(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE260

ASHGO_5.PE260        Location/Qualifiers
FT   CDS_pept        451943..453808
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929968"
FT                   /locus_tag="AEL092W"
FT                   /orf_name="AGOS_AEL092W"
FT                   /product="AEL092Wp"
FT                   /function="Rho guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of Rho protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS52593.1"
FT                   /db_xref="GO:0005089"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0035023"
FT                   /db_xref="HOGENOM:HBG058988"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="UniParc:UPI0000252D0C"
FT                   /db_xref="UniProtKB/TrEMBL:Q757V4"
FT                   /transl_table=1
FT                   /translation="MMDHNSDIDRTRREVLQELIHTEGDYVSMFGLFRESYLKVLAREE
FT                   EHVVFRSMEGVVKELVRWHRRMEFDLQRIMREHDPNSVETALRVSKLVVAYMARLEALY
FT                   RSYIYHFRASTRLFAEEAYYGKVMSELMGRLDHGVRTYQRTQFSGLEKRHLWQKDTSYD
FT                   CLSHLPISRLTNYKLFLEVIGKNVTSPVDKRRIAGYTRKASEIIHQINSDNSTMDPVNA
FT                   VIQRRLRFPTVEYAPVSAFGQCLLAGCLNAMWVRRRSSYGFAVTAEPLGAFLFKSYLIL
FT                   ADICHDWWTVKHCVPMVRCNIHDLTDVISVSDRDSPKLREAISEATSGSNTAPVEGTII
FT                   DTGNNPPMALKLEFYFYGQCFELTFAFRHAQEYQVWKQYLETVKELNGPSVSDFEQLTD
FT                   IGESTMVPRDMVPRTTVASRCPKVNELHNLTNAQRDMLKHSPSDYYGENSIQINVSFSG
FT                   SQRTQQKYQTLSRNKSDSNSYSAKFDSGRRLHIEALMFDVWSDALVRTPSLEYIMTSYS
FT                   DTITSVATTRPPSSTRSSWGMFSIRSDNTRATSILEPTNNQDLSSQQNNHNHTQTCNNC
FT                   SNTTNTTNGNNNKSGTIGRLGTINKLRNYLTVKTYNKQFSENQVA"
     atgatggacc ataattcgga tatcgatagg acccgccgag aggtacttca agagttaatt        60
     cacaccgaag gtgactatgt ctcaatgttt gggttattcc gtgagagcta tctcaaagtt       120
     ttggcacggg aagaggagca tgttgtattt agaagcatgg aaggggtagt gaaggagttg       180
     gttaggtggc accggcgcat ggaatttgac ctacagcgta ttatgaggga acacgaccca       240
     aacagtgttg agacggcgct tcgggtcagc aaacttgtcg tcgcatatat ggctagatta       300
     gaggcgcttt accgcagcta tatttaccat ttccgcgctt ccacccgtct atttgcggaa       360
     gaagcatatt atggcaaagt catgagtgag ttgatgggcc gtctcgacca cggggtacgg       420
     acataccagc gcacgcaatt tagtggttta gaaaaacggc atctttggca gaaagacact       480
     tcatatgact gtctcagcca cctaccgatt agccgtttga ccaactataa gctattttta       540
     gaggtcattg gcaaaaatgt aacgtcgcct gtagacaaac gcaggattgc agggtacacg       600
     cgcaaggctt ccgaaattat acaccaaatc aatagcgaca acagcactat ggacccggtc       660
     aatgccgtta tccagagacg gcttcggttt ccgaccgttg agtatgctcc agtgagcgct       720
     tttggacaat gtctattggc tggctgtctt aatgcaatgt gggttcgccg gcggtcttca       780
     tatggctttg ccgtcactgc agaacctcta ggcgcttttc tcttcaagtc ttacttaata       840
     cttgcagata tatgccatga ttggtggaca gtcaaacatt gcgttcctat ggtgcgctgc       900
     aacatacacg accttacgga cgtcataagc gtcagtgacc gagactctcc caaactcagg       960
     gaggccatct ccgaagcaac cagtggaagc aacacagcgc cagtggaggg caccatcatt      1020
     gatacaggaa ataaccctcc aatggcattg aaacttgaat tctatttcta cggacagtgt      1080
     tttgagctaa ctttcgcttt caggcatgcg caggaatacc aagtttggaa gcaatattta      1140
     gaaacagtca aggagctaaa tgggccatct gtttccgatt tcgaacagct taccgatatt      1200
     ggggagtcaa caatggtccc cagagatatg gttccacgga ccacggttgc tagtcgttgt      1260
     ccaaaggtta acgagttgca taatctaaca aatgcacagc gtgatatgct aaagcattcc      1320
     ccctccgatt actatgggga aaattccatt caaatcaatg tcagcttctc gggctcccag      1380
     agaacccagc aaaagtatca gacgctatca cgcaacaaat cagattcgaa ttcatattct      1440
     gcaaagtttg atagcggaag aaggttgcat attgaagcat tgatgtttga cgtctggtcg      1500
     gatgcattgg ttcgcactcc atctttggaa tatattatga cttcgtatag tgacaccatt      1560
     acgagcgttg caaccaccag accgccgtct tcaacccgat catcatgggg aatgttctcc      1620
     atacgttctg ataacacaag ggctacttcc atcctagagc cgacaaataa ccaagacttg      1680
     tcgtcgcagc aaaacaacca caatcacacc cagacttgta ataactgtag taatactact      1740
     aacaccacta atggtaataa taataagtcc ggaacaattg gccgactggg gacaataaac      1800
     aaacttagga actatcttac tgtaaaaacc tataacaaac agttcagcga aaatcaggta      1860
     gcttaa                                                                 1866
//

If you have problems or comments...

PBIL Back to PBIL home page