(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE441

ASHGO_5.PE441        Location/Qualifiers
FT   CDS_pept        complement(800884..801693)
FT                   /codon_start=1
FT                   /gene_family="HOG000113347" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15759141"
FT                   /gene_name="LOT5"
FT                   /locus_tag="AER086C"
FT                   /product="Protein LOT5"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52770.2"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG059074"
FT                   /db_xref="HOGENOM:HBG202402"
FT                   /db_xref="UniParc:UPI0001DB295D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757C7"
FT                   /transl_table=1
FT                   /translation="MNADRPCCQFVTTKPTVENVTPFAQFQLTQPRLKGVSLQQLSALP
FT                   ILYGGGRNFLFGRFTDSEPQLQDTDLFVLDSCILLWPAHALRGLRIPYDAVIYHAVRRA
FT                   DVLELVLAVERDATLDSLFPPAPGPQPFALSTLELRLRPRYATYDRHYSGAVEQLFTFR
FT                   DFGLNRGDAMVANCNTAIATCMEFHHRAAAADDDDDDDDGPAAHVTPLAELLAPAGHVP
FT                   IYANHGSADDLTDDGLTDDGPQGGAAAGMALAFCSAARVPTKRRRQD"
     atgaacgcgg acagaccctg ctgccagttt gtgaccacca agcccaccgt cgagaacgtc        60
     accccgttcg cccagttcca gctcacacag ccgcgcctca agggtgtcag cctccagcag       120
     ctcagcgcgc tgcccatctt gtacggcggc ggccgcaact tcctcttcgg ccgcttcaca       180
     gacagcgagc cccagctcca ggacacagac ctcttcgtgc tcgactcctg catcctgctc       240
     tggcctgccc acgcgctccg cggcctccgt atcccgtacg acgccgtaat ctaccacgcc       300
     gtgcgccgcg cagacgtgct cgagctcgtg ctcgccgtcg aacgcgacgc cacgctcgac       360
     agcctgttcc cgcctgcgcc cggcccgcag cccttcgcat tgtccacgct cgagctgcgc       420
     ctgcgcccgc gctacgccac ctacgaccgc cactactccg gcgccgtcga gcaactcttc       480
     accttccgcg acttcggcct taaccgtggc gacgccatgg tcgccaactg caacaccgcc       540
     atcgccacct gcatggagtt ccaccaccgc gccgccgccg ccgacgacga cgacgacgac       600
     gatgacggcc ccgccgccca cgtgacccct ctagccgagc tgctcgcccc cgccggtcac       660
     gtgccgattt acgccaacca cggctctgca gatgacctca ccgacgacgg cctcaccgac       720
     gacggcccgc agggtggcgc tgccgccggc atggcgctcg cgttttgctc ggcggctcgc       780
     gtgccaacca agaggcgccg gcaggattag                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page