(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE292

ASHGO_5.PE292        Location/Qualifiers
FT   CDS_pept        complement(518615..519766)
FT                   /codon_start=1
FT                   /gene_family="HOG000065980" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15757987"
FT                   /locus_tag="AEL062C"
FT                   /orf_name="AGOS_AEL062C"
FT                   /product="AEL062Cp"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="AAS52623.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG022580"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="HSSP:1A58"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR008940"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR023114"
FT                   /db_xref="UniParc:UPI0000252D2A"
FT                   /db_xref="UniProtKB/TrEMBL:Q757S4"
FT                   /transl_table=1
FT                   /translation="MSGVTRVYIDIEIGGCKSGRIVFELFQDKAPLSAQNFKQLCCGGI
FT                   ELDGKHVSFRGNRFHRVIKNFMVQAGDIMYGMEGADEENLGKGGCSIYSQQDEEGPCRG
FT                   AFADENTGEFSEPFLLAMANMGAPDSNSSQFFITTTAAPHLNGKHSIFGQVIHGKAVVR
FT                   EIEKEAVDSDGVPEKAVRIAGCGEWTQDMPVPLYNACNDPIGGDIYEEYPTDNTLFGGE
FT                   EFGKAYAAAVLIKESGTQLLKRKDFQNAFFKYRKSLNYVNEYIPDVDIDAEQFEKFNVL
FT                   KQKLYLNMTLALFNMGSYDSAISYTNYVLEMDRVPSMDLAKAYYRRGNCYLAKNLLEEA
FT                   LSNYKRCKEHNSDEAVDMKIASVESKLAARLEKTKKSISKFFQ"
     atgtctggtg tcactagggt ttacattgat attgaaatcg gtggttgtaa aagtgggagg        60
     attgtgttcg agctgttcca ggacaaggcg ccactgagtg cacagaactt taagcaacta       120
     tgttgcggag ggatcgagtt agacgggaag catgtgagtt tccggggcaa tcggttccat       180
     agggtgatca aaaacttcat ggttcaggcc ggcgacatca tgtacggtat ggagggagct       240
     gatgaggaga acctggggaa gggcggctgt tctatctaca gccagcagga cgaagaaggg       300
     ccatgccgcg gggcatttgc cgacgagaac actggggagt tttccgagcc gttcctactg       360
     gcgatggcta acatgggagc gccggatagc aacagctcgc agtttttcat cacgacgacg       420
     gccgcgccac acttaaacgg caagcactct atatttgggc aagtgatcca tgggaaggct       480
     gttgtgcggg aaatagaaaa ggaggccgtc gactccgatg gagtaccaga gaaggctgtg       540
     aggatagctg gctgtggcga atggactcaa gacatgccgg tgcctctgta caatgcatgc       600
     aacgatccaa ttggagggga tatatacgaa gagtatccta cggacaacac tctctttggg       660
     ggcgaagaat ttggcaaggc atacgccgcg gctgtcttga tcaaggagtc tggcacgcag       720
     ctcttaaagc gaaaggactt ccagaacgcg ttcttcaaat acagaaaatc tctgaattat       780
     gttaatgaat atattccaga tgtggacatt gatgctgagc aatttgagaa gttcaacgtg       840
     ctaaagcaga aactttatct gaatatgacg ctcgcgttgt tcaatatggg cagttatgat       900
     agcgcaatca gctataccaa ctacgtgctg gaaatggacc gtgttccgag tatggatctt       960
     gcgaaagcgt actacaggcg tggcaattgc tatctagcta agaaccttct ggaggaagcg      1020
     ctgtcgaatt ataagcgatg caaggagcat aactcagacg aggctgtgga tatgaagatt      1080
     gcttccgtcg agtccaagtt agctgcgaga ctagagaaga cgaagaaaag catctcgaaa      1140
     ttcttccagt aa                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page