(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE400

ASHGO_5.PE400        Location/Qualifiers
FT   CDS_pept        complement(716959..720837)
FT                   /codon_start=1
FT                   /gene_family="HOG000094118" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758049"
FT                   /locus_tag="AER045C"
FT                   /orf_name="AGOS_AER045C"
FT                   /product="AER045Cp"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle fusion with Golgi apparatus "
FT                   /cellular_component="Golgi membrane"
FT                   /protein_id="AAS52729.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0048280"
FT                   /db_xref="HOGENOM:HBG059054"
FT                   /db_xref="HOGENOM:HBG203095"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR006953"
FT                   /db_xref="InterPro:IPR006955"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0000252D91"
FT                   /db_xref="UniProtKB/TrEMBL:Q757G8"
FT                   /transl_table=1
FT                   /translation="MDLIQGLIQPPKAPSVEATIPTLCERIESSTLLSDRRSAILGLKS
FT                   FSRQYRELVVASGLKPLIGTLKRDYEDEDSVKAILETLLILFLRGEGNEDLTRNWAAQY
FT                   SRLQGGKYPSPMLVKKQIEHFDQFSLWIADALTQGEDIVDLLVQLLETDSFHVRLYTIQ
FT                   LLGAIVTTRPEAGNRAIIAIPTGISTLVSLLDDVHDPIRDETVLLLTVLANNNSHIQKL
FT                   VAFENVFDRIFRIIADEGGMRGSLVVSDCLNLLSVILRYNASNQSLFFETSNLPHLGGL
FT                   LDEVLSDEEEFYWNEQRVTNLKTALSIVRRMVEPGNTTTPRHQQLFADTNILMIILRLT
FT                   FFYGTPNSIRPHALLTIADMVRGSPKIQAQLGNIDVPYWDPALPQVVPSSDPVVMPVLD
FT                   LLLRWILFANSIHTFDIRTAALELVKAYLVGNPELQETFLCAQIDLYKKQAEVLSTADQ
FT                   RTSIVAVLLGYDPHADLNPFKLFFSVDLLLFLFKSEDGNAKLRDLFRGIQDGDSAAGEE
FT                   VLSSVQTVVELSVASISSKESRIPISYLSFLIVLLFEDFHTVNEFLSNDSNVKSLLNLV
FT                   PVAQDEGITVKCLVVMLLGVAYEFCTSSSPLPRAQLYESLVATIGVDDYTSKIKQFKEC
FT                   SLFKEVVDSYFDPTFDETGLPKIYFSTYFSELFRENSYRIQSALSRSPDIDPNGKISFE
FT                   AFEELQQRFTTVNKELCELSSSSMEEIHKLELDLRKCQEQYKQLMKAKQESDTQVSDLD
FT                   EKLAQLKTQLDEANSKVEDLSTKKTTLEAAKADCLKKLASHEGQVNSLKNRTTQLEKQL
FT                   ATVSEQKSTAEAGINKMNRELFNLTKEKDSLTAVMNKLQKEGEKKLQEAEKEKVRITQL
FT                   LSQRDRDIENLRNELQDQGTQKKKLEDEHAGLLKEIADLKSQCASQDSLIPKLKEKLKT
FT                   LAESLKDTQNEHATLQKQVGNIQATSHAEITQLNAELQKLKDENVILISRKDELTQELE
FT                   KLQAQTAAGEKQTSDIALLNTQKSELSAKLSRAEKELVNQKAKAEGLFQERAELKDKLN
FT                   TSEKQLQESSQKLSNAQSELNEIRSRLKANEHDLITSRQEAEKLKKQNQQQSSKKDIHK
FT                   LDELSKEADSYKAQVSKLSAELESTMGQLQKSSVEQTDRIENLIKENKDLNTTIATLEK
FT                   EKKAQVVVNAHQENARANNKAVVDNKQKAKSQPATPLVNSKVQELEEQLEALQRKCSEM
