(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE411

ASHGO_5.PE411        Location/Qualifiers
FT   CDS_pept        join(complement(740906..740943),complement(740412..740847))
FT                   /codon_start=1
FT                   /gene_family="HOG000233454" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758057"
FT                   /locus_tag="AER056C"
FT                   /orf_name="AGOS_AER056C"
FT                   /product="AER056Cp"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="AAS52740.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG492183"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="HSSP:1A3S"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI0000252D9C"
FT                   /db_xref="UniProtKB/TrEMBL:Q757F7"
FT                   /transl_table=1
FT                   /translation="MNSLCLQRLQEERKKWRKDHPFGFWAKPTKKEDGSMNLQKWEAGI
FT                   PGREGTIWKDGVYPITIEYPDDYPSKPPRVKFPAGFYHPNIYPSGTVCLSILNEDQDWK
FT                   PAITMKQILLGVQDLLTSPNPNSPAQEPAWRAYAKNLQEYEKKVLEQARRYAK"
     atgaacagct tatgcctgca gagactgcag gaggagagaa agaaatggcg caaggaccat        60
     ccatttgggt tctgggcgaa gcccaccaag aaggaggacg ggtcgatgaa cttgcagaag       120
     tgggaggcgg gaatccccgg gcgcgagggc acgatttgga aggacggcgt gtacccgatc       180
     acgatcgagt atcccgatga ctacccgtcc aagccgccac gggtgaagtt cccggcgggg       240
     ttctaccacc cgaacatata tccgagtggc acggtgtgcc tgagcatact gaacgaggac       300
     caggactgga agccggcgat cacgatgaag cagatcctgc tgggtgtgca ggacctgctg       360
     acgagcccga acccgaactc gcctgcacag gagccggcgt ggcgggcgta cgcgaagaac       420
     ctgcaggagt acgagaagaa ggtgctggag caggcgcggc ggtacgcaaa gtga             474
//

If you have problems or comments...

PBIL Back to PBIL home page