(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE317

ASHGO_5.PE317        Location/Qualifiers
FT   CDS_pept        complement(561627..562973)
FT                   /codon_start=1
FT                   /gene_family="HOG000227107" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15757999"
FT                   /gene_name="PGK1"
FT                   /locus_tag="AEL038C"
FT                   /product="Phosphoglycerate kinase "
FT                   /EC_number="2.7.2.3"
FT                   /function="ATP binding"
FT                   /function="phosphoglycerate kinase activity"
FT                   /biological_process="glycolysis"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS52647.2"
FT                   /db_xref="GO:0004618"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="HOGENOM:HBG003915"
FT                   /db_xref="HOGENOM:HBG453500"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015901"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="UniParc:UPI0000186188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757Q0"
FT                   /transl_table=1
FT                   /translation="MGRSWGLLWMACLLYGVFTECRRSSQHAHTGKMSLSSKLTVKDLS
FT                   LAGKRVFIRVDFNVPLDGKTITSNQRIVAALPTIKYVLEQGPKAVVLASHLGRPNGERN
FT                   EKYSLAPVAAELEKLLGQKVNFLDDCVGEHVTAAVNGAAAGSVFLLENLRFHIEEEGSR
FT                   KVDGEKVKASAEDVQKFRQGLMSLADVYVNDAFGTAHRAHSSMVGFELPERAGGFLLSR
FT                   ELEYFSKALENPTRPFLAILGGAKVADKIQLIDNLLDKVDSIVIGGGMAFTFKKVLENM
FT                   EIGNSIYDKAGAEIVPKLAEKAKKNGVKIVLPVDFVIGDDFSQDANTKIVSASEGIPSG
FT                   WEGLDCGPESRKLFSETIASAKTIVWNGPPGVFEIPKFSEGTQAMLAAAVKASEAGSTV
FT                   IIGGGDTATVAKKYGVVEKISHVSTGGGASLELLEGKDLPGVTFLSSKQ"
     atgggccggt cgtggggtct gctctggatg gcgtgcttgc tgtacggcgt gttcacagag        60
     tgtcgcagat cttcacagca cgcacacaca ggaaaaatgt cgctatcctc taagctaaca       120
     gtcaaggacc tgagccttgc gggcaaacgc gtgttcatcc gcgtggactt caacgtgccg       180
     ctagacggga agacgatcac gtcgaaccag cgcattgtgg ccgcgctacc cacgatcaag       240
     tacgtgttgg agcagggccc caaggcggtg gtgttggcgt cgcacctagg gcggcccaac       300
     ggcgagcgca acgagaagta ctcgttggcg ccggtggccg cggagctgga gaagctgctg       360
     ggccagaagg tgaacttcct ggacgactgc gtgggcgagc acgtgaccgc tgcggtcaac       420
     ggcgcggctg cggggtccgt gttcctgctt gagaacctgc ggttccacat cgaggaggag       480
     ggctcgcgca aggtggacgg cgagaaggtc aaggcgtctg cggaggacgt gcagaagttc       540
     cgccagggcc tcatgtcgct cgcggacgtc tacgtcaacg acgccttcgg caccgcgcac       600
     agagcgcact cctcgatggt cggcttcgag ctgcctgaga gggccggcgg cttcttgttg       660
     tcgcgcgagc tggagtactt cagcaaggcg ttggagaacc ctacgagacc cttcttggcg       720
     atcctgggcg gtgccaaggt tgccgacaag atccagttga tcgacaactt gttggacaag       780
     gtcgactcga ttgtgatcgg cggtggcatg gccttcacct tcaagaaggt gcttgagaac       840
     atggagatcg gtaactccat ctacgacaag gcgggtgccg agatcgttcc taagctagcg       900
     gagaaggcca agaagaacgg cgtcaagatc gtgttgcctg tggacttcgt gatcggcgac       960
     gacttctccc aggacgccaa caccaagatt gtctctgcct ccgagggcat tccatccggc      1020
     tgggagggtc tagactgtgg tcctgagtcc agaaagctgt tcagcgagac catcgcgagc      1080
     gcgaagacca tcgtgtggaa cggcccacca ggtgtctttg agattccaaa gttctccgag      1140
     ggtacccagg ccatgcttgc ggccgctgtc aaggcctccg aggctggcag caccgtcatc      1200
     atcggcggtg gtgacaccgc taccgtggcc aagaagtacg gtgtggtcga gaagatctcc      1260
     catgtgtcca ccggtggtgg tgcctcccta gagctattgg agggtaagga cctaccaggt      1320
     gtcaccttct tgtccagcaa gcagtag                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page