FT                   ETLQKEVKELKENATQLESERDDLMLLVSDLDEKNQKYRSRLEELGHPVSSDEEDESEI
FT                   DDNDEDED"
     atggatctaa tacaaggtct gatacagcct ccgaaagctc cgtctgttga agcgactatt        60
     ccgacactat gcgaaagaat cgagagctcg acgttgttaa gcgacaggcg gtctgctatc       120
     ctggggctga aatcgttcag ccggcagtat cgggagctag tagttgcatc ggggctgaag       180
     ccactgattg ggacgctgaa gcgagactac gaagatgagg attcggtgaa ggcgatcttg       240
     gagactctgc tgatcctgtt cctgcggggg gagggaaacg aggacctcac acggaactgg       300
     gcagcacagt attcgaggct gcaggggggc aagtacccct ctccgatgct ggtgaagaag       360
     caaattgagc attttgatca attctcactg tggattgctg acgcgctgac gcaaggcgag       420
     gacattgtgg acttgctggt gcagctactt gagacagata gcttccacgt gcggctttac       480
     acgatccagc tgcttggtgc aattgtgacc acgaggccgg aggccgggaa tagggccatc       540
     attgcgattc ccacggggat ctcgacgttg gtgtcactgc tggacgacgt tcacgatccc       600
     ataagggatg aaactgttct tctgctgact gtgcttgcaa acaacaattc acatattcag       660
     aaactggttg cgtttgagaa tgtatttgat agaatctttc ggattattgc ggacgaaggg       720
     ggcatgcgtg gctcactagt ggtaagtgac tgtctgaacc tgcttagcgt cattctaaga       780
     tataatgcat cgaaccagtc actcttcttt gagacaagca acttacctca cttgggcggc       840
     ctgctagatg aagttctttc tgacgaggag gagttctact ggaacgaaca gcgcgtcaca       900
     aatttgaaga ccgcgctcag cattgtgcgc cgtatggtgg aaccgggcaa cacgacgacc       960
     ccgcggcacc agcagctgtt tgcagatact aatattctga tgattattct gcgcctaacg      1020
     tttttctacg gaacaccaaa ttctattagg ccccatgcac tgctaacaat tgcagatatg      1080
     gttagggggt caccgaaaat ccaggctcag ttaggaaata ttgatgtgcc atactgggat      1140
     ccggctttac cgcaggttgt gcctagctcg gaccccgtgg ttatgcctgt cctggaccta      1200
     cttttacgtt ggattctatt tgccaactct atacacacat ttgacatcag aactgccgca      1260
     ctcgagcttg taaaagcata tctggttggt aatccagaac tacaggaaac ttttctctgt      1320
     gcgcaaattg atctatacaa gaaacaagca gaggtactgt ccaccgccga tcaaagaacc      1380
     agcatagtag cggtcttact tggatatgat ccgcatgcag acctgaatcc atttaagttg      1440
     tttttctcag ttgacctgct cttgtttttg ttcaagtcgg aagatgggaa tgctaaacta      1500
     cgtgatttat tccgtggaat acaagatggc gacagtgcgg ccggtgaaga agtgctttca      1560
     tctgttcaaa cggttgtcga attgtcggta gcatctattt cttcaaagga atcgcgaatc      1620
     cccatatcct atctcagttt ccttatcgtg ttacttttcg aagatttcca tacggtaaac      1680
     gaatttttat ctaatgattc caatgtgaag tcacttttaa accttgtgcc agttgcacaa      1740
     gatgagggaa taactgttaa gtgcttggta gtcatgctac taggtgtagc ttatgaattt      1800
     tgcacgtctt cctcgccact accacgcgcg cagctgtatg aaagcttggt ggcaacgatt      1860
     ggcgtcgatg actacacatc gaaaatcaag caattcaagg aatgttcttt gtttaaggag      1920
