(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE403

ASHGO_5.PE403        Location/Qualifiers
FT   CDS_pept        complement(726236..726619)
FT                   /codon_start=1
FT                   /gene_family="HOG000154459" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758052"
FT                   /gene_name="SWC7"
FT                   /locus_tag="AER048C"
FT                   /product="SWR1-complex protein 7 "
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52732.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG124840"
FT                   /db_xref="InterPro:IPR020195"
FT                   /db_xref="UniParc:UPI0000252D94"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757G5"
FT                   /transl_table=1
FT                   /translation="MEYKYNVTLLLLQVVLHRQQELAHQDKTLSQISLLREPVVDTAVL
FT                   ERFSAHRVVRLYAPELCGLRLEELQAVVREVFARGLAGSAEDTPVTLITLANHYYRLRV
FT                   QELELQELPKLKELMESAAGLRT"
     atggaataca agtacaatgt gacgttgctg ctgttgcagg tggtgctgca ccggcagcaa        60
     gagctggcgc accaggacaa gacgttgagc cagataagcc ttctgcgcga gccggtggtg       120
     gacacagcgg tgctggagcg gttcagcgca caccgtgtgg tgcggctgta cgcgcccgag       180
     ctgtgcgggc tgcggttgga ggagctacag gcggtggtgc gcgaggtgtt cgcgcgcggg       240
     ctagcgggca gcgcggagga cacgccggtg acgctgatca cgctggcgaa ccactactac       300
     cggctgcgcg tgcaggagct cgagctgcag gagctgccga agctgaagga gctgatggag       360
     agcgcggcgg ggctgcgcac gtga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page