(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE5

ASHGO_5.PE5          Location/Qualifiers
FT   CDS_pept        9427..10608
FT                   /codon_start=1
FT                   /gene_family="HOG000246415" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15755763"
FT                   /locus_tag="AEL341W"
FT                   /orf_name="AGOS_AEL341W"
FT                   /product="AEL341Wp"
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="AAS52343.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG380413"
FT                   /db_xref="HOGENOM:HBG754729"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0000252C17"
FT                   /db_xref="UniProtKB/TrEMBL:Q758U3"
FT                   /transl_table=1
FT                   /translation="MGVLPTDKFATKAIHAGAHTDLHGSVIEPISLSTTFKQSSPGNPV
FT                   GAYEYSRGQNPNRQNLEEAIAALESAKYGLAFSSGSATTAVIVQSLPQGSHAISIGDVY
FT                   GGTHRYFTKVANAHGVETSFTNSLLEDLPKLVRDNTRLVWIESPTNPTLQVTDIQQVAD
FT                   TVKALNEDIILVVDNTFLSPYLSNPLNFGADIVIHSATKYINGHSDVVLGALATNSTSL
FT                   YERLAFLQNAIGAIPSPFDAWLTHRGLKTLHLRVRQAAQSAQKIAEYLEQSEHVVSVNY
FT                   PGLPSHRGYQIAQKQHRDGLGGGMISFRVKGGAQGAALLSQSTRLFTLAESLGGIESLL
FT                   EVPAVMTHAGIPKEAREASGVYDDLVRVSVGIEDTDDLLEDIKQALSVVAESI"
     atgggtgttc ttccgacaga caagtttgca acgaaagcta ttcatgctgg cgcacatact        60
     gacctacatg ggtcggtcat cgagcccatc tcgctttcga ccaccttcaa gcagtcgagt       120
     cccggcaacc cagtgggcgc ctacgaatac tctcgtggtc agaaccccaa ccgtcagaac       180
     ctagaggaag ccattgctgc actcgagagc gcaaagtacg ggttggcttt ctcctctgga       240
     tccgcgacca cagccgtgat agtgcagtct ctgccacaag gctcgcacgc gatctcgatc       300
     ggcgatgtct atggtgggac ccatcgctac tttacaaagg ttgccaatgc ccatggtgtg       360
     gagacctcct tcacaaatag cctgcttgag gacctgccta agctggtccg cgacaacact       420
     cgtctagtct ggatcgagtc tcccaccaac cccactctgc aggtcactga tatccagcag       480
     gttgcggaca ccgtgaaggc cttgaatgag gacattattc tggttgtgga caacacattc       540
     ctctccccat acctgtcgaa cccgctcaac ttcggtgctg acatcgtcat ccattcggct       600
     acaaagtaca tcaatggcca ctccgacgtt gtgcttggtg ctttagccac gaactccacc       660
     agtttatatg aacggcttgc attcctacaa aatgccattg gcgccatccc atcgccgttc       720
     gacgcatggc tgacacacag aggcctaaaa accttgcacc tgcgtgtgcg ccaggctgct       780
     cagtctgctc agaaaattgc tgagtacctg gagcagtcag agcacgttgt gtctgttaac       840
     tacccgggcc tgccctcgca ccgcggctac cagattgctc agaaacagca cagagatggt       900
     ttgggcggcg gtatgatctc attccgtgtt aagggcggcg cgcagggcgc tgctctactt       960
     tctcaatcca ccagactatt tactctagct gagtctctag gcggcattga gtccttgttg      1020
     gaggtccctg cggtaatgac tcatgctggc attccgaagg aggccagaga ggcttctggt      1080
     gtctacgacg atctggtcag agtctccgtg ggaattgagg acactgatga ccttctggag      1140
     gacatcaagc aggcgctgag tgtagtcgct gaatctatct aa                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page