(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE429

ASHGO_5.PE429        Location/Qualifiers
FT   CDS_pept        774205..776136
FT                   /codon_start=1
FT                   /gene_family="HOG000095255" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15759133"
FT                   /gene_name="BRE1"
FT                   /locus_tag="AER074W"
FT                   /product="E3 ubiquitin-protein ligase BRE1 "
FT                   /EC_number="6.3.2.-"
FT                   /function="ligase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin modification"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52758.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="HOGENOM:HBG059068"
FT                   /db_xref="HOGENOM:HBG203087"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013956"
FT                   /db_xref="UniParc:UPI0000252DAE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757D9"
FT                   /transl_table=1
FT                   /translation="MEEPAAKRPKLSDRSEPLTQRDVVLFQKEALFRQLNRYRAEARAG
FT                   QVQVEELRRAHGQVGERLAAVCGVVRSVARAVADARGDGDARALCERVAGGDDDEVVAR
FT                   AAEFAAVVAGGLGRGAAAGEGWHRLEAVNSRLAAENAQLAAELGAVRGFYAELLRRYDR
FT                   DESETVRRVFKVEESEPPRAATPVEESSAKGAASDGEAATAVVEREMQIEELQTEIRVL
FT                   EDTVAQLTDWKRLNEQELTKLRQMASSAELSQRHPTPPSSSNLSADLQVLRSKVEKLSH
FT                   ENKELAQLNEAYLGKFQQLSADREIFNNRLSAEFQTAQETLKKHNSNLEKDLVRIRTAR
FT                   DELLSKVAVLEAQKSKSDMLEDLEKMLALQQEQLKALSEHKPEPARDAVMKELQDLEKA
FT                   FKELSQYSNKKYSEYVNQESLMSKLTVEKTKADQKYFAAMRSKDSILIENKNLSKNLSK
FT                   SNELIQQLKDIEKSLQAKIENLNKQLHISRINEKRLLDSNKTTSLKIMDLTSQLSKANK
FT                   SSTLVQQECNKLIEEKAKMESKLNDLEIETKNLATKLTYQENKSKKLHKTLVSNGGDNG
FT                   ALAEELENFRTVVYCSLCSKNWKDTVIKTCGHVFCADCCKERLAARMRKCPTCNKGFSS
FT                   NDLLVVHL"
     atggaggaac cggcggcgaa gagaccgaag ctgtcggatc ggtcagagcc gttgacacag        60
     cgagacgtgg tgctgttcca gaaggaggcg ctcttccggc agctgaaccg gtaccgtgcg       120
     gaggcgcgcg ccgggcaggt gcaggtggag gagctgcggc gggcgcacgg gcaggtgggg       180
     gagcggctgg cggctgtgtg cggggtggtg aggagcgtcg cacgggcggt ggcggacgcg       240
     cgcggcgatg gggacgcgcg cgcgctgtgc gaacgcgtgg ccggaggcga cgatgacgag       300
     gttgtggcgc gcgcagcgga gtttgcggcg gtggtagcgg gcgggctggg gcgcggcgcg       360
     gcggcggggg agggttggca ccggctggag gccgtgaaca gccgactggc ggcggagaac       420
     gcgcagctgg cggcggagct gggggccgtg cgcggcttct acgcggagct gctgcgtcgc       480
     tacgatcgcg acgaaagcga gaccgtgcgg cgcgtgttca aggtggagga gagcgagccg       540
     ccgcgcgccg cgacgccggt ggaggagagc tctgcaaagg gtgctgcgtc cgacggggag       600
     gctgcaaccg cagttgtgga gcgcgagatg cagatcgagg agctgcagac ggagatcagg       660
     gtcctggagg acacggtcgc gcagctgacg gactggaaac ggctcaacga gcaggagctc       720
     acgaagctgc ggcagatggc gagctctgca gagctttcgc agcggcaccc gaccccaccg       780
     agctcgagca acttgtcggc ggatcttcag gtgctccgca gcaaggtaga gaagctcagc       840
     cacgaaaaca aagagctggc gcaacttaac gaagcgtacc tggggaagtt ccagcagctg       900
     tccgcggacc gggaaatatt caataatcgt ctatcagcag agttccagac agcacaggag       960
     acactcaaga aacacaattc gaacctagag aaggatctcg tccgcatacg gacagcgcgc      1020
     gatgagctgc tgagcaaagt ggcagtactc gaggcgcaga aatccaagtc cgacatgctc      1080
     gaggacctgg agaaaatgct tgcacttcag caggaacagc tgaaagcttt gagcgagcac      1140
     aagcctgagc ctgcacggga cgccgttatg aaggagttgc aggatctgga aaaggcattc      1200
     aaggagctat cccagtattc caacaagaag tattccgaat atgttaacca ggagtcgtta      1260
     atgtccaagt tgactgtgga gaaaaccaaa gctgatcaga aatacttcgc ggccatgcgc      1320
     tccaaggatt cgattttaat tgaaaataaa aacctttcaa aaaacctcag caaatcaaac      1380
     gaattgatcc agcagttaaa ggatatcgaa aagtccttac aggcgaagat tgaaaaccta      1440
     aacaaacaac tgcatatatc gcggatcaat gaaaagagac tattagattc caataagaca      1500
     acttcactga agataatgga tctgacttcc cagctgtcga aggccaacaa atcgtccacc      1560
     ctcgttcaac aagaatgtaa caaattaata gaggagaagg ccaagatgga gtcaaagctg      1620
     aatgatcttg agattgaaac caaaaaccta gcaaccaagc tcacatacca ggaaaacaag      1680
     tccaagaaac tgcacaagac gttggtgtcg aacggcggtg ataatggtgc tctagccgaa      1740
     gaactggaaa acttccgcac cgtcgtctac tgctcactgt gctccaaaaa ttggaaggac      1800
     actgtcatta aaacatgtgg tcatgttttc tgtgcagatt gttgcaagga aaggttagca      1860
     gccagaatga ggaaatgtcc gacttgcaac aaggggtttt cttccaatga tctcctcgtt      1920
     gtccatttgt aa                                                          1932
//

If you have problems or comments...

PBIL Back to PBIL home page