(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE286

ASHGO_5.PE286        Location/Qualifiers
FT   CDS_pept        504513..507032
FT                   /codon_start=1
FT                   /gene_family="HOG000246763" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18929970"
FT                   /gene_name="HUL4"
FT                   /locus_tag="AEL068W"
FT                   /product="Probable E3 ubiquitin-protein ligase HUL4 "
FT                   /EC_number="6.3.2.-"
FT                   /function="acid-amino acid ligase activity"
FT                   /biological_process="protein modification process "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52617.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016881"
FT                   /db_xref="HOGENOM:HBG059001"
FT                   /db_xref="HOGENOM:HBG398466"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="UniParc:UPI0000252D24"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757T0"
FT                   /transl_table=1
FT                   /translation="MSFFSRNINSKDRHKIQIISNSTAPSFEPNNEFVTSSCCCCGTIL
FT                   QHPKNISKFRCSVCYVTVVLQGTAFTQDKTELFDLDDMRELLSSCNNTYRELDKDEKRL
FT                   RKHEVFHLLEDYIATRMVTIFPLNASFESSNPREMLDYDQVKEFYRILMELPTKKPFYS
FT                   FLVACNELLKRPHVALNTPTPTNPKYKRIGLFRWILIILEVPIFKQTLANAEARCNTPH
FT                   FRAISYEVLKKAVGYMSCLDEASAKELVHFLKYMQKDIFASKVELVNMYITFHFARILH
FT                   TIGKETNNGKYSPQLEDFEHSEKLNPSLNQGSAKKLVHTNMNIFFGGIVRPMTSSANSK
FT                   DILALNYRFSPEDYGNEWHIKTGARLLLCLYVANQSAYKCPVSNFYNTMIDFVDYKRDF
FT                   ELWQDLSKLSASHEKENSGSSGPRYSPVQFTICQCPFLFSLGMKISILEYETRRLMEYS
FT                   AEQAFLKALDRKQVVDVYLKIRVRREFVTTDSLRSIQNQQKDLKKSLRIEFVNEPGIDA
FT                   GGLRKEWFLLLTRDLFNPNNGLFVYVPESRLCWFSIMESIEHELLQGEGSSSELYYLFG
FT                   VVLGLAIYNSTILDLKFPRAFYKKICGEVLSVNDFLELYPETGTNMLKMLEYDGEDFED
FT                   IFALTFETCFPDRFDESKIHYRQLCPDGSTQAVTRENKHEYFRLWMDFYLNRSIAPGFE
FT                   SFRNGFFHVIEGNSFRLFGSEELEQLVCGSNEQSLDVSMLRSVTRYQGGFDDNSPVVQW
FT                   FWEILSEMEYPQQRKLLHFVTGSDRVPATGVTTIPFRISRIRSGADRLPLSHTCFNEIC
FT                   LHEYKDKETLRNKLIIALEESQGYGFR"
     atgagctttt tcagcagaaa cataaacagc aaggaccgtc acaaaataca aatcatatct        60
     aacagtacag ctccgtcttt cgagccgaac aatgaattcg taacatcaag ttgctgctgc       120
     tgcggcacaa ttcttcagca cccaaagaac atcagcaaat tcaggtgctc agtttgctac       180
     gtgacagtgg tgttacaggg gactgcattc acgcaagata agacggaatt gttcgatcta       240
     gatgatatgc gtgaattact tagctcctgt aacaacactt atcgggaact tgataaggac       300
     gagaaacgtc tcaggaaaca cgaagttttt catcttcttg aggattatat tgccacgcgc       360
     atggtcacta tctttccatt aaacgcatct tttgaaagca gcaatccgag agagatgtta       420
     gattatgatc aagtaaagga attttacaga attttaatgg aattacccac taaaaaaccc       480
     ttttattcat ttttggttgc ttgcaatgaa ttgttgaaac gtccccacgt tgctcttaat       540
     actccgacac ctacaaaccc gaaatacaag cgtatcggat tatttagatg gattcttatc       600
     atattggaag tgcctatttt taaacagacc ctagcgaatg ccgaagctcg atgcaataca       660
     ccacacttcc gggctatatc atatgaggtg ctcaaaaaag ctgtcggata catgtcatgc       720
     ttggacgagg ccagcgcaaa agaactagta catttcttaa agtatatgca gaaggatatt       780
     tttgcatcga aggttgaatt agtgaacatg tacatcactt tccacttcgc gaggatactt       840
     catacaatag gcaaagagac aaacaatggc aaatatagcc ctcagctaga ggacttcgaa       900
     cactcagaga aacttaatcc ctctttaaac cagggaagtg cgaagaaatt ggtgcatacc       960
     aatatgaata ttttctttgg cggcatagtc agaccgatga cttcaagcgc taatagtaag      1020
     gatatccttg cactaaatta taggtttagc cctgaagact atggaaatga gtggcatatc      1080
     aagacgggcg ccagactact cctctgtctc tatgtggcca atcagtcggc ttacaagtgc      1140
     cctgtgtcga acttttataa cactatgatc gattttgtcg actacaagag agactttgag      1200
     ctttggcaag atctaagcaa actttcagct agtcatgaga aagaaaatag cgggagttct      1260
     gggccacgct acagcccggt gcaattcacg atatgccaat gccccttttt gttttctttg      1320
     ggtatgaaaa tctccatttt agagtatgag acaaggagac tcatggaata cagcgccgag      1380
     caggcctttt taaaggcgct agacagaaaa caagtggttg atgtctatct aaagatacga      1440
     gtccgaagag aatttgttac aaccgattct cttcggagca tccaaaacca acagaaggac      1500
     cttaaaaaat cattaagaat tgaattcgtg aatgagcctg gcatagacgc tggaggatta      1560
     cgtaaagagt ggttcttatt actaacaagg gacttgttca atcccaacaa cggtctattt      1620
     gtttatgtac cagagagtag actatgctgg ttttcaatca tggagtcaat cgaacacgag      1680
     ctactacagg gagagggtag cagcagcgag ttatactacc tatttggtgt tgtcctaggc      1740
     ttagcaatct ataactccac aatattagat ctcaagtttc ccagagcttt ctacaaaaag      1800
     atctgcggag aggtactctc cgtgaacgac tttttagaat tgtacccaga aaccggcaca      1860
     aatatgctaa agatgcttga atatgatgga gaagacttcg aagatatctt tgcacttact      1920
     ttcgaaacat gctttcctga ccgtttcgat gaatcaaaaa tacattacag gcaactttgt      1980
     ccagatggct ccacacaggc cgttacccgc gaaaacaaac acgagtactt cagactatgg      2040
     atggacttct atctcaaccg ctcaattgcc ccaggttttg aaagctttcg gaatggcttc      2100
     ttccacgtca tcgagggcaa ttccttccgt ctattcggct ccgaagaact cgaacagcta      2160
     gtgtgcggca gcaacgagca gagtcttgac gtcagtatgt tgcgcagcgt cacccgttac      2220
     cagggtggct ttgatgataa tagccctgtg gtacagtggt tctgggagat actctcagag      2280
     atggagtacc cgcagcaacg caagcttttg cacttcgtca ccgggtccga tcgcgtacct      2340
     gccaccggtg taacgactat tccatttcga atttcacgca tccgctctgg ggcagacagg      2400
     ttgccactat ctcacacctg cttcaatgaa atctgtcttc acgagtacaa ggacaaggaa      2460
     accttgcgta ataagcttat aattgcgctt gaagagtcac aaggatacgg ctttcggtaa      2520
//

If you have problems or comments...

PBIL Back to PBIL home page