(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE283

ASHGO_5.PE283        Location/Qualifiers
FT   CDS_pept        497043..497426
FT                   /codon_start=1
FT                   /gene_family="HOG000055226" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15757984"
FT                   /gene_name="SNU13"
FT                   /locus_tag="AEL070W"
FT                   /product="13 kDa ribonucleoprotein-associated protein "
FT                   /function="RNA binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="AAS52615.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG125288"
FT                   /db_xref="HOGENOM:HBG739027"
FT                   /db_xref="HSSP:1ZWZ"
FT                   /db_xref="InterPro:IPR002415"
FT                   /db_xref="InterPro:IPR004037"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR018492"
FT                   /db_xref="UniParc:UPI0000252D22"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757T2"
FT                   /transl_table=1
FT                   /translation="MSSTPNPKAFPLADAALTQQILDVVQQASNMRQLKKGANEATKTL
FT                   NRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASIT
FT                   TNDASAIKSQIYAVKDKIETLLI"
     atgtcttcta ctccaaaccc aaaagctttc cccttggccg atgccgcttt gacgcagcaa        60
     attctagacg tggtgcaaca ggcatcgaac atgcgtcagt tgaagaaggg tgccaacgag       120
     gcgaccaaga ctctgaaccg tggtatctct gagttcatca taatggcggc ggactgtgag       180
     ccaattgaaa ttttgttgca cttgcctcta ctgtgcgagg acaagaacgt gccatatgtg       240
     ttcgtgccct cccgggtggc gctaggcaga gcgtgcggtg tgtcgcgtcc tgtgattgct       300
     gcgtcgatta ccacgaacga tgcctctgct atcaagagcc agatctacgc ggtgaaggac       360
     aagatcgaga cgttgttgat ctga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page