(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE231

ASHGO_5.PE231        Location/Qualifiers
FT   CDS_pept        395600..397921
FT                   /codon_start=1
FT                   /gene_family="HOG000113231" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756919"
FT                   /locus_tag="AEL120W"
FT                   /orf_name="AGOS_AEL120W"
FT                   /product="AEL120Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS52565.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058976"
FT                   /db_xref="HOGENOM:HBG202406"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016241"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI0000252CF0"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Y0"
FT                   /transl_table=1
FT                   /translation="MSNTYNVNPGLKRRDAPTLLQRNFAERVSVDTLISGEAGPPDEGG
FT                   SDGGEHNDEDEDTIYFKPKKIYRMEQESGSRQTLVRVYSETERSNFNEVTGKRMFDDWK
FT                   YRPLYYHEEETRPRCEGVGSVSAGSVRWGDMQDEYVPDLDFAAAVKAWQAEELKEEMPM
FT                   TRYQLWSEDESDFNLDSASSSMIIESSHAQVSPIPFPSSTGKSPVSAAHSLLTLNKALG
FT                   NRVGSRVFSPSNLESKAKHRSMYEWGSLLSISSATSIGDKFTQDDIRAITRKIPDDFLS
FT                   LPYTQRKKILMDIAPDKDYKAIMSVFKKYSLVSSSSFTHLSNHGSRRSRHGSMASQYLS
FT                   SFTPSSASFKPDERGSIVLGHRLGKIIGFGAWGMIRDCYDVKQSFVISPSESQPPASHA
FT                   MKIVRFKNNQKVKEHALREIAIWKKLHHPNILELINWKQEEDYAAYYLTEKIQDGTLYD
FT                   LVSTWGESDGSTIPLDQRCKLTIALALQLISALKYMHSKYIVHADVKLENCLLEKTGSQ
FT                   SWKLYLCDFGMSCQYGKPRNDNEELYSPDEGMDFSPAERKGLKNKRRPSLSKSSSQGVL
FT                   KPLTKLQKIIRSKQQTHDDTPLGITSFPKQYGPSLTSTTMSSSSVWKQASPAGSSSKLD
FT                   KTGRSGTSEEHDAATKAVEPHSHIGSLPYAAPELIDPCPPPLGPSADIWASGVTMYTML
FT                   TGKLPFKHDYEPRLRAMISSGKYDTELLRSVCNISENGLAPQGPGPAFGGLYAAVCGCL
FT                   TKSMVHRWELSEVDNTLRNE"
     atgtcgaaca cgtacaatgt gaatccgggc ttgaagaggc gcgatgctcc gactctgctg        60
     cagagaaact tcgcggagcg ggtttcggtg gacacgctga tatccggaga agcagggccg       120
     ccggacgaag gagggtcgga cggaggagag cacaacgacg aggacgagga taccatatac       180
     ttcaagccaa agaagatata tcgcatggag caggagtctg ggtcgcggca gacgttggtg       240
     cgggtgtact ccgagactga gcggtcgaac ttcaacgagg tgacgggcaa gcggatgttt       300
     gacgactgga agtaccggcc actatattac cacgaagagg agacgcggcc tcggtgcgag       360
     ggggtggggt ctgtgtctgc ggggtctgtg cggtggggcg acatgcagga cgagtacgtg       420
     ccagacttgg actttgcggc ggcagtgaag gcttggcagg cggaggaact caaggaggag       480
     atgcccatga cgcgctacca gctgtggtcc gaagacgagt ccgacttcaa tctggacagt       540
     gcgtcttcgt cgatgatcat tgagtcgagt cacgcacagg tttcgccaat tccgttcccg       600
     agctcgaccg gcaaatctcc ggtgagcgcg gcgcactcgc tgctgactct gaacaaggcg       660
     ctaggcaacc gtgtagggtc acgcgtgttc tcaccgagca acctagagtc caaagccaaa       720
     caccgttcca tgtatgaatg gggctctctt ctgtcgataa gctcagcgac ctccataggg       780
     gacaagttta cacaggatga catcagggca atcactagga agataccgga cgacttcctc       840
     tctctcccgt atacgcaaag gaaaaagata ttgatggata tagcgccgga caaggactac       900
     aaagccatca tgtctgtctt caagaaatat agtctggtaa gcagcagcag cttcacccac       960
     ctgagcaacc atggttcgcg ccgttctcga cacggctcca tggcgtcgca atatctcagc      1020
     tcattcaccc cctcttctgc gtctttcaag cccgatgagc gtggttctat cgtacttggt      1080
     caccgcctag ggaaaatcat tggatttggc gcatggggca tgatacgcga ctgctatgac      1140
     gtaaagcaga gttttgtgat ttccccgagt gagtcacagc ctccggcttc ccacgccatg      1200
     aaaatagttc gttttaaaaa taatcagaaa gtaaaagagc atgccctgag ggagatagcc      1260
     atttggaaga agctccacca ccctaatata ttagaattga tcaattggaa acaagaggaa      1320
     gactatgcgg cgtattattt gactgaaaaa atccaggatg gaaccttgta tgacctagtg      1380
     agcacctggg gtgaaagtga cggtagcacc atccctttgg accagaggtg caagctcaca      1440
     atcgcactag cactccagct catatcggca ttaaaataca tgcactctaa gtacatagta      1500
     catgccgacg taaaacttga aaactgcctc ctagagaaga caggatcaca atcttggaaa      1560
     ctatacttat gcgactttgg catgagttgc cagtacggca agccgcgcaa cgataatgag      1620
     gagctctaca gccctgacga aggcatggat ttttctcccg ctgagagaaa gggtttgaag      1680
     aacaaacggc ggccttcgct gtccaaatcc tcttcacaag gggtattaaa gccattgacg      1740
     aagttacaaa agataatcag gagcaagcaa caaacccacg atgacacgcc attgggtatt      1800
     acttcctttc ccaagcagta tgggccatcc ctaaccagca ccacaatgtc ctcgtcgagt      1860
     gtatggaagc aagcttcccc tgctggcagc agtagcaagc tcgacaaaac tggccggtcc      1920
     gggacttccg aagagcatga cgccgcaaca aaagctgtgg aaccgcactc gcacattggc      1980
     tctttgccct acgctgcgcc agagctcatt gacccatgcc ctcctccatt gggcccgagt      2040
     gccgacattt gggcatccgg cgtcaccatg tatacaatgc taacgggcaa gttgcccttc      2100
     aagcatgact atgagccgag gctcagggca atgatctcct ccggcaaata cgatactgag      2160
     ctgcttcggt ccgtttgcaa tatcagtgag aacggtttgg caccccaggg tccgggtcca      2220
     gcgtttggcg gtttgtacgc ggctgtctgc ggttgtttga caaagagcat ggtgcatcgc      2280
     tgggaattat ccgaagtgga caatacttta cgaaacgagt aa                         2322
//

If you have problems or comments...

PBIL Back to PBIL home page