(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE28

ASHGO_5.PE28         Location/Qualifiers
FT   CDS_pept        48135..48680
FT                   /codon_start=1
FT                   /gene_family="HOG000216577" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20623889"
FT                   /locus_tag="AEL318W"
FT                   /orf_name="AGOS_AEL318W"
FT                   /product="AEL318Wp"
FT                   /biological_process="protein targeting"
FT                   /cellular_component="mitochondrial outer membrane
FT                   translocase complex"
FT                   /protein_id="AAS52366.1"
FT                   /db_xref="GO:0005742"
FT                   /db_xref="GO:0006605"
FT                   /db_xref="HOGENOM:HBG059002"
FT                   /db_xref="HOGENOM:HBG333608"
FT                   /db_xref="InterPro:IPR002056"
FT                   /db_xref="UniParc:UPI0000252C2E"
FT                   /db_xref="UniProtKB/TrEMBL:Q758S1"
FT                   /transl_table=1
FT                   /translation="MSQTVSRVFALTTATVVAVAAGYALYFDYQRRHNPGFRKNLKRSL
FT                   KKQRAQEHAEHEEAKQATMAHVGEYLTMELIKEPIPQDSNEKQASFKVNVEEGEMLAKV
FT                   PGKELESALKFYRALAMYPSPAELLGIYQRSIPEAVYEYIVLMIAILPPVNVSSFLSGS
FT                   ASTASVHAQPQEAVGIDE"
     atgtcacaaa cagtttcccg agtattcgct ctcactacag ctacggtagt agctgtagct        60
     gcaggttatg ctctgtactt cgattaccag cggaggcaca accccgggtt cagaaagaac       120
     ctcaagcgga gccttaagaa gcagcgtgcc caggaacatg ctgagcacga ggaagccaag       180
     caggctacga tggcgcatgt tggggagtac ctaacgatgg aactaattaa agagccgatc       240
     ccacaggact ctaacgagaa gcaggccagc ttcaaggtga acgtggagga gggtgagatg       300
     cttgccaagg ttccaggtaa ggagttggag tctgccctga agttttacag ggcgttagcc       360
     atgtacccta gcccagctga gctgctgggc atttaccagc gctcgattcc agaggcagtt       420
     tacgagtaca ttgtgcttat gattgccatc ttaccgccag ttaacgtctc ctcgtttctg       480
     agcggaagtg catctacggc ctcggtccac gcacagcctc aggaagcggt gggtattgac       540
     gaataa                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page