(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE32

ASHGO_5.PE32         Location/Qualifiers
FT   CDS_pept        52979..55126
FT                   /codon_start=1
FT                   /gene_family="HOG000048466" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19776428"
FT                   /gene_name="MDV1"
FT                   /locus_tag="AEL314W"
FT                   /product="Mitochondrial division protein 1 "
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="AAS52370.1"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="HOGENOM:HBG059021"
FT                   /db_xref="HOGENOM:HBG327700"
FT                   /db_xref="HSSP:1ERJ"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI0000252C32"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758R7"
FT                   /transl_table=1
FT                   /translation="MSSGTSGDQISHFGKTLTTTASLVFGSQSMEDTILSYSSPYKKIL
FT                   HDTITSSGGTSSLMKVERSGRMFTPFRTRNSAFQDIFHASSGRGYFKNGFSDTRTSFQV
FT                   LSYLSDAMLADIPSSESAAATSGKLVTEKGEKGKKKRAETAHARGPSLYQGFEASLPTI
FT                   NQTITTHQKKQIMNRDIKSIRESDATPEDVGQDVDIEKGEEETTHDEFTLPKGIKPEHL
FT                   SNSYSIKNLKGAVQTITDNLDLLEIQKNLAASEIRELDLKMEKLKLMRDLVFRRVAKIE
FT                   QNELFLEKHLMNIRERIDMIEEYNLDNDTDAEKAYEEATSAPEDTKDQYSELPDANTAE
FT                   SGETVVQEPQVNLASAQKSLKKRSKQTGYSHKNHEKKVQQHEFRHLRKTYPTLQQYYEP
FT                   GANILSFDSAHEDNVTCLDFNLPFGTLCSAGKLDPTIKVWNLSKNKHVASITGHLATVS
FT                   CMQMDQYNTLITGGRDALLKMWDIQKAIDNDSIPSDEVCIYTFDSHIDEITALSFEANN
FT                   LVSGSQDRTIRQWDLNNGKCVQTLDINFATGGNLSRSMIGSGFLNTNNDHPIIGAIQCY
FT                   DAALATGTKDGIVRLWDLRSGRVVRTLEGHSDAVTSLQFDSLNLVTGSLDNSIRIWDLR
FT                   TGTLADTFSYEHPVTCLQFDLNKIVVANQEGTVKVYNRQEKKHWFCGGDEHSENAVEYV
FT                   RYKDGYLVEGRANGDINAWAI"
     atgtctagtg gtacatctgg cgaccagatt tcgcattttg ggaagacgct gacgaccact        60
     gcgtcgttag tgttcggctc gcagtccatg gaggatacta tcctatcgta cagcagcccc       120
     tacaagaaga tattgcatga cacaataacc agctccggag ggacctccag tttgatgaag       180
     gtggagcgga gtggccgtat gtttacgccg ttcaggacgc ggaactcggc atttcaggac       240
     atattccacg cttcttctgg ccgcggctac ttcaagaatg gattcagtga caccaggacg       300
     agctttcagg tgttaagtta tcttagcgat gcgatgttgg cggatatacc tagctcggaa       360
     tcggcggcag caactagtgg aaagctggtg actgagaagg gcgaaaaggg caagaaaaaa       420
     agggcagaaa ctgcacacgc acgcggacca tcgctttacc agggctttga ggcatcactt       480
     cccacaatta atcaaaccat caccacccac cagaaaaagc agattatgaa cagagatatt       540
     aaatccatca gggaatcaga cgctactcct gaagatgtgg gacaggatgt ggatattgag       600
     aaaggtgaag aggaaaccac acatgatgaa tttacgcttc ccaagggtat aaaacctgaa       660
     cacctaagca actcatactc gataaagaat ctaaagggtg ccgtacagac gatcaccgat       720
     aatctggatt tgttggaaat tcaaaagaac ctggctgcta gtgaaatccg ggaattggat       780
     ttgaagatgg aaaaattaaa gctcatgcgt gatttggtct ttcgaagggt tgccaaaatt       840
     gaacaaaatg aattgttctt ggaaaagcat ctaatgaaca ttagggagag aatagatatg       900
     atagaggaat ataacttgga taatgatact gatgcggaga aggcctatga ggaggcaacc       960
     tccgcgccag aagatacgaa ggaccaatat agcgaattgc ctgatgcgaa cactgctgaa      1020
     tctggtgaga ctgttgtgca ggaacctcaa gtcaatcttg catctgcaca gaaatcgctc      1080
     aagaaaagat caaagcagac tggatattcg cataaaaatc atgaaaagaa ggtgcagcag      1140
     catgagttca ggcatctaag gaaaacttat ccaaccttgc aacaatatta tgaaccaggt      1200
     gctaacattc tttcctttga ttcagcgcat gaggacaacg taacatgttt ggatttcaat      1260
     ttgccatttg gaactctttg ctcagctggg aagttagatc ctacaattaa ggtgtggaac      1320
     ttgagtaaga acaagcatgt ggcttccatt acaggacatc tagcgactgt tagctgcatg      1380
     cagatggacc aatataatac tctgattact ggtgggcgtg atgctttgct gaaaatgtgg      1440
     gacatacaga aggcaattga caatgactca attccttccg acgaggtctg catttatact      1500
     tttgactcgc atattgatga aattactgct ttgagttttg aggccaataa tctagtctct      1560
     ggttcacagg atagaaccat ccgtcaatgg gatttgaaca acggtaaatg tgtccaaacg      1620
     ctagatatca acttcgccac aggtggaaac ttatctcgct ccatgattgg ttcaggattc      1680
     ctgaacacga ataatgacca ccccattatc ggcgctatcc agtgttacga tgctgcactt      1740
     gccacaggta ccaaggatgg tattgtacgc ctatgggacc taaggtctgg acgggttgtg      1800
     cgtaccctag agggccactc tgatgctgtt acatcccttc agtttgattc tctaaacctt      1860
     gtgactggtt ccttggataa cagcattaga atctgggatc tacgtaccgg tacattggct      1920
     gatacatttt cgtatgaaca cccggtgaca tgtttgcagt ttgacttgaa taagatagtt      1980
     gtcgctaacc aggaaggtac agtgaaggtt tacaaccggc aagagaagaa gcattggttt      2040
     tgcggcggtg atgagcatag tgagaatgcc gtggaatatg tcagatataa agatggctac      2100
     ttggttgaag gccgcgcgaa cggtgatatt aatgcctggg ccatttga                   2148
//

If you have problems or comments...

PBIL Back to PBIL home page