(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE313

ASHGO_5.PE313        Location/Qualifiers
FT   CDS_pept        complement(556385..558028)
FT                   /codon_start=1
FT                   /gene_family="HOG000202869" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081286"
FT                   /locus_tag="AEL042C"
FT                   /orf_name="AGOS_AEL042C"
FT                   /product="AEL042Cp"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS52643.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000252D3E"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Q4"
FT                   /transl_table=1
FT                   /translation="MTLVDKLLLRNIEYKGTAYDYFPKVYNVYLVAVVACISGMMFGFD
FT                   ISSMSSMQDFEPYKDYFKHPNELTQGGITASMAAGSLLGSILSPGISDAFGRRVSLHMC
FT                   SSLWIIGAVLQTAAQNQAMLFVGRIVAGLGVGFGSSVAPVYTAEVSPPKIRGAVGGLFQ
FT                   LSVTVGILVMFLIGYGSVSLNSVASFRVAWSMQLVPGVVLLLATFLLPESPRWLANHGR
FT                   WDETTLVVEKVGRSVNVSDEELRIHINEIRERVALDEMARDFTYADLFRRKTQRKIFIG
FT                   MAAQMWQQLCGMNVMMYYIVHVFKMAGFSGNQNLVSSIVQYVLNVGMTIPSLFLVDRAG
FT                   RRPVLIIGGVLMFTWLYAVAGILATYSVPRPNGVEGNTTVRIEIPPERSSAAKAVIVCS
FT                   YLFVCSFAPTWGIGIWVYCAEIFNNIERARGSALCTSVNWAFNFALAMFVPTAFKNITW
FT                   RTYIIFGTFSVALTIHAFLSFPETKGKTLEEIDEMWDAHIPAWRTASYKPELAQMAAPK
FT                   LSSGSISDATGGLHEKKAAAGSPGASAGSS"
     atgacactgg tggacaagct tttgctcaga aatattgaat acaagggcac cgcgtacgac        60
     tactttccca aggtctacaa tgtgtacctg gtggcggttg ttgcgtgcat ctcggggatg       120
     atgtttggct ttgatatctc gtcgatgtct tcgatgcagg actttgagcc ctacaaggac       180
     tactttaaac atccaaacga actgacgcag ggcggtatca cggcctcgat ggctgctggt       240
     tccctgttag gatccatcct ttcgcccggt atctcggacg cttttggtcg tcgggtgtca       300
     ttgcacatgt gttccagtct gtggattatt ggcgcggtgc tgcaaactgc agcgcagaac       360
     caggcgatgc tttttgtggg gcgcattgtt gcggggcttg gtgttggctt cgggtcatcg       420
     gtcgcgccag tgtacactgc tgaggtgtct ccgccaaaga tcagaggtgc tgtgggaggt       480
     ttgttccagc tgtcggtcac ggtcgggatc ttggtcatgt tcctgatcgg gtacggatct       540
     gtgtcgttga attcggtggc gtccttccgt gtggcgtggt caatgcaact cgtgccaggc       600
     gtggtgttgc tgttggccac attcctgctt cctgagtcac ctcggtggct agctaaccat       660
     ggccggtggg atgagaccac tcttgttgtc gagaaagtcg ggcgcagtgt caatgtcagc       720
     gatgaagagc tgcgcataca catcaacgag atccgcgagc gcgtggccct ggatgaaatg       780
     gcccgcgatt tcacttacgc cgacctgttc cgccgcaaga cacaacgcaa gattttcatt       840
     ggtatggctg cgcagatgtg gcagcaactc tgtggtatga atgtgatgat gtactatatt       900
     gtccatgtgt tcaaaatggc tggattctcg ggcaatcaga acctggtctc ttcgatagtg       960
     cagtatgtgc taaacgtggg catgaccatc ccctctctat ttttggttga tcgtgcaggg      1020
     cgccggcctg tcttgatcat cggaggtgtg ttgatgttca cctggcttta cgctgtggcc      1080
     ggaattcttg ccacttattc tgttcctcgc cctaatggtg tggaaggcaa caccactgtt      1140
     cggattgaga ttccgcccga gaggagctcc gcggccaaag ctgtcattgt ctgttcttat      1200
     ctgttcgtgt gttcctttgc tcctacctgg ggtatcggta tctgggtgta ctgcgcagag      1260
     attttcaata acattgagcg tgcccgcggt tcggctctgt gtacctctgt caactgggcc      1320
     ttcaactttg cccttgccat gtttgtgcca acggcgttta agaatatcac ttggaggaca      1380
     tacattattt ttggcacatt ctctgtcgcg ctgacgatcc acgcattcct gtcgttccct      1440
     gaaacaaagg gtaagactct agaggaaatt gacgaaatgt gggacgccca tattccggcc      1500
     tggcgcaccg ccagttacaa gcccgagctt gcccaaatgg cagcgccaaa actttcttca      1560
     ggcagcattt ccgacgccac aggcgggctt cacgagaaaa aggcggctgc cggcagccct      1620
     ggtgccagtg ctggctcttc ctag                                             1644
//

If you have problems or comments...

PBIL Back to PBIL home page