(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE310

ASHGO_5.PE310        Location/Qualifiers
FT   CDS_pept        join(548573..548577,548641..549271)
FT                   /codon_start=1
FT                   /gene_family="HOG000233452" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15757997"
FT                   /locus_tag="AEL045W"
FT                   /orf_name="AGOS_AEL045W"
FT                   /product="AEL045Wp"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="AAS52640.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG492183"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="HSSP:1AYZ"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR015581"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI0000252D3B"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Q7"
FT                   /transl_table=1
FT                   /translation="MSSSKRRIETDVMKLLMSDHDVELVDDNMQEFHVKFHGPKGTPYE
FT                   RGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDAASGSICLDVINSTWSPLYDLLNIVE
FT                   WMIPGLLKEPNGSDPLNNEAATLQLKNPQMYEEKIQEYIDKYATEERYVQQFGGAGGDA
FT                   GDGSEDDEDADENPSDGMDYDEDDEELSEIEVEEEDEEVHISDSDLLD"
     atgagcagct ccaaaagaag gattgagacg gatgttatga agttattgat gtcggatcac        60
     gacgtggaac tggtcgatga caacatgcaa gagttccacg ttaagtttca cgggccgaag       120
     gggacgccct acgagcgtgg cgtgtggcgc ttgcatgtgg aattgccgga caactacccg       180
     tacaagtcgc ccagcatcgg ctttgtcaat aagatattcc accccaacat cgacgcggca       240
     tcgggctcta tctgcctgga cgtgatcaac tcgacgtggt cgccgctgta cgacctgctc       300
     aacatcgtgg agtggatgat cccaggcctg ttgaaggagc cgaatggctc ggatcccctc       360
     aacaacgagg ccgccacgct gcagcttaag aacccccaga tgtacgagga gaagatccag       420
     gagtacatcg acaagtatgc caccgaggag cgctacgtgc agcagttcgg cggcgcgggc       480
     ggggacgcgg gcgacggctc cgaggacgac gaggacgcag acgaaaaccc aagcgatgga       540
     atggactacg acgaggacga cgaggaactg agcgaaatag aggttgaaga ggaggatgaa       600
     gaggtccaca tcagcgactc cgacctattg gactag                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page