(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE424

ASHGO_5.PE424        Location/Qualifiers
FT   CDS_pept        763090..763596
FT                   /codon_start=1
FT                   /gene_family="HOG000204790" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777279"
FT                   /locus_tag="AER069W"
FT                   /orf_name="AGOS_AER069W"
FT                   /product="AER069Wp"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS52753.1"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG489199"
FT                   /db_xref="HOGENOM:HBG717354"
FT                   /db_xref="InterPro:IPR008417"
FT                   /db_xref="UniParc:UPI0000252DA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q757E4"
FT                   /transl_table=1
FT                   /translation="MSLYYSLVFAMLVCESAVFALLAVPLPMAVRRPLTRALARPFESA
FT                   TVQMVLKVLLGFVLLLFVDTTNRLYVVNREYERARHVEFAHGRRELLSRKFLAQRNMYL
FT                   TGITLFLTFMLGQTFNLVLELLALKGATERPGATTAAGLRAEIEECEKELARLKAQADA
FT                   LAEDM"
     atgtcgttgt actactcgct ggtgtttgcg atgctggtgt gcgagagcgc ggtgtttgcg        60
     ctgctggcgg tgccgctgcc gatggcggtg cggcggccgc tgacgcgggc gctggcgcgg       120
     ccgttcgagt ctgcgacggt gcagatggtg ctgaaggtgc tgctggggtt cgtgctgctg       180
     ctgttcgtgg acacgacgaa ccggctgtac gtggtgaacc gggagtacga gcgggcgcgg       240
     cacgtggagt ttgcgcacgg gcggcgggag ctgctgtcgc gcaagttcct cgcgcagcgc       300
     aacatgtacc tgacggggat cacgctgttc ctgacgttca tgctggggca gacgttcaac       360
     ctggtgctgg agctgctggc gctgaagggc gcgacggagc ggccgggggc cacgacggcg       420
     gcggggctgc gcgcggagat cgaggagtgc gaaaaggagc ttgcgcggct caaggcgcag       480
     gcggacgcgc tggcagagga tatgtag                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page