     gtcgtcgatt cctattttga tccgaccttt gatgagactg gtttgccaaa gatttacttc      1980
     agtacctatt tctcggagtt atttagggag aactcctacc gtatccaatc cgcactgtcc      2040
     cgtagcccag atatagatcc aaatggcaag atatcctttg aagcctttga ggagctacag      2100
     cagaggttta caactgttaa caaggagttg tgtgaattgt cgtctagtag catggaagaa      2160
     atacacaaat tagaactgga tcttcgcaag tgccaggaac aatacaagca acttatgaag      2220
     gctaagcaag aatcagacac gcaggtatct gatctagatg agaaactggc ccaattgaaa      2280
     actcaattag atgaagctaa ttctaaggtt gaagaccttt cgactaaaaa gaccactttg      2340
     gaagccgcta aagctgattg tttgaagaag ttggcaagcc acgagggtca ggtaaattca      2400
     ttaaagaacc gtacaactca gttggaaaag caactagcca cagtaagcga gcaaaaatcc      2460
     acagccgaag ccgggatcaa taagatgaac agagaacttt ttaacttaac gaaggaaaaa      2520
     gactccttaa ccgcggttat gaataagttg cagaaggaag gtgaaaaaaa actgcaagag      2580
     gcggaaaagg aaaaggtacg tattacccag cttctaagcc agcgtgatag ggatattgaa      2640
     aatctgagga atgaattaca agaccaggga acccaaaaga aaaaactgga ggatgagcat      2700
     gccggacttt taaaagaaat tgcagatttg aaatcacaat gcgctagcca agattcccta      2760
     attccgaagt tgaaagaaaa attgaaaacc ctagcagaat ccctgaaaga tacccaaaat      2820
     gagcatgcta cattgcagaa gcaagtgggc aatattcaag ctacatcgca tgcggagatt      2880
     acgcagttga atgctgaact tcaaaaactg aaagacgaaa atgtcattct tatttcaagg      2940
     aaggatgagc tgactcaaga actagagaag ctgcaggcac agactgcagc aggcgaaaaa      3000
     cagacgagcg atattgccct attgaatact caaaagtccg agctttctgc gaaactatcc      3060
     agagctgaaa aagagcttgt aaaccagaag gctaaagctg agggactatt tcaggaacgc      3120
     gctgagttaa aggataagct taatacttcc gaaaagcagc ttcaggagtc gtcgcaaaaa      3180
     ctttcaaatg cccaatccga actaaatgaa atcagaagca gattaaaggc taacgagcat      3240
     gacttgatta cttcgcggca agaggctgaa aaattgaaga aacaaaacca gcagcagtca      3300
     tcaaagaagg atattcacaa acttgatgaa ctttcaaagg aggcagactc ctataaggca      3360
     caagtatcaa aactatctgc cgaattggaa tcaacaatgg gtcagcttca gaaaagttcg      3420
     gtggaacaaa ctgacaggat cgagaatctg atcaaggaga ataaagacct gaatactacc      3480
     atagctactt tggagaaaga gaaaaaggca caagtagtag taaatgccca tcaagaaaat      3540
     gctagagcaa ataataaagc agttgtggac aataaacaga aggctaaatc tcaacctgcc      3600
     acaccactcg ttaactcaaa ggtgcaagaa ctggaagaac agcttgaagc gttgcagaga      3660
     aagtgtagcg aaatggaaac tttgcagaag gaagtaaaag aactaaagga aaacgctact      3720
     caattagagt cagagcggga tgacttgatg ctacttgtct cggatctaga tgaaaagaat      3780
     caaaaatacc gcagcaggct ggaggaacta ggtcaccctg tcagttcaga tgaagaggat      3840
     gaatcagaga ttgatgataa cgatgaagat gaagactaa                             3879
//

If you have problems or comments...

PBIL Back to PBIL home page