(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE401

ASHGO_5.PE401        Location/Qualifiers
FT   CDS_pept        721434..722048
FT                   /codon_start=1
FT                   /gene_family="HOG000065968" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758050"
FT                   /gene_name="RAD59"
FT                   /locus_tag="AER046W"
FT                   /product="DNA repair protein RAD59 "
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52730.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="HOGENOM:HBG059055"
FT                   /db_xref="HOGENOM:HBG203094"
FT                   /db_xref="InterPro:IPR007232"
FT                   /db_xref="InterPro:IPR016810"
FT                   /db_xref="UniParc:UPI0000252D92"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757G7"
FT                   /transl_table=1
FT                   /translation="MSDYTNVSWDNVTYYGGNGVALDELELKVSWHNRPASSWSVRRIG
FT                   ALQHKIEQYTFKIYHVNRYGKHSLSQVIPTHVLIQFANEAFGYNGWSSAVEEVLITDVK
FT                   QRERVRDGAAIELYTVTAEARVKLTLQDGTNTEATGLSKITLPSKGDAYGKAKKEASAD
FT                   ALKRCLLSFEGIVIEHEQKVASNYYTDGEFGSRKAGDKRDR"
     atgagtgact acacgaatgt ttcatgggac aacgtaacat actatggcgg caatggcgtg        60
     gctttagatg agctcgaact gaaggtgagc tggcacaatc ggcccgccag cagctggtct       120
     gtgcgacgga tcggtgctct gcagcacaag attgagcagt acacgttcaa gatctaccat       180
     gtgaatcggt acgggaagca tagcctttca caggtgatcc cgacacatgt tctgatacag       240
     ttcgcaaatg aggcctttgg gtacaacgga tggtcgtctg ctgtggaaga ggtgctgatc       300
     acagacgtta agcagcggga gcgggttcgc gatggcgcgg ccatcgagct atacacggtt       360
     acggcagagg cgagggtgaa actgacgctg caggatggca cgaatactga ggcgacaggg       420
     ctaagcaaaa taacgctccc gagcaagggc gatgcatacg ggaaggccaa gaaggaggca       480
     tctgcggatg cactgaagag atgtttactc tccttcgagg gtatcgttat tgaacacgaa       540
     cagaaggtcg ctagcaatta ctataccgac ggcgaattcg gatcaaggaa ggcaggcgac       600
     aaacgtgacc gctga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page