(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE347

ASHGO_5.PE347        Location/Qualifiers
FT   CDS_pept        617521..617997
FT                   /codon_start=1
FT                   /gene_family="HOG000216023" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758016"
FT                   /gene_name="ATP16"
FT                   /locus_tag="AEL008W"
FT                   /product="ATP synthase subunit delta, mitochondrial "
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="AAS52677.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG343819"
FT                   /db_xref="HOGENOM:HBG663981"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="UniParc:UPI0000252D60"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757N0"
FT                   /transl_table=1
FT                   /translation="MFRLTSARALFRVANVAARRTYAEAAADALKLNFALPHETLFAGT
FT                   AVKQVNLPVKTGQIGILANHVPIVEQLVPGVVEVLEGSESKKFFVSGGFATVQPDSTLS
FT                   ITSVEAFPLDSFSAENVRALLAEAQKNAGAADSRVAAEASIQIEVLEALQAALK"
     atgttccgct tgacctccgc cagagctctg ttcagggttg ccaacgttgc cgccagacgt        60
     acgtacgcag aggcggccgc cgatgctttg aagttgaact tcgcgcttcc tcacgaaacg       120
     ctgtttgccg gcaccgcggt caagcaggtg aacctgcctg tcaagaccgg tcagatcggt       180
     atcctggcga accacgtgcc gattgtggag cagctggtcc caggtgtcgt ggaggtgctg       240
     gagggctcgg agtccaagaa gttcttcgtc tcgggcgggt tcgccacagt gcagcccgac       300
     tccaccctat ccatcacgtc cgtggaggcc ttccctctag actcgttctc tgcggagaac       360
     gtgcgcgcgc tcttggctga ggcccagaag aacgccggcg ccgccgacag ccgcgttgcc       420
     gcggaggcgt ccatccagat cgaggttctg gaagcattgc aggccgcgtt gaaatga          477
//

If you have problems or comments...

PBIL Back to PBIL home page