(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE418

ASHGO_5.PE418        Location/Qualifiers
FT   CDS_pept        750765..750947
FT                   /codon_start=1
FT                   /gene_family="HOG000199609" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20624709"
FT                   /gene_name="COX9"
FT                   /locus_tag="AER063W"
FT                   /product="Cytochrome c oxidase subunit 7A "
FT                   /EC_number="1.9.3.1"
FT                   /function="cytochrome-c oxidase activity"
FT                   /biological_process="respiratory electron transport chain "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial respiratory chain "
FT                   /protein_id="AAS52747.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0005746"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022904"
FT                   /db_xref="HOGENOM:HBG053624"
FT                   /db_xref="HOGENOM:HBG736151"
FT                   /db_xref="InterPro:IPR014368"
FT                   /db_xref="UniParc:UPI0000252DA3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757F0"
FT                   /transl_table=1
FT                   /translation="MSAIAPITGSLKKRIMKDIAVGMGLGTVLGSYWWWGFHKPKIAAR
FT                   ENYYTQLAEQKAAEE"
     atgtcagcga ttgcacctat taccgggagc ctcaagaagc ggattatgaa agatatcgcc        60
     gtcgggatgg gcctgggcac ggtgctgggc agctactggt ggtggggctt ccacaagccc       120
     aagattgccg cgcgggagaa ctactacaca cagctggcgg agcagaaggc ggcggaagag       180
     tag                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page