagga atgcagaaca tgacgacttt gaagaatcat ttgcatcaca taagcctgaa      1560
     aatatgaaga ggcggaatgc gtacctactg caattcttga accacatgcg acctgccagc      1620
     tga                                                                    1623
//

If you have problems or comments...

PBIL Back to PBIL home page