(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE307

ASHGO_5.PE307        Location/Qualifiers
FT   CDS_pept        544884..546590
FT                   /codon_start=1
FT                   /gene_family="HOG000177331" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15757995"
FT                   /gene_name="VAC8"
FT                   /locus_tag="AEL048W"
FT                   /product="Vacuolar protein 8"
FT                   /function="binding"
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="AAS52637.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="HOGENOM:HBG055740"
FT                   /db_xref="HOGENOM:HBG327627"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0000252D38"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757R0"
FT                   /transl_table=1
FT                   /translation="MGGCCSCLKESQDDATVLPIAENEREAVTSLLGYLEDKDNYDFYS
FT                   GGPLKALTTLVYSDNLNLQRSAALAFAEITEKYVRPVDREVLEPILILLQSHDPQIQIA
FT                   ACAALGNLAVNNENKILIVEMGGLEPLIEQMKSNNVEVQCNAVGCITNLATQDDNKAKI
FT                   AHSGALVPLTKLAKSKNIRVQRNATGALLNMTHSGENRKELVDAGAVPVLVSLLSSSDA
FT                   DVQYYCTTALSNIAVDESNRRKLSQTEPRLVSKLVVLTDSPSARVKCQATLALRNLASD
FT                   TGYQLEIVRAGGLSHLVKLIQCNSMPLVLASVACIRNISIHPLNEGLIVDAGFLKPLVK
FT                   LLDYNDNEEIQCHAVSTLRNLAASSEKNRQEFFESGAVEKCKQLALVSPISVQSEISAC
FT                   FAILALADNSKLELLDANILEALIPMTFSTNQEVAGNAAAALANLCSRINNYEKIIESW
FT                   TEPSKGVCGFLIRFLQSEYPTFEHIALWTILQLLESHNETMLGLIKSNKEIVKSIKRLS
FT                   DINYENAQKASSLHSRLQQVNGGSVASGSEQYEHASLELYNITQQIMQFLN"
     atgggaggtt gctgcagttg tctgaaggag tcgcaggatg acgccactgt gctcccaata        60
     gcggagaacg agcgagaggc ggttacgtcg ctcttggggt acttggagga caaggacaac       120
     tacgacttct atagcggggg gccgttgaag gcgttaacga cgttggtgta tagcgacaac       180
     ctcaacttgc agcgcagtgc ggcgttggcg ttcgcggaaa tcacggagaa gtacgtgcgg       240
     cctgtggacc gggaggtgct ggagccgatc ttgattctgc tgcagagcca cgacccgcaa       300
     atccagatag cggcgtgcgc ggcgctaggg aacctcgcgg tgaacaacga gaacaagatt       360
     ctcattgtgg agatgggggg gttggagccg ttgatagagc agatgaagag taacaacgtg       420
     gaagtgcagt gcaacgcggt ggggtgcatc acgaatttag ccacgcagga cgataacaag       480
     gcgaagatag cacactccgg ggctttggtg ccccttacga agttggcgaa gtccaagaac       540
     atccgcgtgc aacgcaatgc gacgggcgcg ttgttgaaca tgacgcactc gggggagaac       600
     cgtaaagagc tcgtcgatgc tggcgcggta ccggttcttg tgtcacttct ctcgtcgtcc       660
     gacgcagacg tccagtacta ctgtaccacg gcgctctcca acattgctgt cgacgaatcc       720
     aacagacgca agttgtcgca gacggagcca cggttggttt ccaagctagt cgtgttgacg       780
     gactcgccct cggcacgggt caagtgccaa gcgacgcttg cgctcagaaa tttggcttct       840
     gatacgggtt atcagttgga gatcgtccgg gcgggcggtt tgagccactt ggtgaagctt       900
     atccagtgca actcgatgcc tttggtgctt gccagcgtgg cctgcattag gaatatctcc       960
     attcatccgc tgaacgaggg tttgatcgtg gatgcggggt tcctaaagcc actggtgaaa      1020
     ttgctagact acaacgacaa cgaagagatc cagtgccacg cggtatccac gttgcgtaat      1080
     ctcgcggcat cttcagaaaa gaaccggcag gagtttttcg aaagcggcgc ggtcgagaag      1140
     tgcaagcagc tggcgttggt gtcgcccata tctgtgcaga gcgagatatc cgcgtgcttc      1200
     gctatcttgg ccttggcaga taactcgaaa ctggagctac tagacgccaa catcctcgaa      1260
     gccttgatcc ccatgacctt ttcaaccaac caggaggtgg caggcaacgc ggccgcggcg      1320
     cttgcgaacc tatgctcgcg tattaacaac tatgaaaaga taatcgaatc gtggacggag      1380
     ccaagcaagg gtgtctgtgg ctttttgatt aggttccttc agagcgaata cccgactttc      1440
     gaacatattg cattgtggac tattttgcaa ctacttgaat cacataacga gacgatgctc      1500
     ggcttgatca agtctaacaa agaaatagtc aagagcataa agcgtctatc ggatattaac      1560
     tacgaaaatg ctcaaaaggc gtcctctttg cattcacgat tacaacaggt caacggcggg      1620
     agcgtagcct cggggtcgga gcagtacgag catgcgagtt tggaactata caacatcaca      1680
     cagcaaatca tgcagttttt gaattag                                          1707
//

If you have problems or comments...

PBIL Back to PBIL home page