(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE232

ASHGO_5.PE232        Location/Qualifiers
FT   CDS_pept        398358..398774
FT                   /codon_start=1
FT                   /gene_family="HOG000183702" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081029"
FT                   /locus_tag="AEL119W"
FT                   /orf_name="AGOS_AEL119W"
FT                   /product="AEL119Wp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="AAS52566.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="HOGENOM:HBG384371"
FT                   /db_xref="HOGENOM:HBG594899"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="UniParc:UPI0000252CF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q757X9"
FT                   /transl_table=1
FT                   /translation="MIYLKTILKVIDNSGAQLAECIKVLGKGSPKSAGKVGDKIVCVVQ
FT                   KAKPMNQSITGQSNNNRVKKGDIVRAVIVRTKQKNMMRPDGSTVSFGDNACVLLHKTTG
FT                   EPLGTRIQLNDGVVSRELEAKGYNKICSLASKVA"
     atgatatatt tgaagactat ccttaaggtt atagataact ccggtgcaca gcttgcagag        60
     tgcatcaagg tattgggtaa aggctcccca aagtctgcag gcaaagtcgg tgacaagatt       120
     gtatgtgtcg ttcagaaggc taagcctatg aaccagtcta ttactggtca gtccaacaat       180
     aaccgtgtga agaagggtga catagtaagg gcggttattg tgcgcacgaa gcagaagaat       240
     atgatgcgcc cggacggctc tactgtgtcc ttcggtgaca atgcgtgtgt gctgctccac       300
     aaaactacgg gcgagccgct cgggacaaga atccagctga atgacggtgt tgttagtcgc       360
     gagctggaag ccaagggcta caataagatc tgctctctcg caagcaaggt agcatga          417
//

If you have problems or comments...

PBIL Back to PBIL home page