(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE252

ASHGO_5.PE252        Location/Qualifiers
FT   CDS_pept        437279..438136
FT                   /codon_start=1
FT                   /gene_family="HOG000000883" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15757970"
FT                   /gene_name="YNG2"
FT                   /locus_tag="AEL100W"
FT                   /product="Chromatin modification-related protein YNG2 "
FT                   /function="zinc ion binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="meiosis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52585.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0007126"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="HOGENOM:HBG058785"
FT                   /db_xref="HOGENOM:HBG396187"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI0000252D04"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757W2"
FT                   /transl_table=1
FT                   /translation="MSFERPQDPSSALEQATQDVSNLKSESRFLLEEIRASDLEFYESK
FT                   KRFLNKDTQIHKFIKQHGSLVDNPKEAEFQERIKEDLERCHQLQVDKCTVANSLLYMVT
FT                   KHLKKVQANIEALEEDGLLAPLEDDAVELANELSRESSVLSSGTSLERRKRTVAAGTLS
FT                   AGSSLRKRVKKERGRSTQRDGMLSEPPSDEASSHGANFADDLQDFNDELFSLNQQEEDD
FT                   KQLYCFCQSVSYGEMVACDGPNCKYEWFHYGCVNLDEPPKGQWYCPECRQEMANLKLKK
FT                   KKRV"
     atgagcttcg agagaccgca agatccctcc agtgcactgg aacaggctac gcaggatgtg        60
     tcgaacttga agtcggagtc tcgctttttg cttgaggaga tacgggcgtc agacctggag       120
     ttctatgaat ccaagaaaag gtttctgaac aaggacaccc agattcacaa gtttatcaag       180
     cagcatgggt cgctggtgga caatccaaaa gaggcagagt tccaggagcg cataaaagag       240
     gacctggagc gctgccacca gctgcaggtg gacaaatgca cggtagcgaa ctcgctgctc       300
     tacatggtga ccaagcacct caagaaggtg caggccaaca tagaggcgct ggaagaggac       360
     gggctgctgg cgccgctgga ggatgacgcg gtggagcttg ccaacgagct ctcgcgcgag       420
     agctccgtgc tctcctccgg gacgtccctg gagcggcgca agcgtacggt agcggccgga       480
     acgctatctg cgggttcttc gctgcgcaag agggtcaaga aggagcgggg gcgctcgaca       540
     cagcgcgacg gcatgctcag cgagcctccc tctgacgagg ctagcagcca cggcgccaac       600
     ttcgccgacg acctgcagga ctttaacgac gagctcttct cgctcaacca acaggaggag       660
     gacgacaagc agctgtactg cttctgccaa agtgtgtcct acggcgagat ggtcgcctgc       720
     gatgggccca actgcaagta cgagtggttc cactacggct gcgtcaacct cgacgaacca       780
     cccaaggggc agtggtactg ccccgagtgc cgccaggaga tggctaatct gaagcttaag       840
     aagaagaaac gcgtgtga                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page