(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE48

ASHGO_5.PE48         Location/Qualifiers
FT   CDS_pept        complement(81183..82196)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929434"
FT                   /locus_tag="AGOS_AEL298C"
FT                   /product="AEL298Cp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52386.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059097"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001DB296E"
FT                   /db_xref="UniProtKB/TrEMBL:Q758Q1"
FT                   /transl_table=1
FT                   /translation="MLSSIAIDNQHADKTLPPLLLLPPVIHTEAQAAGGTGATTPVSSY
FT                   DAGLAGYGAGYEEGEADAAAEHKPVSPYSETSTTSSSLERLAFLATRKGDGSGQYGAAP
FT                   DAYYVGRQAPAYQTPFYGGTVAPGAARSLTPNGAPRLQYEATYNTPRSPESARGVSMSP
FT                   LMSESASGFQRGDVQRTGSPPNSLLQEPTVITASKYKRQRTGPSCDICRSKKIKCDATI
FT                   TILFQDASVTGSFNEMLHAPVNVSELANEWLSQIPDEVRQALLTKELTLLKHVDKLIAF
FT                   KPCTSCSKRKNCFCTFSKGFTRADINVYTNLCVKFGKRSSIDQFSLNDYRNCGYQV"
     atgctgtcga gcatagcaat cgacaaccag cacgcagaca agacgctgcc gccgctgctg        60
     ctgctgccgc cggtgatcca cacggaggcg caagcggcgg gcggaaccgg cgcgacgacg       120
     ccggtgtcct catacgatgc ggggctggcg ggctacgggg cgggctacga agagggcgag       180
     gcggacgcgg cggcggagca taagcccgtg agcccatact cggagacgtc gacgacgtcg       240
     tcgagtctgg agcgcctggc gtttctggcg acgcgcaagg gtgacgggag cgggcagtac       300
     ggtgctgcgc cggacgcgta ctatgtgggg cggcaggcgc ctgcgtacca aacgccgttc       360
     tacggcggca ccgttgcgcc tggcgcggca cgcagtctca caccgaacgg cgcacccaga       420
     ctacagtacg aagcgacgta taacacgccg cgctcgccag agtccgcgcg cggcgtgtcg       480
     atgtcgccgc tgatgtcgga atctgcttcg ggcttccaac ggggggacgt gcagcgcact       540
     ggttcgccac cgaactcgct gctacaggag ccaaccgtta tcacggcgtc gaagtacaag       600
     cgtcagcgga cgggccccag ctgcgacatc tgccgctcca agaagattaa gtgtgacgcc       660
     acgatcacga tactgttcca ggacgcctcg gtcacaggct cgttcaacga gatgcttcac       720
     gcaccggtaa atgtgtctga gctggcaaac gagtggctta gccagattcc agacgaggtg       780
     aggcaggcgc tgctcacaaa ggaactgacg ctgctgaagc atgtggataa gttgatagca       840
     ttcaagcctt gcacttcgtg ttccaaacgg aagaattgct tctgcacgtt tagcaagggc       900
     tttacgaggg cggacatcaa tgtgtataca aacctctgcg tcaaattcgg caaacgcagc       960
     tccattgatc agttcagcct gaatgattat agaaactgtg gttaccaggt atga            1014
//

If you have problems or comments...

PBIL Back to PBIL home page