(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE337

ASHGO_5.PE337        Location/Qualifiers
FT   CDS_pept        complement(601134..602285)
FT                   /codon_start=1
FT                   /gene_family="HOG000074712" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624456"
FT                   /locus_tag="AEL018C"
FT                   /orf_name="AGOS_AEL018C"
FT                   /product="AEL018Cp"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS52667.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059026"
FT                   /db_xref="InterPro:IPR013952"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000252D56"
FT                   /db_xref="UniProtKB/TrEMBL:Q757L8"
FT                   /transl_table=1
FT                   /translation="MAERWINACFEAYDTTIRHAEDVGAQAVQSARAVYNVACETVSEI
FT                   ARRAGTEERGVAVLAEKPAGGVAAAREHILAAVVGLAGRPRVRAAAAAAAAGLLVYVAG
FT                   RALVPAVAARVVGERETVLVLGEMTDPITRALVYDLHRRGFCVFVCSTSEKRDRQLEDE
FT                   YEKVPSPWDQEGGVCHMAATPEAVARLTEFLQREERRLRGVLVVPSSCFFTSGMFTNIP
FT                   EGQVRSELQENLVNTWAVVTRLLPQFDSASRDKLQVVVFNPSLSQKLNLQYHSLELLMS
FT                   STMESLYRILANECGYLADVYQCHLGILNIAGNASNYKYLTINGSHITKALCEPIYELL
FT                   LSRDNMWVRFKRWLQGPVLYCGKGSRLACWLRSYAPLWLLEFI"
     atggcagagc ggtggataaa cgcatgcttc gaggcatatg acacgaccat tcggcacgcg        60
     gaagacgtgg gtgcgcaggc ggtgcagtct gcgcgggcgg tgtacaacgt cgcgtgcgag       120
     acggtgagcg agatcgcgcg gcgcgcgggg acggaggagc gcggggtggc ggtgctggcg       180
     gagaagccgg cgggcggcgt ggcggcggcg cgtgagcaca tactggcggc ggtggtcggg       240
     ctggcggggc ggccgcgggt gcgggcggcg gcggcggcgg cggcggcggg gctgctggtg       300
     tacgtggcgg ggcgggcgct ggtgccggcg gtggcggcgc gcgtggtggg ggagcgggag       360
     acggtgctgg tgctggggga gatgacagac ccgatcacgc gggcgctggt gtacgacctg       420
     caccggcggg gcttctgcgt gttcgtgtgc agcacgagcg agaagcgcga ccggcagcta       480
     gaggacgagt acgagaaggt cccgtcgccg tgggaccagg agggcggggt gtgccacatg       540
     gcggcaacgc cggaggcggt ggcgcggttg accgagttcc tgcagcggga ggagcggcgg       600
     ctgcgcggcg tgctggtggt gccgagctcg tgcttcttca cgtctgggat gttcacgaac       660
     atcccggagg ggcaggtgcg cagcgagctc caggagaacc tggtcaacac gtgggcggtg       720
     gtcacgcggc tgctgccgca gttcgacagc gcatcgcggg acaagctgca ggtggtggtg       780
     ttcaacccgt ccctgtcgca gaagctgaac ctgcagtacc actcgctgga gctgctgatg       840
     tcgtcgacga tggagtcact gtaccgcatc ctggccaacg agtgcggcta cctggcggac       900
     gtgtaccagt gccatctcgg gattctgaat atcgcgggca acgcgtcgaa ctacaagtac       960
     ctgacaatca acggcagcca catcacgaag gcgctctgcg agccgatcta cgagctgctg      1020
     ctttcgcgag acaacatgtg ggtgcgtttc aagcggtggc tccagggccc tgttctatac      1080
     tgcgggaagg gttcccggct tgcatgttgg ctgaggagct atgctccgct ctggttactc      1140
     gagtttatct ag                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page