(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE305

ASHGO_5.PE305        Location/Qualifiers
FT   CDS_pept        complement(540314..542467)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15757994"
FT                   /locus_tag="AEL050C"
FT                   /orf_name="AGOS_AEL050C"
FT                   /product="AEL050Cp"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS52635.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG059011"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniParc:UPI0000252D36"
FT                   /db_xref="UniProtKB/TrEMBL:Q757R2"
FT                   /transl_table=1
FT                   /translation="MQSADHKAHCGGMNDQELEEAYDYNSVLDELDYMTAPGARTAWHK
FT                   RWMQQARGTWYKWRTPRRLAGSQRGVELYRLDRAGEGTMLLEDEARELEGKRWGSWART
FT                   LVPLVMLAALLPVYLTILAPWIRFAKLAPTEPAASPRWNNGTHDFVGLTLLVSIDGFHP
FT                   SYINNESTPFINELYSGTYAKSGVLTTPYMRPSFPSETFPNHWTLVTGRRPGHHGIVSN
FT                   VFYDDTLKKEFVFVDSPQDPAFWKGGDPIWFTAQKAFGISEFSAAAHFWPGSETVYEED
FT                   DPERETRTPRYVDKYDGLESMDHKLDRIFEFIDMPLGERPGLILSYIPEVDSVGHRYGN
FT                   AWTNPVLQKALRDTDDFMRRLFQGLEQRNLTSFANTVIVSDHGMAKLNWTKDVLFLEDI
FT                   FSSDDVSRLERISGHVNCGVYPKDSHDVHYFHQTLKEHLKGLPYDVYLREQLPAEYELQ
FT                   GRYDHRLAPIWILSHPGKYIMDNRKTAPPNEIFGMHGFNNSHVDMRATFIGVGPFFGRS
FT                   GVTSYLAPFDNIEVCQLLSDVIGLAEPAETDATWPWPFSHMTLKEWTNIALPYGWHEDS
FT                   EYLAYRYPGSTFNKLWNHFKRPAAQEQVTTTLSSPSDHPPSSAAAPTTTLSSPSDHPPS
FT                   SAAAPTTTLSSSSDHPTSSSAAPTTETTEWYSGIMDGAAHIIDDTEQLINSIMPQEVGD
FT                   FVGGLVHDVLGGVEHFLDGLSSE"
     atgcagagcg cagaccacaa agcacactgc ggtggtatga acgatcagga actggaagag        60
     gcgtatgact acaacagtgt gttggacgag ctagactaca tgacggcgcc gggggcgcgc       120
     acggcgtggc acaagcgatg gatgcagcag gcgcgcggca cgtggtacaa atggcggacg       180
     ccgcggcggt tagccggtag ccagcgcggg gtggagctct acaggctgga ccgggcgggc       240
     gagggcacga tgttgctgga ggatgaggcg cgcgagctgg agggtaaacg gtggggcagc       300
     tgggcgagga ccttggtgcc actcgtgatg ctggctgcgc ttttgcccgt gtacttgacg       360
     atcctggcgc cctggatccg gtttgcgaag ctggccccca ccgagccggc tgcctccccc       420
     cgatggaaca acgggacgca cgacttcgtg ggactcacct tacttgtttc gattgacggg       480
     ttccacccgt cgtacatcaa caacgaatcc acgccgttca taaacgagtt gtacagcggc       540
     acgtacgcca agagcggcgt gctgacgacc ccgtacatga ggcccagctt tccgtctgag       600
     acgttcccca accactggac tttggtaacg gggagacggc ccgggcacca cggcatcgtg       660
     agcaatgtgt tctacgatga cacgcttaag aaggagtttg tgtttgttga ttctccccaa       720
     gaccccgcct tctggaaggg cggggatccg atatggttca ctgcgcagaa ggcatttggc       780
     atctcggagt tcagcgctgc cgcgcacttc tggcctggct ctgagacggt ttacgaggaa       840
     gatgaccctg aacgggaaac ccggactccg cgctatgtgg acaagtacga tggcctggag       900
     tcgatggacc acaagttgga ccgcatattt gagtttatcg acatgccact aggggaacgg       960
     ccaggactca tcctgtccta tattcccgag gtagactccg tggggcaccg ctatggcaat      1020
     gcatggacga atcccgtact ccaaaaggcc ttgcgagaca cggacgactt catgcggcgt      1080
     ctctttcagg gtttggagca gcgcaacttg acctcgtttg cgaacacggt gattgtcagc      1140
     gaccacggga tggcgaagct aaattggaca aaagatgtgc tattcttgga ggacatattc      1200
     agttcagatg atgtgtctcg tttggaacgg atcagcgggc atgttaactg cggcgtttac      1260
     cccaaggata gccacgatgt gcattatttc catcagacac tcaaagagca cttgaaaggg      1320
     ctaccgtacg atgtttactt gcgtgagcag ctcccagcag agtacgaatt acaggggcgc      1380
     tacgatcacc gccttgcgcc aatctggata ctctctcatc ctggaaagta cattatggac      1440
     aacaggaaaa cagctccgcc caacgagata ttcggcatgc acggcttcaa caactctcac      1500
     gtagacatgc gtgctacgtt cataggagtg gggccgttct tcggtcggag cggcgtcaca      1560
     agctatctag cacccttcga taacatcgag gtttgccaac tcttgtccga tgtaatcggt      1620
     cttgcagaac cggcggagac agacgccact tggccttggc cgtttagcca catgactctg      1680
     aaggagtgga ccaatatcgc cttgccttac ggctggcatg aagatagtga ataccttgcg      1740
     taccgctacc caggtagcac cttcaacaag ctatggaatc acttcaagcg gcccgcagct      1800
     caggaacaag tcactacgac tctttcatca ccctccgacc atcccccatc atccgccgcc      1860
     gcgcccacaa cgactctttc atcaccctct gaccatcccc catcatccgc cgccgcgccc      1920
     acaactactc tttcatcatc atctgaccat cccacttcat cttccgccgc gcccacaacg      1980
     gagacgacag aatggtattc cggtattatg gatggtgcag cgcacatcat agatgataca      2040
     gagcagctca tcaacagcat tatgccgcaa gaagtcggtg attttgtcgg tggtttagtc      2100
     catgatgtac ttggaggcgt ggaacacttc ctcgatggac tgtctagtga atag            2154
//

If you have problems or comments...

PBIL Back to PBIL home page