(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE233

ASHGO_5.PE233        Location/Qualifiers
FT   CDS_pept        complement(398944..400995)
FT                   /codon_start=1
FT                   /gene_family="HOG000112846" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756920"
FT                   /locus_tag="AEL118C"
FT                   /product="Probable serine/threonine-protein kinase HAL5-
FT                   like"
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS52567.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG124951"
FT                   /db_xref="HOGENOM:HBG202407"
FT                   /db_xref="HSSP:2BRG"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015729"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI0000252CF2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757X8"
FT                   /transl_table=1
FT                   /translation="MPQQVRLSRENSVKRSRSLTKSFRGLFKFNSPGSPPSSAATSDSS
FT                   EMSGAQGGRGNGLLGGRTKKASISPKSEAQFTQRNKSAESVVSDEGVAMVASAGAQFYG
FT                   RGKHESSPNVLMTGGEEAARAAGRASAESIALSEGGPPSIDTKLERVTPSLIYPQNGRA
FT                   KHSSQRSRSASVGRNKERGGPTPAPIGSIREEESKKAHKCIIQQEHFTVDENGNHQHSL
FT                   KVLPLIVQDPESHKPKLFSFSAVFKSHKNGEDEELSDAFSILPDYSTVLEKTLVEPLSE
FT                   VKIFSEAAQPDENGGRTEANQPKDMPKIVNKHAAIGNEELKLINNLSETIHVGMQGPDK
FT                   HSSPPQPFTCKATKSKQVLAEKYGKCIGMIGQGAYGTVWVTCRSLPQDNQTETHYPTET
FT                   YERNGKLFYAIKEIKPRADEPNEKFSTRLTSEFVIGHSLSGGAGGTKRLTSHPNILKVL
FT                   DLMQAHDVFIEVFEFCPSGDLFSLLTRSSKTGSGLHPLEADCFMKQLLNGVRYMHDHGV
FT                   AHCDLKPENILFTPNGTLKLCDFGSSSVFQTAWEKRVHFQTGAVGSEPYVAPEEFIPKR
FT                   EYDTRLVDCWSCGIIYCTMVLGHYLWKIAIKEKDQIYSAFLDDMTTRGEYYVFENMRHV
FT                   NQEVNRCRKMCLYNIFQWDPKKRITIPKLLDTPWMRRTKCCVNYRAAI"
     atgccgcagc aggtgaggct ttctcgggag aactctgtga aaaggtcgcg gtccctcacc        60
     aagtccttcc gtgggttgtt taaattcaac tctccgggat caccgccttc ctcagcagcg       120
     acatcggact cgtctgagat gtcaggggcg cagggggggc gaggaaatgg attactgggc       180
     gggcggacga agaaggcctc gatatcgccg aagtctgagg cgcagttcac gcagcgcaac       240
     aagtccgcgg agtcggtggt gagcgatgag ggtgtcgcga tggtggcaag cgcgggcgct       300
     cagttctatg ggcggggcaa gcacgaatcg tcgccgaacg tgctgatgac gggtggggag       360
     gaggcggcac gggcggccgg gcgggcctcc gcggagtcga tagcgttgag cgagggcggg       420
     ccgccgtcga tagacacgaa gctggaacgg gtgactccgt cgctcatcta cccgcagaac       480
     gggcgggcga agcactcctc gcagcggtcg cggagcgcca gcgtcgggag gaacaaggag       540
     cgcggcgggc ccacgccggc gccgatcggg tctatccgcg aagaggagag caagaaggcg       600
     cacaagtgca tcatccagca ggagcacttc acggtggatg aaaacggcaa ccaccagcat       660
     agcttgaagg tgcttcccct aatagtacag gacccagaga gtcacaagcc aaagctgttt       720
     tcgttctctg cggtgttcaa gtcgcacaaa aatggggaag acgaggagct cagcgatgca       780
     ttttcgattt tgccggacta cagcactgtt cttgagaaaa cgcttgttga gccgcttagc       840
     gaggtcaaaa tattctccga ggcggcgcag ccggatgaga acggtggtcg cacagaggcc       900
     aaccagccaa aagatatgcc caagatcgtc aacaagcacg ccgcgattgg caatgaggag       960
     ttaaaactaa taaataatct ttcagagacc atccacgtcg gcatgcaagg tccagacaag      1020
     cattcgtctc cgccacagcc gtttacttgc aaagctacca aaagtaagca agttctagca      1080
     gagaagtatg gaaaatgcat aggaatgatc ggccaaggtg cttatggtac tgtgtgggta      1140
     acgtgcagaa gcctgcctca ggataaccaa actgagacac actatcccac agaaacgtac      1200
     gagcgaaatg gaaaactctt ctatgcgata aaagagatca agccacgtgc agatgaaccg      1260
     aacgaaaagt ttagcactcg cttgacgtca gaatttgtaa taggacactc cttgagtggc      1320
     ggcgcgggag gtactaagcg tctgacttcg cacccgaata tattgaaggt tttggacctt      1380
     atgcaagcgc acgatgtttt catagaggtg tttgagtttt gcccgtctgg ggacctattc      1440
     agcctattaa caaggtcctc gaaaaccggc tccggattgc atcctttgga ggcggactgc      1500
     ttcatgaagc agctactaaa tggggttagg tatatgcacg atcacggggt tgcacactgt      1560
     gatttaaagc cagaaaatat attgttcact ccgaatggca cccttaaatt atgtgacttc      1620
     gggtctagct ctgtcttcca aactgcgtgg gagaaacgcg tacatttcca aaccggtgct      1680
     gtgggctccg aaccatatgt ggcgcctgag gagttcatcc ccaaacggga gtatgatact      1740
     aggctggtcg attgctggag ttgtggcatt atctattgca caatggtgtt aggtcattat      1800
     ttatggaaaa ttgccattaa agaaaaggat cagatataca gcgctttcct cgacgatatg      1860
     actactcgtg gcgagtacta cgtttttgaa aatatgaggc atgtcaacca agaggttaac      1920
     cgctgcagaa agatgtgcct atacaacatc ttccagtggg atccgaaaaa gagaatcact      1980
     attccaaagc ttttggacac cccatggatg aggcgaacca aatgttgtgt caactacagg      2040
     gccgcaattt aa                                                          2052
//

If you have problems or comments...

PBIL Back to PBIL home page