(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE388

ASHGO_5.PE388        Location/Qualifiers
FT   CDS_pept        697282..698121
FT                   /codon_start=1
FT                   /gene_family="HOG000019802" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758041"
FT                   /gene_name="MRPS9"
FT                   /locus_tag="AER033W"
FT                   /product="40S ribosomal protein S9, mitochondrial "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="mitochondrion"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS52717.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG059045"
FT                   /db_xref="HOGENOM:HBG328295"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="UniParc:UPI0000252D85"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757I0"
FT                   /transl_table=1
FT                   /translation="MFARMASLRALVPVRALLWRAPVRSVHRAAVRETRIVPQLPTFYS
FT                   ANPAHEAHMDRLEALLRKHTKQQARRVAVERTASDRPRWLSFDQYALIGGTSRLKPTQY
FT                   RQLVSVLDRLHAIDPQLSNGEIAATLEAFLRKSRLEEQNVVRQELDHLGRACAVGRRKT
FT                   SSAKVWLVRGSGEVLVNGRTFADYFSKIKDRDAIMYPLRVLDAAGKYNIFAAVRGGGVT
FT                   GQAEAIMHAVAKALVVFNPLLKTRLHRAGVLTRDYRHVERKKPGKRKARKMPAWVKR"
     atgtttgcgc gtatggcgag cctgagggct ctcgttccag tgcgggcgct cctgtggagg        60
     gcgccggtgc gcagcgtgca ccgtgcggcc gtccgcgaga cgcgtatcgt gccgcagctg       120
     cccaccttct actccgccaa cccggcacac gaggcacaca tggaccggct cgaggccctg       180
     ctgcgcaagc acaccaagca gcaggcgcgc cgcgtcgccg ttgagcgcac cgccagcgac       240
     cgcccgcgct ggctctcatt cgaccagtac gccctgatcg gcggcacctc gcgcctcaag       300
     ccgacccagt accggcagct ggtctccgtc ctcgaccggc tgcacgccat cgacccccag       360
     ctgtccaacg gcgagatcgc cgcgacgctt gaggccttcc tgcgcaagtc gcggctcgag       420
     gagcagaacg tggtgcgcca ggagctcgac cacctcggcc gcgcctgcgc cgtcggccgc       480
     agaaagacgt ccagcgccaa ggtgtggctc gtgcgcggct ccggcgaggt cctggtcaac       540
     ggccgcacgt tcgccgacta cttcagcaag atcaaggacc gcgacgccat catgtacccg       600
     ctgcgcgtgc tggacgccgc gggcaagtac aacatcttcg ccgccgtgcg cggcggcggc       660
     gtcaccggcc aggccgaggc catcatgcac gccgtggcca aggccctggt cgtgttcaac       720
     ccgctgctga aaaccagact ccaccgcgcc ggcgtcctga cgcgcgacta cagacacgtc       780
     gagcggaaga agccgggcaa gcgcaaggcg cggaagatgc ctgcctgggt caagcgttaa       840
//

If you have problems or comments...

PBIL Back to PBIL home page